Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001345 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001345
Unique NameTCONS_00001345
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3176

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001345 ID=TCONS_00001345|Name=TCONS_00001345|organism=Clytia hemisphaerica|type=transcript|length=3176bp
ACTCTTGTTACAAGAGCCGACCGCAGAAGTCATTTGGCGCCATTCTTTTT
TCGCTAATTTTGATTTGACAAAGAAATCTACCCTGGGTTTTCAAGATACT
CGCAACCTGCCTTGTTCAAGTGTTGGGTGTTTCGTGTCAAAAAAAGCTTC
GAAAATGGCGAACATTGAAGAGGCTGAAATCACCTTTCAACAACAAGAAC
CTGCACAGAATGAACCCCCTGCAGATTTATCCAGCTTTCAATTTGTTCCT
GAAAAAATTGTGGATTTTTCCATTCTACAGGATGGCCAACGTTCTTATTG
TGTCCGTTGGAAGGATTCCTGGCTGACTGAAGAGCTTCTCTCCCTAACCT
ACCAACACCTTATCAACGAGTTCTGGTCAACCGCAGCTGCCAATGTCAAC
AAAGAGCAGACagaaaaagtgaagaaatcGAAAGCAACcaacataaaaat
cataaataagcAGGATAACTATGAAGCTGTGTCTGTCCAGCCGCAATATC
AGACAACATCCATAACAGTAACTTCACCGGGAAGTGCAACCCAACAGCTG
GTTGATAATGAAGCTAATCTTAAAGAAATGACTGAAACTACTGCAGCAGC
TCAACTTATAGACCACTCTGGTATCCTAAAACAACAAGTAATACCAAAGA
TTCCTGATCAAACTGGTATCAATGCCAATACATTAAGCTCGATGGTTGTT
ACTAGTGATGTCACCTTAGCTGCTTATCCAAACGAAGCCAACCCTCCAAC
CATGATTCCACAGCAACCAACCATACCAAAATACCAACAGGCTCTTCAAC
AGTCGATCTCGATCCAACAACAACAATTAAACCCCGATTCTGAAACAGGA
AAAGTCACGTTTCCAAAACACGTTTTCTCTCAAGCTCGATTTGTTAATAA
AAAGCAACAGCAAACTCTTGTGTCTTCCGAACAGCCACGAGTCAACTGTG
ATATTTGTCAGAAATCCTTGAAAACCAAGAAAATGTTGTGGGCACATAAA
GTTGCTGTTCATTTCGGTGGTAATTTTCCCTGTGAGATTTGTGGCAAGAA
ATGTATAACTGGTGCTGAGTTGAGACGTCACATGACATCCCATTCGACCG
AGCGTCGTTTCGTTTGCCAGTATTGTGGATTAGCCTATAAACGATGGTCA
CACTTGTATCAGCATTTGCGTGTTCACgaagaagagaaaaatttccGTTG
TGATGTTTgtcatttgaatttcaaagtTCAGTCTGAATTGAAGGATCATT
GTTTTGCTGAGCACTCGGACGGTAAAATGGTCCAGTGTAGTGTATGTAAA
CATAAGCTACAAACACCTCTTGCCGTTTATCATCATAGTATGAAACACAC
AGGTACTCGTGACTTCATTTGCGAGATTTGTGGCTCGAATTTCAAACGAA
AACAACATCTGGTTACTCACATGAAAACACATTTGACGGAAAAGAAAGCA
ACCGATGGTAGTGAAGAAGTGTATCATTGTCAAGCTTGCGATGAAAGTTT
CACGTTAAAAATGGATCTGAAAGCACATTGCACAGCCGCACATCCTTTGC
TGGGAGACGAGAGCGTAGCTTGTAGAACATGTCAAAAGAGACTGAAAGTA
TCACATTCAGTTTATCTACACGGCTTACGTCATTTTGGTGCACGTGACTT
CAAATGTACGTTATGTAACCAGTTCTTTAAAAGGAAAGCCCATTTATTAC
GTCATTCATTAGATCGTCATCCAGAACAACCGAGAGAACGAAAAAAACGA
ACAGTCCAAGTCGATGGAATCACATGCGATCTTTGCCAGAAATCTTTCAA
GTACAAGAACGCACTCGTCAAACACATGACAACCCAACACGGAATATTAC
CATCTCAAGACCCAAGTACTGAACTTGGCATTGTCGTCAAAAAAGGAATC
AAACGTCCTCACAAATGTGACGTATGTAGCAAACGTTTCAAATCCAAAAA
TGGTCTCGCTAAGCATAAGGTTAATAAACATTCGTTGGAAAGTGAAAACA
GTATTGTGATTCTTGGTGAAGACGGCTCAAAGGATTTGGAGGAGAAAGGA
AACGTTCGCGAAGAAGATGAAGTCGACGATGACGATGACGAAGATATCGA
AACAGATTCTGAAACTGAAACGCCTCAGATACTGCAAAACCAAGCTATTG
CTGAACCACAATTACTTCAAAACCAATCAGTCGAATTATCTTCATCTTCT
CGGCAAAAAAGTGAACCCATGGAAGTTGACCAACAACAACCAGAGATGGT
GGACCATGACGACAATGTGTTACATGAGTTGGATGTTACGACAAACAGCG
ATGATAAGGATGCTACCAATAATTTCCGTGTAGTTCCTATTGAGCATTTC
AATACTTCAACTGGAGCAGGGACTTCCAATGTGGGCTCATCAGCTGATAA
CGTACCACACCAAGTAATCACTGTAGACGAAGCTACCGGTCAAATCATCC
TGATGACAACAAATGCACCACCATCCAACCAACAAGATGTGAAAGACAAC
AAAACCGGACCGTCGGATGTGGGTACAAACCAGATTATACCTGTCGATGA
TGCATCCAGAGCCTCACCGATCATCACAGTACGAGAATCCGATCAATCAA
