|
|
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00020107-protein ID=TCONS_00020107-protein|Name=TCONS_00020107-protein|organism=Clytia hemisphaerica|type=polypeptide|length=661bp
GQGLKFLKLKKDLCQWKIIKGKKMNKRNVKKKFAQSFQGNFGKNDSDSKE
GNVPYAILKAARHSGQLNLSGRSLTSVPDKVYRINIDVPDEAKSTSMADT
DERWWDQVDLRKLILASNQLSEISGEIKNLPVLNVLDIHDNVIEKLPEEI
GELKELSKLHLSHNKLSCFPNSFCNLVALKSLLLSGNVIEKLPEDIGYLV
NVEELDLAQNKLTGLPESIGNMKCLKKLNLTKNQITDLPVTFEYLTGLRD
LDLSSNKLTTLPSGFGKLTSLEIVECRYNLISSISKFTESANIKQLFLGY
NRLRELPEDIFGDFPQLVSLDLRDNSISKLPESLLELKMLERIDLTNNNI
SGLPYVLGHMKLKALTLDGNPMRGIRRDIIARGTQAILEYLRSRMPIPEP
KEEIVESPKKSETVADNNSTNESQIKPARFDGESKVQSSDASKQNHPKEP
SKAVVDQYLIATTKVLTHNNGSSNIPESVWLPGAKISNINFSKNTLSEFP
SEIMQYKESLSEINISHNRITALPALIGDLSKLTFIDLSNNMLQALPEEI
KVLPHLLQIVLSFNRFTTMPKPMFEMKSLQTILMANNQLSDIDVDGLLQL
KTVQTLDLSNNNIARIPPQLGNVEWLKSLNLDGNSFRSPRPQILMKGTQF
ILGYLRDRIPT Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
This polypeptide derives from the following transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0005515 | protein binding |
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
| Category |
Term Accession |
Term Name |
| molecular_function |
GO:0005515 |
protein binding |
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | PRINTS | PR00019 | LEURICHRPT | coord: 248..261
score: 54.32
coord: 530..543
score: 46.4 |
| None | No IPR available | SMART | SM00365 | LRR_sd22_2 | coord: 153..178
e-value: 180.0
score: 5.2
coord: 199..224
e-value: 28.0
score: 12.0
coord: 530..552
e-value: 260.0
score: 4.1
coord: 314..336
e-value: 410.0
score: 2.5
coord: 600..625
e-value: 260.0
score: 4.0
coord: 337..355
e-value: 610.0
score: 1.0
coord: 245..276
e-value: 53.0
score: 9.6 |
| None | No IPR available | SMART | SM00364 | LRR_bac_2 | coord: 176..195
e-value: 260.0
score: 3.0
coord: 337..356
e-value: 620.0
score: 0.0
coord: 225..241
e-value: 150.0
score: 4.7
coord: 314..333
e-value: 100.0
score: 6.0
coord: 553..572
e-value: 95.0
score: 6.3
coord: 153..172
e-value: 66.0
score: 7.4
coord: 530..549
e-value: 45.0
score: 8.7
coord: 245..264
e-value: 98.0
score: 6.1
coord: 290..309
e-value: 9.5
score: 13.9
coord: 507..526
e-value: 6.2
score: 15.3
coord: 199..218
e-value: 120.0
score: 5.5 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 399..452 |
| IPR003591 | Leucine-rich repeat, typical subtype | SMART | SM00369 | LRR_typ_2 | coord: 199..221
e-value: 4.6
score: 16.0
coord: 222..244
e-value: 19.0
score: 10.9
coord: 291..313
e-value: 8.2
score: 14.0
coord: 530..552
e-value: 8.0
score: 14.1
coord: 314..336
e-value: 37.0
score: 8.6
coord: 337..359
e-value: 9.2
score: 13.6
coord: 176..197
e-value: 15.0
score: 11.8
coord: 245..268
e-value: 0.0032
score: 26.7
coord: 553..576
e-value: 15.0
score: 11.8
coord: 130..151
e-value: 63.0
score: 6.7
coord: 600..623
e-value: 0.99
score: 18.4
coord: 153..175
e-value: 2.3
score: 17.2 |
| IPR032675 | Leucine-rich repeat domain, L domain-like | GENE3D | 3.80.10.10 | | coord: 584..652
e-value: 2.4E-11
score: 42.8
coord: 180..232
e-value: 1.9E-16
score: 59.4 |
| IPR032675 | Leucine-rich repeat domain, L domain-like | GENE3D | 3.80.10.10 | | coord: 463..583
e-value: 4.0E-22
score: 77.6 |
| IPR032675 | Leucine-rich repeat domain, L domain-like | GENE3D | 3.80.10.10 | | coord: 30..179
e-value: 2.0E-19
score: 68.8 |
| IPR032675 | Leucine-rich repeat domain, L domain-like | GENE3D | 3.80.10.10 | | coord: 233..462
e-value: 1.7E-39
score: 134.6 |
| IPR032675 | Leucine-rich repeat domain, L domain-like | SUPERFAMILY | 52058 | L domain-like | coord: 66..377 |
| IPR032675 | Leucine-rich repeat domain, L domain-like | SUPERFAMILY | 52058 | L domain-like | coord: 464..638 |
