|
|
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00035393-protein ID=TCONS_00035393-protein|Name=TCONS_00035393-protein|organism=Clytia hemisphaerica|type=polypeptide|length=224bp
MECDDLITVQVFDDEEAARLSFENPEQVPTRHSNQGPENIPVKGTKGSRL
NGYHLFYKGSSSTIVKDSSQKRTTPPTLGEMSKIGGRNWKKLQPEARKEW
IQKGREERERRREQGVTKFKCGKCEKTFNGEKYMHHHENSCGEAICFIDN
CGKKFTSTILLKKHQKTHDKTYECAECGKSFSTKQILKVHMISHTEGIPC
ALCGRHFTNQSNLTRHTKTIHHSR Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
This polypeptide derives from the following transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0003676 | nucleic acid binding |
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
| Category |
Term Accession |
Term Name |
| molecular_function |
GO:0003676 |
nucleic acid binding |
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR013087 | Zinc finger C2H2-type | SMART | SM00355 | c2h2final6 | coord: 119..139
e-value: 100.0
score: 4.3
coord: 144..168
e-value: 0.13
score: 21.3
coord: 198..221
e-value: 0.013
score: 24.7
coord: 172..194
e-value: 8.5E-4
score: 28.6 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS00028 | ZINC_FINGER_C2H2_1 | coord: 174..194 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS00028 | ZINC_FINGER_C2H2_1 | coord: 200..222 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 198..224
score: 12.03 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 172..199
score: 13.484 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 144..173
score: 9.93 |
| IPR013087 | Zinc finger C2H2-type | SUPERFAMILY | 57667 | beta-beta-alpha zinc fingers | coord: 167..216 |
| IPR013087 | Zinc finger C2H2-type | SUPERFAMILY | 57667 | beta-beta-alpha zinc fingers | coord: 119..168 |
| None | No IPR available | PFAM | PF00096 | zf-C2H2 | coord: 146..168
e-value: 0.0014
score: 18.9
coord: 172..194
e-value: 1.3E-4
score: 22.1
coord: 199..221
e-value: 3.3E-5
score: 24.0 |
| None | No IPR available | GENE3D | 2.10.69.10 | | coord: 155..184
e-value: 2.4E-13
score: 49.6 |
| None | No IPR available | GENE3D | 3.30.160.60 | | coord: 106..130
e-value: 0.032
score: 13.7 |
| None | No IPR available | GENE3D | 3.30.160.60 | | coord: 185..222
e-value: 9.1E-14
score: 51.1
coord: 131..154
e-value: 8.4E-6
score: 25.6 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 21..45 |
| None | No IPR available | CDD | cd00084 | HMG-box | coord: 50..103
e-value: 9.51051E-5
score: 37.5984 |
| IPR009071 | High mobility group box domain | PFAM | PF00505 | HMG_box | coord: 50..113
e-value: 5.8E-6
score: 26.5 |
| IPR009071 | High mobility group box domain | GENE3D | 1.10.30.10 | | coord: 44..105
e-value: 2.4E-9
score: 37.1 |
| IPR009071 | High mobility group box domain | SUPERFAMILY | 47095 | HMG-box | coord: 50..113 |
Blast
The following BLAST results are available for this feature:
|