CGAGTGCAGCATTCGAAGGTCAGGCGGTCGATCCTTCTCAAATCCGGGCA
CTCACATCGGCAGCCCAACAACAGCAATTAACTACCGGACAGCTCCAACA
AGTACAAATCGGACAGATTTTGAATCAGGATGGAGTCACGCTTGCGTCAG
TACCAATCCAATCCGTACAAGGAGTAGGTGATGGTCAGAATATAATCAAT
TTTTCACAAGGAAGTAATGAACAAATTGTTGTTTTACTATCCGCTCTGAA
CTCTGAGAACATTCAACAAATTCAAtaacatttcaatttcatcataatCG
TTTAAGACAAAAGGTTTTtctagtttttattttattttttgaatacgTAT
GTTTTAGATATCGATTTCAAACTGAGTTCATTTTCTGccattttttaata
ttgaatgatttttttttctagcCTATAATATGTGCTCGGAAAAAAAGCGG
TACTGATCTGAAAAAAGTAAATTCATCAAATTAGTCCGTTGTTCAATTTC
CAATTTCGAAGTATATCAAGAATAAGTGAACACCTTTCGTTTATTaaata
gatttaaaaattgCGATCAATCTTCC
Run BLAST on NCBI

protein sequence of TCONS_00001345-protein

>TCONS_00001345-protein ID=TCONS_00001345-protein|Name=TCONS_00001345-protein|organism=Clytia hemisphaerica|type=polypeptide|length=958bp
LLLQEPTAEVIWRHSFFANFDLTKKSTLGFQDTRNLPCSSVGCFVSKKAS
KMANIEEAEITFQQQEPAQNEPPADLSSFQFVPEKIVDFSILQDGQRSYC
VRWKDSWLTEELLSLTYQHLINEFWSTAAANVNKEQTEKVKKSKATNIKI
INKQDNYEAVSVQPQYQTTSITVTSPGSATQQLVDNEANLKEMTETTAAA
QLIDHSGILKQQVIPKIPDQTGINANTLSSMVVTSDVTLAAYPNEANPPT
MIPQQPTIPKYQQALQQSISIQQQQLNPDSETGKVTFPKHVFSQARFVNK
KQQQTLVSSEQPRVNCDICQKSLKTKKMLWAHKVAVHFGGNFPCEICGKK
CITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRC
DVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHT
GTRDFICEICGSNFKRKQHLVTHMKTHLTEKKATDGSEEVYHCQACDESF
TLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDF
KCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFK
YKNALVKHMTTQHGILPSQDPSTELGIVVKKGIKRPHKCDVCSKRFKSKN
GLAKHKVNKHSLESENSIVILGEDGSKDLEEKGNVREEDEVDDDDDEDIE
TDSETETPQILQNQAIAEPQLLQNQSVELSSSSRQKSEPMEVDQQQPEMV
DHDDNVLHELDVTTNSDDKDATNNFRVVPIEHFNTSTGAGTSNVGSSADN
VPHQVITVDEATGQIILMTTNAPPSNQQDVKDNKTGPSDVGTNQIIPVDD
ASRASPIITVRESDQSTSAAFEGQAVDPSQIRALTSAAQQQQLTTGQLQQ
VQIGQILNQDGVTLASVPIQSVQGVGDGQNIINFSQGSNEQIVVLLSALN
SENIQQIQ
Run BLAST on NCBI

transcript from alignment at sc0000010:499806..508214+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001345 ID=TCONS_00001345|Name=TCONS_00001345|organism=Clytia hemisphaerica|type=transcript|length=8409bp|location=Sequence derived from alignment at sc0000010:499806..508214+ (Clytia hemisphaerica)
ACTCTTGTTACAAGAGCCGACCGCAGAAGTCATTTGGCGCCATTCTTTTT TCGCTAATTTTGATTTGACAAAGAAATCTACCCTGGGTTTTCAAGATACT CGCAACCTGCCTTGTTCAAGTGTTGGGTGTTTCGTGTCAAAAAAAGCTTC GAAAATGGCGAACATTGAAGAGGCTGAAATCACCTTTCAACAACAAGAAC CTGCACAGAATGAACCCCCTGCAGATTTATCCAGCTTTCAATTTGTTCCT GAAAAAATTGTGGATTTTTCCATTCTACAGGTAAGCATTAAACTCTTGAt tgtttgtctttttttcttgttGTTCTTTTCGACTTTCAAATCTGGTGTGT GGCCATGGACCTATAAAGAGCGGTCAAATTATCTTTATTTCTGCTCATTC TAAAATGCTCAAAACTTTTTGTGTATGTGTGGTCATCTCTCTCATCCTTT NGCTTTTCGACTTTCAGATCTGGTGTGTGGCCATGGACCTATAAAGAGCG GTCAAATTATCTTTATTTCTCCTCATTCTAAAATGCTCAAAACTTTTTGT GTATGTGTGGTCATCTCTCTCATCCTTTTCTAGTACATTGATTTGTTTGC TGGACTTgaaatttaatgtttctatTATTAGGTTTAGAAGAGATTTGAGA tttcttctcatttttaaaAGCTTTCTCAATGGATCTATAACTCTTATATC TTAACTTCATTTTTTACAACATTTTATACCTAACTCAAGTTATCCTACCT GAAGTTCTTGCACATATAGCTATTTTCTCCTACAGGCTACGATCTCTCTT TCAATACCACCTTAAGttggtaccgtgagattgggtaaattgcatcagtg