| IPR001611 | Leucine-rich repeat | PFAM | PF13855 | LRR_8 | coord: 554..613
e-value: 2.4E-7
score: 30.3
coord: 133..189
e-value: 1.2E-8
score: 34.5
coord: 225..274
e-value: 1.0E-8
score: 34.7
coord: 292..350
e-value: 1.4E-10
score: 40.7 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 602..623
score: 7.111 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 625..646
score: 5.255 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 109..130
score: 7.104 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 339..360
score: 6.341 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 316..338
score: 7.512 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 555..576
score: 4.501 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 270..291
score: 5.117 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 201..222
score: 6.48 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 178..199
score: 6.888 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 532..553
score: 6.703 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 292..313
score: 6.156 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 224..246
score: 7.196 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 247..269
score: 7.35 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 155..176
score: 7.034 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 132..153
score: 6.341 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 578..599
score: 6.588 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 509..530
score: 6.98 |
Blast
BLAST of TCONS_00020107-protein vs. Swiss-Prot (Human)
Match: LRC40 (Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1) HSP 1 Score: 453.751 bits (1166), Expect = 1.762e-152 Identity = 253/636 (39.78%), Postives = 388/636 (61.01%), Query Frame = 0
Query: 29 VKKKFAQSFQGNFGKNDSDSKEGNVPYAILKAARHSGQLNLSGRSLTSVPDKVYRINIDVPDEAKSTSMADTDERWWDQVDLRKLILASNQLSEISGEIKNLPVLNVLDIHDNVIEKLPEEIGELKELSKLHLSHNKLSCFPNSFCNLVALKSLLLSGNVIEKLPEDIGYLVNVEELDLAQNKLTGLPESIGNMKCLKKLNLTKNQITDLPVTFEYLTGLRDLDLSSNKLTTLPSGFGKLTSLEIVECRYNLISSISKFTESANIKQLFLGYNRLRELPEDIFGDFPQLVSLDLRDNSISKLPESLLELKMLERIDLTNNNISGLPYVLGHMKLKALTLDGNPMRGIRRDIIARGTQAILEYLRSRMPIPEPKEEIVESPKKSETVADNNSTNESQIKPARFDGESKVQSSDASKQNHPKEPSKAVVDQYLIATTKVLTHNNGSSN-IPESVW--LPGAKISNINFSKNTLSEFPSEIMQYKESLSEINISHNRITALPALIGDLSKLTFIDLSNNMLQALPEEIKVLPHLLQIVLSFNRFTTMPKPMFEMKSLQTILMANNQLSDIDVDGLLQLKTVQTLDLSNNNIARIPPQLGNVEWLKSLNLDGNSFRSPRPQILMKGTQFILGYLRDRIPT 661
+K+ Q + F D +VP +LKAAR SGQLNLSGR+L+ VP V+RIN+D+P+EA ERWW+Q DL KLI+++N+L ++ +++ LP L VLDIHDN + LP I EL+ L KL++SHNKL P NL LK L L N + + E L N+E+LDL+ N LT +P S ++ L +LNL+ N++ LP + L+ LD +SN L T+P + SLE++ R N + + +F + +K+L +G N++ L + ++ LDLRDN + +P+ ++ L+ LER+DL+NN+IS LPY LG++ LK L L+GNP+R IRR+II++GTQ +L+YLRS++ + DG S+ S+++ + PS++ V+ + I T K+L +++ + IP+ V+ + +++INFSKN L E P +++ KE +S++++S N+++ + + L KLTF+DL NN L +LPEE++ L L I LSFNRF +P+ ++ + +L+TIL++NNQ+ +D + ++ + TLDL NN++ +IPP+LGN L++L LDGN FR PR ILMKGT IL YLRDRIPT
Sbjct: 4 LKRIAGQDLRAGFKAGGRDCG-TSVPQGLLKAARKSGQLNLSGRNLSEVPQCVWRINVDIPEEANQNLSFGATERWWEQTDLTKLIISNNKLQSLTDDLRLLPALTVLDIHDNQLTSLPSAIRELENLQKLNVSHNKLKILPEEITNLRNLKCLYLQHNELTCISEGFEQLSNLEDLDLSNNHLTTVPASFSSLSSLVRLNLSSNELKSLPAEINRMKRLKHLDCNSNLLETIPPELAGMESLELLYLRRNKLRFLPEFPSCSLLKELHVGENQIEMLEAEHLKHLNSILVLDLRDNKLKSVPDEIILLRSLERLDLSNNDISSLPYSLGNLHLKFLALEGNPLRTIRREIISKGTQEVLKYLRSKI---------------------------------KDDGPSQ---SESATETAMTLPSESRVNIHAIITLKILDYSDKQATLIPDEVFDAVKSNIVTSINFSKNQLCEIPKRMVELKEMVSDVDLSFNKLSFISLELCVLQKLTFLDLRNNFLNSLPEEMESLVRLQTINLSFNRFKMLPEVLYRIFTLETILISNNQVGSVDPQKMKMMENLTTLDLQNNDLLQIPPELGNCVNLRTLLLDGNPFRVPRAAILMKGTAAILEYLRDRIPT 602
The following BLAST results are available for this feature:
|
