|
|
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00059688-protein ID=TCONS_00059688-protein|Name=TCONS_00059688-protein|organism=Clytia hemisphaerica|type=polypeptide|length=342bp
MSESKPDISEVAAFDSSKLKHVETEEKNTLPSSDLIQEEAVESRSEVKVF
DKSNLKSVETVEKNTLPTAATLKEETRPEVLPDVSGVAEFDASKLKHVET
EEKTVLPTSDVIQEEAVESRAEVKVFDKSNLKSVETVEKNTLPTAATLKE
ETRPESLPDVSGVAEFDASKLKHVETEEKSVLPTADVIKEESVESRSEVK
AFDKSKLKSVDTEEKNTLPTAATLKEETRPEVLPDVSAVKDFDKGQLKES
KTEEKAVLPTKEVIDEEKRESRAEVKAFDKSNLKKVETVEKNSPPTAEGK
TSETVQSENKKPEVSSEASSPSEPTPTTTNESENKKKGCTIL Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
This polypeptide derives from the following transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
| Term | Definition |
|---|
| IPR001152 | Beta-thymosin |
Vocabulary: Biological Process
| Term | Definition |
|---|
| GO:0007015 | actin filament organization |
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0003785 | actin monomer binding |
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
| Category |
Term Accession |
Term Name |
| biological_process |
GO:0007015 |
actin filament organization |
| molecular_function |
GO:0003785 |
actin monomer binding |
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR001152 | Beta-thymosin | SMART | SM00152 | THY_2 | coord: 236..272
e-value: 0.032
score: 22.4
coord: 121..156
e-value: 0.028
score: 22.8
coord: 273..313
e-value: 0.43
score: 13.9
coord: 160..196
e-value: 0.0017
score: 27.7
coord: 45..79
e-value: 0.077
score: 19.5
coord: 8..44
e-value: 6.7E-6
score: 35.6
coord: 84..120
e-value: 0.02
score: 23.9
coord: 197..231
e-value: 0.096
score: 18.8 |
| IPR001152 | Beta-thymosin | PFAM | PF01290 | Thymosin | coord: 45..75
e-value: 1.1E-8
score: 34.6
coord: 121..151
e-value: 2.1E-8
score: 33.7
coord: 157..192
e-value: 5.8E-14
score: 51.4
coord: 5..39
e-value: 1.4E-13
score: 50.2
coord: 233..270
e-value: 9.7E-12
score: 44.3
coord: 81..115
e-value: 1.9E-13
score: 49.8
coord: 197..227
e-value: 5.9E-10
score: 38.6
coord: 273..298
e-value: 6.3E-7
score: 28.9 |
| IPR001152 | Beta-thymosin | PRODOM | PD005116 | | coord: 158..188
e-value: 0.006
score: 95.0
coord: 5..39
e-value: 1.0E-5
score: 119.0
coord: 82..115
e-value: 8.0E-4
score: 103.0
coord: 234..268
e-value: 2.0E-4
score: 108.0 |
| None | No IPR available | GENE3D | 1.20.5.520 | | coord: 158..191
e-value: 1.0E-12
score: 47.3
coord: 270..308
e-value: 1.7E-8
score: 33.7
coord: 82..115
e-value: 1.3E-12
score: 46.9
coord: 234..269
e-value: 3.1E-10
score: 39.3
coord: 118..152
e-value: 5.0E-10
score: 38.6
coord: 4..39
e-value: 9.8E-15
score: 53.7
coord: 42..76
e-value: 8.6E-10
score: 37.9
coord: 194..228
e-value: 2.0E-10
score: 39.9 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 200..342 |
Blast
The following BLAST results are available for this feature:
|