gaggctggTTAACATGCATAGAcgtcaaatgaaagacctgactggtcatt aaaatacaacctACAGTAGCAGCTCCGCTCCGCTCGCATctttactctac catttttgttttgatttaactttgtattacGCTCCTTTGTTTGTTtagcc actaatttggtctctTCGTTCAAGACATATTCGCTTGTGTTCCACtaagg attttttttcatatttcgatttgtAATATTCGGTTTGAAAGTGAaatctt gtattttttaatacgccgttcatcaTATCAAATGACTATGgaagttcggt gaaatggtggtcgaattgctgtcccatgttttgtcagatagtccctagtt agagcagttgatggtaataAACAAAAGATGAATGGATGGGTGTTAcaaca gtcactttcggtcggggtagAGGATGGCAacatttgtcgttctttatgaa atttgtcgttcttgtctatttttagtaaatgcaATGATTTTTTAAACCCG AATCGTGCAAAATTCTGCTTTCAtatatgaaaaatcaaatttgataaaaa attagtcaaaatgaggaaaaaataccccaaaaaattGTTATTGGAATTGG AAGTATTTTATTatggaattttcgaaattttggcaAACTTATTCGGTATT TTAGAAATTGCAAACCCTGTACGCCCCTATCTTAGAAGGGATTAAAAGAC AAAAGAGAATGTCTACagacatttttggacctaccccggtggggtggagg tcctataaattaacccgtgttcgttagttagttagttagttaccaacttt tctcgagattggctcattcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN Natttttctttcaccgttaaacatcgatgcgtttcttaattgctttctcc gttccaatagatatataaatctaaatttaaaattatacattacttccatt aaattctaattattcgttttataaataggtaggtccattaaagtattact tgttaatttcacttttattatggaattttcgaaattttggcaAACTTATT CGGTATTTTAGAAATTGCAAACCCTGTACGCCCCTGTCTTAGAAGGGATT AAAAGACAAAAGAGAATGTCTACAGACATTTTTAATTTCACGTGAAATTG CCAAACACAAATATTTCTcaggattaaaaaaaatcacctcTAAAAATGGT CTCATTAGGGCAAAACAGgctatttttgtaaacaaaacattCTCTCAACC TGGAAATTAAACTTCCAAATTTTGAGCTGTTAAACtgcaaaaaatttctt cccttaagttaATGCGTACCATAAGTTGGtataatgtcaacatccctctt ctaatttcaacacccttctttagagatataAGGAATATTAAGAAGGTCGG GATCTCTAATAGACAAAAGTTTTTGTCCACTCTGATTGCcaaggaaagaa aaatagtttccatcagcgattctgaccttcctattattcctatctcaaag aagggtgtcaaaattagaagagggatgtcaacattaggcCAACTTACGAC AAAacatttcacttttttcaaattgcGGGTGAATAAGCTTTGACCattga ttttggtcaattttaggGTGCTGATTTGGAATTTAAGCTTGAAAACCTGC AGTTTTTgcataatttgatttttttttctaaataaaattgtaagctacct taaaggaagaaattttggcggaaagaaaattagGCGGATTTGGcaagaat ccgccaaattaagttcccgccaaaatttcttttttcccccatccgccaaa ttaaattcccgccaaatagCGCTCCGCGCAAcccatacgtcataattatt acttttcactttttttgacatttgtacgagttgcaatcccacaattcaac gtggctcaattaaagatacatgcaagctgttatatatcttttgtcaaacg atgcaattaacgtgcaaaagagattagcgcaaaggttgatgggattggaa ctcgtacaaacacatcgagagtaatgattatgtcaaaaataaaatctatt tttagattcagcgcggtgcgctattaaattttttgaaaatatgctcTTTT AAGgagtttttgcatttttttgtagCTGTTTTTACGTCAgtttaagaata aatttttcagcaaacgtcaaattaaattcccgccaaatttagttttttcg tccatccgccaaattaaattccctctaaaaaactttttcggccatcagcc aaattaaattcccgccaaaatttcttcctttaaggtaaaattcataattt tcagggtgttcttcaaaatcaaaaaagacctataccacgaGATAGAGCTC Ttccaaactgagcaaaaaatgtattatatcaaagtctcaacttttctaga tcaaaagttatgggtgtttttgtggtaaaaaaagtgctataattttgcat aGATTATGCAGATTACAGGGTAATTCCCTGTTTTCGATCAATTTTTGACc acaacattttttttctctcatgAGAAGAAACTTTGGCTTGAATGTTGtgg aaaaattgaattaaatttaCTGGTGACTTAGTCCGCCAATCTCGCCTAAG GTTCATTAAAATTAATTTGTATTTTTGCATTTTGCCAAAATAAGGCAAAA CAGGACAAATTTAACCAATATTAAACTGCTTGCTGAAATTAGTTCTTGCC AAATAAGTTGCCTTAATGTAGAAGGAATCTGcatgccaaatatctcaaac catctgatcatccctttaattattattattattagcatggtgtctacggg accttgaaaaccttgaaattggactaagcaaccttgaaaaccttaaaaat gcATGATTGTGACTGTATAGTTGTCTTGTTTTGGCTTGGGTCCTGAATAA