|
Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00019572 ID=TCONS_00019572|Name=TCONS_00019572|organism=Clytia hemisphaerica|type=transcript|length=2495bpRun BLAST on NCBI protein sequence of TCONS_00019572-protein >TCONS_00019572-protein ID=TCONS_00019572-protein|Name=TCONS_00019572-protein|organism=Clytia hemisphaerica|type=polypeptide|length=398bp MDAISNCSRLSVLDLQHSPNISDSSLLAASAILKKNLVVLKISGASKITDRun BLAST on NCBI transcript from alignment at sc0000331:233902..248155+ Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00019572 ID=TCONS_00019572|Name=TCONS_00019572|organism=Clytia hemisphaerica|type=transcript|length=14254bp|location=Sequence derived from alignment at sc0000331:233902..248155+ (Clytia hemisphaerica) Coding sequence (CDS) from alignment at sc0000331:233902..248155+ >TCONS_00019572 ID=TCONS_00019572|Name=TCONS_00019572|organism=Clytia hemisphaerica|type=CDS|length=9576bp|location=Sequence derived from alignment at sc0000331:233902..248155+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2
Annotated Terms
The following terms have been associated with this transcript:
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00019572 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 0
|
