TCONS_00044209-protein (polypeptide) - C. hemisphaerica

Overview


Name	TCONS_00044209-protein
Unique Name	TCONS_00044209-protein
Type	polypeptide
Organism	Clytia hemisphaerica (Jellyfish)
Sequence length	381

Sequence

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>TCONS_00044209-protein ID=TCONS_00044209-protein|Name=TCONS_00044209-protein|organism=Clytia hemisphaerica|type=polypeptide|length=381bp
EVIGVTTSLMVLLSLFTVVGNLMVIYIFVKHKNLQIAKNYFILSLAIADV
FIGTFSINFYNVYLAFGGWPFGNISCDLWLSMDYSCCNVSTLTLLAISIE
RFVGVHYTAFHRNQFTKKRLKRTIFIIWLISFLVWFPAIFAYPYIHGERT
VKDGQCYVQFLYESPSMTIVTAFINFYGPIIFMVIIYILISRTLIKRYKR
KYHLRENSIPPETSSERRPSSSRERKYSVRPSIASTTVISPERRPTIATI
IGSPSEMDRMRKSYESIVSGDANSNSKRKPNKPKTQREKDYLSHKRAITL
LLLIIGAFAITWFPYNLMAVIAPFCRKCIHADWWHFGYIFCYVNSLLNPL
CYAFGNRHFKKYIKEIFVAIKKRICCPKAGS

Run BLAST on NCBI

Gene-mRNA-Prot

This polypeptide comes from the following gene feature:


Feature Name	Unique Name	Species	Type
XLOC_027853	XLOC_027853	Clytia hemisphaerica	gene

This polypeptide derives from the following transcript feature(s):


Feature Name	Unique Name	Species	Type
TCONS_00044209	TCONS_00044209	Clytia hemisphaerica	transcript

Annotated Terms

The following terms have been associated with this polypeptide:

Vocabulary: **INTERPRO**
Term	Definition
IPR000276	GPCR_Rhodpsn
IPR000995	Musac_Ach_rcpt
IPR017452	GPCR_Rhodpsn_7TM

Vocabulary: **Biological Process**
Term	Definition
GO:0007186	G-protein coupled receptor signaling pathway

Vocabulary: **Molecular Function**
Term	Definition
GO:0004930	G-protein coupled receptor activity
GO:0016907	G-protein coupled acetylcholine receptor activity

Vocabulary: **Cellular Component**
Term	Definition
GO:0016021	integral component of membrane
GO:0005887	integral component of plasma membrane

GO Annotation

GO Assignments

This polypeptide is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0007186	G-protein coupled receptor signaling pathway
cellular_component	GO:0016021	integral component of membrane
cellular_component	GO:0005887	integral component of plasma membrane
molecular_function	GO:0016907	G-protein coupled acetylcholine receptor activity
molecular_function	GO:0004930	G-protein coupled receptor activity

InterPro

Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR000276	G protein-coupled receptor, rhodopsin-like	PRINTS	PR00237	GPCRRHODOPSN	coord: 83..105 score: 28.18 coord: 5..29 score: 25.27 coord: 297..321 score: 26.45 coord: 119..140 score: 24.93 coord: 334..360 score: 29.65 coord: 168..191 score: 22.52 coord: 38..59 score: 30.89
IPR000276	G protein-coupled receptor, rhodopsin-like	SMART	SM01381	7TM_GPCR_Srsx_2	coord: 14..367 e-value: 0.0095 score: -69.0
IPR000276	G protein-coupled receptor, rhodopsin-like	PFAM	PF00001	7tm_1	coord: 20..352 e-value: 7.6E-63 score: 212.1
IPR000276	G protein-coupled receptor, rhodopsin-like	PROSITE	PS00237	G_PROTEIN_RECEP_F1_1	coord: 89..105
IPR000995	Muscarinic acetylcholine receptor family	PRINTS	PR00243	MUSCARINICR	coord: 53..63 score: 52.57 coord: 324..342 score: 45.77 coord: 2..14 score: 26.76
None	No IPR available	GENE3D	1.20.1070.10		coord: 3..380 e-value: 3.5E-79 score: 265.6
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 209..230
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 269..290
None	No IPR available	SUPERFAMILY	81321	Family A G protein-coupled receptor-like	coord: 7..226 coord: 293..373
IPR017452	GPCR, rhodopsin-like, 7TM	PROSITE	PS50262	G_PROTEIN_RECEP_F1_2	coord: 20..352 score: 36.701

Blast

[Close]

BLAST of TCONS_00044209-protein vs. Swiss-Prot (Human)
Match: ACM1 (Muscarinic acetylcholine receptor M1 OS=Homo sapiens GN=CHRM1 PE=1 SV=2)

HSP 1 Score: 229.18 bits (583), Expect = 5.494e-71
Identity = 143/419 (34.13%), Postives = 203/419 (48.45%), Query Frame = 0

Query:    3 IGVTTSLMVLLSLFTVVGNLMVIYIFVKHKNLQIAKNYFILSLAIADVFIGTFSINFYNVYLAFGGWPFGNISCDLWLSMDYSCCNVSTLTLLAISIERFVGVHYTAFHRNQFTKKRLKRTIFIIWLISFLVWFPAIFAYPYIHGERTVKDGQCYVQFLYESPSMTIVTAFINFYGPIIFMVIIYILISRTLIKRYKRKYHLRENSIP--------------------PET-----------------------------SSERRPSSSRERKYSVRPSIASTTVISPE-RRPTIATIIGSPSEMDRMRKSYESIVSGDANSNSKRKP-NKPKTQREKDY--LSHKRAITLLLLIIGAFAITWFPYNLMAVIAPFCRKCIHADWWHFGYIFCYVNSLLNPLCYAFGNRHFKKYIKEIFV 368
            IG+TT L   LSL TV GNL+V+  F  +  L+   NYF+LSLA AD+ IGTFS+N Y  YL  G W  G ++CDLWL++DY   N S + LL IS +R+  V     +R + T +R    I + WL+SF++W PAI  + Y+ GERTV  GQCY+QFL + P +T  TA   FY P+  M  +Y  I R    R +    L+ +  P                    PET                             S E   SS  E   S    +    ++ PE + PT      SP+ + R  K       G   +   +KP  K +  + K +  +  K+A   L  I+ AF +TW PYN+M +++ FC+ C+    W  GY  CYVNS +NP+CYA  N+ F+   + + +
Sbjct:   28 IGITTGL---LSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQ-PIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGS--EVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTK------KGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLL 434

The following BLAST results are available for this feature:

BLAST of TCONS_00044209-protein vs. Swiss-Prot (Human)

BLAST of TCONS_00044209-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1


Match Name	E-value	Identity	Description
ACM1	5.494e-71	34.13	Muscarinic acetylcholine receptor M1 OS=Homo sapie...	[more]

You are here

TCONS_00044209-protein (polypeptide) - C. hemisphaerica