AGTTTTGGTCTATGCTAAACTCTAGGAATTTTCTtgttcgcttcgctcgc aatcaTTGTTTCCAAACCAACTACTGGTAGTAACATCTCTTGCACCTTGT CAACAAGTCATATCCTACTTAAGTCGATTTGAGTTCTGAGAAACCTTGAA AATAACCaataaatggtccaaaaaaccttgaaaattttgccaaaaaagct ttgaaaatcTTGGAAATGGTGACAAAAATTCTGTAGTCACCCTGATTAGT GacttaagaatattttgaatttggcATCAATAACTTATTTGTATGAATTT TCCCTGAAAAGAGAGTTCTAAGAAATAGAAATATCTGGGCAGatttgaaa aagttaaatttggTAAATgacccaataattttttaaatttgggaaaaaat aaatttccagGGAACTTTTAGCTGAAAATTTGAacttaaaaaaatgaatt tttcaagtcagtcttaatttttcatcccaCATAGTTTGAGttttattttt gctaaaaagcccAAAAATGGTTAGTAGAAGCTCAAATTTAAATCTTGCAT AAATTAATTCAAGTAAAGATCGTACAATCTCGGATCATTTGTCTCATTTG TTTGACCAAGTCTCTACcactctaccactgcactatggttggtatatttt ttacaattgtttttaattttttaacaaaactaTTACTCTTTCTGTTTTAG GATGGCCAACGTTCTTATTGTGTCCGTTGGAAGGATTCCTGGCTGACTGA AGAGCTTCTCTCCCTAACCTACCAACACCTTATCAACGAGTTCTGGTCAA CCGCAGCTGCCAATGTCAACAAAGAGCAGACagaaaaagtgaagaaatcG AAAGCAACcaacataaaaatcataaataagcAGGATAACTATGAAGCTGT GTCTGTCCAGCCGCAATATCAGACAACATCCATAACAGTAACTTCACCGG GAAGTGCAACCCAACAGCTGGTTGATAATGAAGCTAATCTTAAAGAAATG ACTGAAACTACTGCAGCAGCTCAACTTATAGACCACTCTGGTATCCTAAA ACAACAAGTAATACCAAAGATTCCTGATCAAACTGGTATCAATGCCAATA CATTAAGCTCGATGGTTGTTACTAGTGATGTCACCTTAGCTGCTTATCCA AACGAAGCCAACCCTCCAACCATGATTCCACAGCAACCAACCATACCAAA ATACCAACAGGCTCTTCAACAGTCGATCTCGATCCAACAACAACAATTAA ACCCCGATTCTGAAACAGGAAAAGTCACGTTTCCAAAACACGTTTTCTCT CAAGCTCGATTTGTTAATAAAAAGCAACAGCAAACTCTTGTGTCTTCCGA ACAGCCACGAGTCAACTGTGATATTTGTCAGAAATCCTTGAAAACCAAGA AAATGTTGTGGGCACATAAAGTTGCTGTTCATTTCGGTGGTAATTTTCCC TGTGAGATTTGTGGCAAGAAATGTATAACTGGTGCTGAGTTGAGACGTCA CATGACATCCCATTCGACCGAGCGTCGTTTCGTTTGCCAGTATTGTGGAT TAGCCTATAAACGATGGTCACACTTGTATCAGCATTTGCGTGTTCACgaa gaagagaaaaatttccGTTGTGATGTTTgtcatttgaatttcaaagtTCA GTCTGAATTGAAGGATCATTGTTTTGCTGAGCACTCGGACGGTAAAATGG TCCAGTGTAGTGTATGTAAACATAAGCTACAAACACCTCTTGCCGTTTAT CATCATAGTATGAAACACACAGGTACTCGTGACTTCATTTGCGAGATTTG TGGCTCGAATTTCAAACGAAAACAACATCTGGTTACTCACATGAAAACAC ATTTGACGGAAAAGAAAGCAACCGATGGTAGTGAAGAAGTGTATCATTGT CAAGCTTGCGATGAAAGTTTCACGTTAAAAATGGATCTGAAAGCACATTG CACAGCCGCACATCCTTTGCTGGGAGACGAGAGCGTAGCTTGTAGAACAT GTCAAAAGAGACTGAAAGTATCACATTCAGTTTATCTACACGGCTTACGT CATTTTGGTGCACGTGACTTCAAATGTACGTTATGTAACCAGTTCTTTAA AAGGAAAGCCCATTTATTACGTCATTCATTAGATCGTCATCCAGAACAAC CGAGAGAACGAAAAAAACGAACAGTCCAAGTCGATGGAATCACATGCGAT CTTTGCCAGAAATCTTTCAAGTACAAGAACGCACTCGTCAAACACATGAC AACCNCATGCGATCTTTGCCAGAAATCTTTCAAGTACAAGAACGCACTCG TCAAACACATGACAACCCAACACGGAATATTACCATCTCAAGACCCAAGT ACTGAACTTGGCATTGTCGTCAAAAAAGGAATCAAACGTCCTCACAAATG TGACGTATGTAGCAAACGTTTCAAATCCAAAAATGGTCTCGCTAAGCATA AGGTTAATAAACATTCGTTGGAAAGTGAAAACAGTATTGTGATTCTTGGT GAAGACGGCTCAAAGGATTTGGAGGAGAAAGGAAACGTTCGCGAAGAAGA TGAAGTCGACGATGACGATGACGAAGATATCGAAACAGATTCTGAAACTG AAACGCCTCAGATACTGCAAAACCAAGCTATTGCTGAACCACAATTACTT CAAAACCAATCAGTCGAATTATCTTCATCTTCTCGGCAAAAAAGTGAACC CATGGAAGTTGACCAACAACAACCAGAGATGGTGGACCATGACGACAATG TGTTACATGAGTTGGATGTTACGACAAACAGCGATGATAAGGATGCTACC AATAATTTCCGTGTAGTTCCTATTGAGCATTTCAATACTTCAACTGGAGC AGGGACTTCCAATGTGGGCTCATCAGCTGATAACGTACCACACCAAGTAA TCACTGTAGACGAAGCTACCGGTCAAATCATCCTGATGACAACAAATGCA CCACCATCCAACCAACAAGATGTGAAAGACAACAAAACCGGACCGTCGGA TGTGGGTACAAACCAGATTATACCTGTCGATGATGCATCCAGAGCCTCAC CGATCATCACAGTACGAGAATCCGATCAATCAACGAGTGCAGCATTCGAA GGTCAGGCGGTCGATCCTTCTCAAATCCGGGCACTCACATCGGCAGCCCA ACAACAGCAATTAACTACCGGACAGCTCCAACAAGTACAAATCGGACAGA TTTTGAATCAGGATGGAGTCACGCTTGCGTCAGTACCAATCCAATCCGTA CAAGGAGTAGGTGATGGTCAGAATATAATCAATTTTTCACAAGGAAGTAA TGAACAAATTGTTGTTTTACTATCCGCTCTGAACTCTGAGAACATTCAAC AAATTCAAtaacatttcaatttcatcataatCGTTTAAGACAAAAGGTTT TtctagtttttattttattttttgaatacgTATGTTTTAGATATCGATTT CAAACTGAGTTCATTTTCTGccattttttaatattgaatgattttttttt ctagcCTATAATATGTGCTCGGAAAAAAAGCGGTACTGATCTGAAAAAAG TAAATTCATCAAATTAGTCCGTTGTTCAATTTCCAATTTCGAAGTATATC AAGAATAAGTGAACACCTTTCGTTTATTaaatagatttaaaaattgCGAT CAATCTTCC

Coding sequence (CDS) from alignment at sc0000010:499806..508214+

>TCONS_00001345 ID=TCONS_00001345|Name=TCONS_00001345|organism=Clytia hemisphaerica|type=CDS|length=8631bp|location=Sequence derived from alignment at sc0000010:499806..508214+ (Clytia hemisphaerica)
CTCTTGTTACAAGAGCCGACCGCAGAAGTCATTTGGCGCCATTCTTTTTT
CGCTAATTTTGATTTGACAAAGAAATCTACCCTGGGTTTTCAAGATACTC
GCAACCTGCCTTGTTCAAGTGTTGGGTGTTTCGTGTCAAAAAAAGCTTCG
AAAATGGCGAACATTGAAGAGGCTGAAATCACCTTTCAACAACAAGAACC
TGCACAGAATGAACCCCCTGCAGATTTATCCAGCTTTCAATTTGTTCCTG
AAAAAATTGTGGATTTTTCCATTCTACAGGATGGCCAACGTTCTTATTGT
GTCCGTTGGAAGGATTCCTGGCTGACTGAAGAGCTTCTCTCCCTAACCTA
CCAACACCTTATCAACGAGTTCTGGTCAACCGCAGCTGCCAATGTCAACA
AAGAGCAGACagaaaaagtgaagaaatcGAAAGCAACcaacataaaaatc
ataaataagcAGGATAACTATGAAGCTGTGTCTGTCCAGCCGCAATATCA
GACAACATCCATAACAGTAACTTCACCGGGAAGTGCAACCCAACAGCTGG
TTGATAATGAAGCTAATCTTAAAGAAATGACTGAAACTACTGCAGCAGCT
CAACTTATAGACCACTCTGGTATCCTAAAACAACAAGTAATACCAAAGAT
TCCTGATCAAACTGGTATCAATGCCAATACATTAAGCTCGATGGTTGTTA
CTAGTGATGTCACCTTAGCTGCTTATCCAAACGAAGCCAACCCTCCAACC
ATGATTCCACAGCAACCAACCATACCAAAATACCAACAGGCTCTTCAACA
GTCGATCTCGATCCAACAACAACAATTAAACCCCGATTCTGAAACAGGAA
AAGTCACGTTTCCAAAACACGTTTTCTCTCAAGCTCGATTTGTTAATAAA
AAGCAACAGCAAACTCTTGTGTCTTCCGAACAGCCACGAGTCAACTGTGA
TATTTGTCAGAAATCCTTGAAAACCAAGAAAATGTTGTGGGCACATAAAG
TTGCTGTTCATTTCGGTGGTAATTTTCCCTGTGAGATTTGTGGCAAGAAA
TGTATAACTGGTGCTGAGTTGAGACGTCACATGACATCCCATTCGACCGA
GCGTCGTTTCGTTTGCCAGTATTGTGGATTAGCCTATAAACGATGGTCAC
ACTTGTATCAGCATTTGCGTGTTCACgaagaagagaaaaatttccGTTGT
GATGTTTgtcatttgaatttcaaagtTCAGTCTGAATTGAAGGATCATTG
TTTTGCTGAGCACTCGGACGGTAAAATGGTCCAGTGTAGTGTATGTAAAC
ATAAGCTACAAACACCTCTTGCCGTTTATCATCATAGTATGAAACACACA
GGTACTCGTGACTTCATTTGCGAGATTTGTGGCTCGAATTTCAAACGAAA
ACAACATCTGGTTACTCACATGAAAACACATTTGACGGAAAAGAAAGCAA
CCGATGGTAGTGAAGAAGTGTATCATTGTCAAGCTTGCGATGAAAGTTTC
ACGTTAAAAATGGATCTGAAAGCACATTGCACAGCCGCACATCCTTTGCT
GGGAGACGAGAGCGTAGCTTGTAGAACATGTCAAAAGAGACTGAAAGTAT
CACATTCAGTTTATCTACACGGCTTACGTCATTTTGGTGCACGTGACTTC
AAATGTACGTTATGTAACCAGTTCTTTAAAAGGAAAGCCCATTTATTACG
TCATTCATTAGATCGTCATCCAGAACAACCGAGAGAACGAAAAAAACGAA
CAGTCCAAGTCGATGGAATCACATGCGATCTTTGCCAGAAATCTTTCAAG
TACAAGAACGCACTCGTCAAACACATGACAACCCAACACGGAATATTACC
ATCTCAAGACCCAAGTACTGAACTTGGCATTGTCGTCAAAAAAGGAATCA
AACGTCCTCACAAATGTGACGTATGTAGCAAACGTTTCAAATCCAAAAAT
GGTCTCGCTAAGCATAAGGTTAATAAACATTCGTTGGAAAGTGAAAACAG
TATTGTGATTCTTGGTGAAGACGGCTCAAAGGATTTGGAGGAGAAAGGAA
ACGTTCGCGAAGAAGATGAAGTCGACGATGACGATGACGAAGATATCGAA
ACAGATTCTGAAACTGAAACGCCTCAGATACTGCAAAACCAAGCTATTGC
TGAACCACAATTACTTCAAAACCAATCAGTCGAATTATCTTCATCTTCTC
GGCAAAAAAGTGAACCCATGGAAGTTGACCAACAACAACCAGAGATGGTG
GACCATGACGACAATGTGTTACATGAGTTGGATGTTACGACAAACAGCGA
TGATAAGGATGCTACCAATAATTTCCGTGTAGTTCCTATTGAGCATTTCA
ATACTTCAACTGGAGCAGGGACTTCCAATGTGGGCTCATCAGCTGATAAC
GTACCACACCAAGTAATCACTGTAGACGAAGCTACCGGTCAAATCATCCT
GATGACAACAAATGCACCACCATCCAACCAACAAGATGTGAAAGACAACA
AAACCGGACCGTCGGATGTGGGTACAAACCAGATTATACCTGTCGATGAT
GCATCCAGAGCCTCACCGATCATCACAGTACGAGAATCCGATCAATCAAC
GAGTGCAGCATTCGAAGGTCAGGCGGTCGATCCTTCTCAAATCCGGGCAC
TCACATCGGCAGCCCAACAACAGCAATTAACTACCGGACAGCTCCAACAA
GTACAAATCGGACAGATTTTGAATCAGGATGGAGTCACGCTTGCGTCAGT
ACCAATCCAATCCGTACAAGGAGTAGGTGATGGTCAGAATATAATCAATT
TTTCACAAGGAAGTAATGAACAAATTGTTGTTTTACTATCCGCTCTGAAC
TCTGAGAACATTCAACAAATTCAAtaaCTCTTGTTACAAGAGCCGACCGC
AGAAGTCATTTGGCGCCATTCTTTTTTCGCTAATTTTGATTTGACAAAGA
AATCTACCCTGGGTTTTCAAGATACTCGCAACCTGCCTTGTTCAAGTGTT
GGGTGTTTCGTGTCAAAAAAAGCTTCGAAAATGGCGAACATTGAAGAGGC
TGAAATCACCTTTCAACAACAAGAACCTGCACAGAATGAACCCCCTGCAG
ATTTATCCAGCTTTCAATTTGTTCCTGAAAAAATTGTGGATTTTTCCATT
CTACAGGATGGCCAACGTTCTTATTGTGTCCGTTGGAAGGATTCCTGGCT
GACTGAAGAGCTTCTCTCCCTAACCTACCAACACCTTATCAACGAGTTCT
GGTCAACCGCAGCTGCCAATGTCAACAAAGAGCAGACagaaaaagtgaag
aaatcGAAAGCAACcaacataaaaatcataaataagcAGGATAACTATGA
AGCTGTGTCTGTCCAGCCGCAATATCAGACAACATCCATAACAGTAACTT
CACCGGGAAGTGCAACCCAACAGCTGGTTGATAATGAAGCTAATCTTAAA
GAAATGACTGAAACTACTGCAGCAGCTCAACTTATAGACCACTCTGGTAT
CCTAAAACAACAAGTAATACCAAAGATTCCTGATCAAACTGGTATCAATG
CCAATACATTAAGCTCGATGGTTGTTACTAGTGATGTCACCTTAGCTGCT
TATCCAAACGAAGCCAACCCTCCAACCATGATTCCACAGCAACCAACCAT
ACCAAAATACCAACAGGCTCTTCAACAGTCGATCTCGATCCAACAACAAC
AATTAAACCCCGATTCTGAAACAGGAAAAGTCACGTTTCCAAAACACGTT
TTCTCTCAAGCTCGATTTGTTAATAAAAAGCAACAGCAAACTCTTGTGTC
TTCCGAACAGCCACGAGTCAACTGTGATATTTGTCAGAAATCCTTGAAAA
CCAAGAAAATGTTGTGGGCACATAAAGTTGCTGTTCATTTCGGTGGTAAT
TTTCCCTGTGAGATTTGTGGCAAGAAATGTATAACTGGTGCTGAGTTGAG
ACGTCACATGACATCCCATTCGACCGAGCGTCGTTTCGTTTGCCAGTATT
GTGGATTAGCCTATAAACGATGGTCACACTTGTATCAGCATTTGCGTGTT
CACgaagaagagaaaaatttccGTTGTGATGTTTgtcatttgaatttcaa
agtTCAGTCTGAATTGAAGGATCATTGTTTTGCTGAGCACTCGGACGGTA
AAATGGTCCAGTGTAGTGTATGTAAACATAAGCTACAAACACCTCTTGCC
GTTTATCATCATAGTATGAAACACACAGGTACTCGTGACTTCATTTGCGA
GATTTGTGGCTCGAATTTCAAACGAAAACAACATCTGGTTACTCACATGA
AAACACATTTGACGGAAAAGAAAGCAACCGATGGTAGTGAAGAAGTGTAT
CATTGTCAAGCTTGCGATGAAAGTTTCACGTTAAAAATGGATCTGAAAGC
ACATTGCACAGCCGCACATCCTTTGCTGGGAGACGAGAGCGTAGCTTGTA
GAACATGTCAAAAGAGACTGAAAGTATCACATTCAGTTTATCTACACGGC
TTACGTCATTTTGGTGCACGTGACTTCAAATGTACGTTATGTAACCAGTT
CTTTAAAAGGAAAGCCCATTTATTACGTCATTCATTAGATCGTCATCCAG
AACAACCGAGAGAACGAAAAAAACGAACAGTCCAAGTCGATGGAATCACA
TGCGATCTTTGCCAGAAATCTTTCAAGTACAAGAACGCACTCGTCAAACA
CATGACAACCCAACACGGAATATTACCATCTCAAGACCCAAGTACTGAAC
TTGGCATTGTCGTCAAAAAAGGAATCAAACGTCCTCACAAATGTGACGTA
TGTAGCAAACGTTTCAAATCCAAAAATGGTCTCGCTAAGCATAAGGTTAA
TAAACATTCGTTGGAAAGTGAAAACAGTATTGTGATTCTTGGTGAAGACG
GCTCAAAGGATTTGGAGGAGAAAGGAAACGTTCGCGAAGAAGATGAAGTC
GACGATGACGATGACGAAGATATCGAAACAGATTCTGAAACTGAAACGCC
TCAGATACTGCAAAACCAAGCTATTGCTGAACCACAATTACTTCAAAACC
AATCAGTCGAATTATCTTCATCTTCTCGGCAAAAAAGTGAACCCATGGAA
GTTGACCAACAACAACCAGAGATGGTGGACCATGACGACAATGTGTTACA
TGAGTTGGATGTTACGACAAACAGCGATGATAAGGATGCTACCAATAATT
TCCGTGTAGTTCCTATTGAGCATTTCAATACTTCAACTGGAGCAGGGACT
TCCAATGTGGGCTCATCAGCTGATAACGTACCACACCAAGTAATCACTGT
AGACGAAGCTACCGGTCAAATCATCCTGATGACAACAAATGCACCACCAT
CCAACCAACAAGATGTGAAAGACAACAAAACCGGACCGTCGGATGTGGGT
ACAAACCAGATTATACCTGTCGATGATGCATCCAGAGCCTCACCGATCAT
CACAGTACGAGAATCCGATCAATCAACGAGTGCAGCATTCGAAGGTCAGG
CGGTCGATCCTTCTCAAATCCGGGCACTCACATCGGCAGCCCAACAACAG
CAATTAACTACCGGACAGCTCCAACAAGTACAAATCGGACAGATTTTGAA
TCAGGATGGAGTCACGCTTGCGTCAGTACCAATCCAATCCGTACAAGGAG
TAGGTGATGGTCAGAATATAATCAATTTTTCACAAGGAAGTAATGAACAA
ATTGTTGTTTTACTATCCGCTCTGAACTCTGAGAACATTCAACAAATTCA
AtaaCTCTTGTTACAAGAGCCGACCGCAGAAGTCATTTGGCGCCATTCTT
TTTTCGCTAATTTTGATTTGACAAAGAAATCTACCCTGGGTTTTCAAGAT
ACTCGCAACCTGCCTTGTTCAAGTGTTGGGTGTTTCGTGTCAAAAAAAGC
TTCGAAAATGGCGAACATTGAAGAGGCTGAAATCACCTTTCAACAACAAG
AACCTGCACAGAATGAACCCCCTGCAGATTTATCCAGCTTTCAATTTGTT
CCTGAAAAAATTGTGGATTTTTCCATTCTACAGGATGGCCAACGTTCTTA
TTGTGTCCGTTGGAAGGATTCCTGGCTGACTGAAGAGCTTCTCTCCCTAA
CCTACCAACACCTTATCAACGAGTTCTGGTCAACCGCAGCTGCCAATGTC
AACAAAGAGCAGACagaaaaagtgaagaaatcGAAAGCAACcaacataaa
aatcataaataagcAGGATAACTATGAAGCTGTGTCTGTCCAGCCGCAAT
ATCAGACAACATCCATAACAGTAACTTCACCGGGAAGTGCAACCCAACAG
CTGGTTGATAATGAAGCTAATCTTAAAGAAATGACTGAAACTACTGCAGC
AGCTCAACTTATAGACCACTCTGGTATCCTAAAACAACAAGTAATACCAA
AGATTCCTGATCAAACTGGTATCAATGCCAATACATTAAGCTCGATGGTT
GTTACTAGTGATGTCACCTTAGCTGCTTATCCAAACGAAGCCAACCCTCC
AACCATGATTCCACAGCAACCAACCATACCAAAATACCAACAGGCTCTTC
AACAGTCGATCTCGATCCAACAACAACAATTAAACCCCGATTCTGAAACA
GGAAAAGTCACGTTTCCAAAACACGTTTTCTCTCAAGCTCGATTTGTTAA
TAAAAAGCAACAGCAAACTCTTGTGTCTTCCGAACAGCCACGAGTCAACT
GTGATATTTGTCAGAAATCCTTGAAAACCAAGAAAATGTTGTGGGCACAT
AAAGTTGCTGTTCATTTCGGTGGTAATTTTCCCTGTGAGATTTGTGGCAA
GAAATGTATAACTGGTGCTGAGTTGAGACGTCACATGACATCCCATTCGA
CCGAGCGTCGTTTCGTTTGCCAGTATTGTGGATTAGCCTATAAACGATGG
TCACACTTGTATCAGCATTTGCGTGTTCACgaagaagagaaaaatttccG
TTGTGATGTTTgtcatttgaatttcaaagtTCAGTCTGAATTGAAGGATC
ATTGTTTTGCTGAGCACTCGGACGGTAAAATGGTCCAGTGTAGTGTATGT
AAACATAAGCTACAAACACCTCTTGCCGTTTATCATCATAGTATGAAACA
CACAGGTACTCGTGACTTCATTTGCGAGATTTGTGGCTCGAATTTCAAAC
GAAAACAACATCTGGTTACTCACATGAAAACACATTTGACGGAAAAGAAA
GCAACCGATGGTAGTGAAGAAGTGTATCATTGTCAAGCTTGCGATGAAAG
TTTCACGTTAAAAATGGATCTGAAAGCACATTGCACAGCCGCACATCCTT
TGCTGGGAGACGAGAGCGTAGCTTGTAGAACATGTCAAAAGAGACTGAAA
GTATCACATTCAGTTTATCTACACGGCTTACGTCATTTTGGTGCACGTGA
CTTCAAATGTACGTTATGTAACCAGTTCTTTAAAAGGAAAGCCCATTTAT
TACGTCATTCATTAGATCGTCATCCAGAACAACCGAGAGAACGAAAAAAA
CGAACAGTCCAAGTCGATGGAATCACATGCGATCTTTGCCAGAAATCTTT
CAAGTACAAGAACGCACTCGTCAAACACATGACAACCCAACACGGAATAT
TACCATCTCAAGACCCAAGTACTGAACTTGGCATTGTCGTCAAAAAAGGA
ATCAAACGTCCTCACAAATGTGACGTATGTAGCAAACGTTTCAAATCCAA
AAATGGTCTCGCTAAGCATAAGGTTAATAAACATTCGTTGGAAAGTGAAA
ACAGTATTGTGATTCTTGGTGAAGACGGCTCAAAGGATTTGGAGGAGAAA
GGAAACGTTCGCGAAGAAGATGAAGTCGACGATGACGATGACGAAGATAT
CGAAACAGATTCTGAAACTGAAACGCCTCAGATACTGCAAAACCAAGCTA
TTGCTGAACCACAATTACTTCAAAACCAATCAGTCGAATTATCTTCATCT
TCTCGGCAAAAAAGTGAACCCATGGAAGTTGACCAACAACAACCAGAGAT
GGTGGACCATGACGACAATGTGTTACATGAGTTGGATGTTACGACAAACA
GCGATGATAAGGATGCTACCAATAATTTCCGTGTAGTTCCTATTGAGCAT
TTCAATACTTCAACTGGAGCAGGGACTTCCAATGTGGGCTCATCAGCTGA
TAACGTACCACACCAAGTAATCACTGTAGACGAAGCTACCGGTCAAATCA
TCCTGATGACAACAAATGCACCACCATCCAACCAACAAGATGTGAAAGAC
AACAAAACCGGACCGTCGGATGTGGGTACAAACCAGATTATACCTGTCGA
TGATGCATCCAGAGCCTCACCGATCATCACAGTACGAGAATCCGATCAAT
CAACGAGTGCAGCATTCGAAGGTCAGGCGGTCGATCCTTCTCAAATCCGG
GCACTCACATCGGCAGCCCAACAACAGCAATTAACTACCGGACAGCTCCA
ACAAGTACAAATCGGACAGATTTTGAATCAGGATGGAGTCACGCTTGCGT
CAGTACCAATCCAATCCGTACAAGGAGTAGGTGATGGTCAGAATATAATC
AATTTTTCACAAGGAAGTAATGAACAAATTGTTGTTTTACTATCCGCTCT
GAACTCTGAGAACATTCAACAAATTCAAtaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000726XLOC_000726Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001345-proteinTCONS_00001345-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001345-exon-sc0000010-1491911889:499806..500085TCONS_00001345-exon-sc0000010-1491911889:499806..500085Clytia hemisphaericaexon
TCONS_00001345-exon-sc0000010-1510915933:499806..500085TCONS_00001345-exon-sc0000010-1510915933:499806..500085Clytia hemisphaericaexon
TCONS_00001345-exon-sc0000010-1575043694:499806..500085TCONS_00001345-exon-sc0000010-1575043694:499806..500085Clytia hemisphaericaexon
TCONS_00001345-exon-sc0000010-1491911889:505256..506800TCONS_00001345-exon-sc0000010-1491911889:505256..506800Clytia hemisphaericaexon
TCONS_00001345-exon-sc0000010-1510915933:505256..506800TCONS_00001345-exon-sc0000010-1510915933:505256..506800Clytia hemisphaericaexon
TCONS_00001345-exon-sc0000010-1575043694:505256..506800TCONS_00001345-exon-sc0000010-1575043694:505256..506800Clytia hemisphaericaexon
TCONS_00001345-exon-sc0000010-1491911889:506864..508214TCONS_00001345-exon-sc0000010-1491911889:506864..508214Clytia hemisphaericaexon
TCONS_00001345-exon-sc0000010-1510915933:506864..508214TCONS_00001345-exon-sc0000010-1510915933:506864..508214Clytia hemisphaericaexon
TCONS_00001345-exon-sc0000010-1575043694:506864..508214TCONS_00001345-exon-sc0000010-1575043694:506864..508214Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:499806..508214 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
35.5856 33.7201 18.8028 17.1613 80.8322 62.6103 48.7945 49.4084 20.9611 27.2838 21.5954 19.24 18.593 24.0991 17.1451 28.6579 24.1235 27.8684 9.55259 9.67599 19.184 17.4941 32.0644 31.1745 35.0996 33.6171 9.29629 7.04857 24.217 27.0715
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR016197Chromodomain-like
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003676 nucleic acid binding
Blast
BLAST of TCONS_00001345 vs. Swiss-Prot (Human)
Match: ZN226 (Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2)

HSP 1 Score: 150.214 bits (378), Expect = 5.401e-37
Identity = 120/397 (30.23%), Postives = 169/397 (42.57%), Query Frame = 2
Query:  872 VFSQARFVNKKQQQTLVSSEQPRVNCDICQKSLKTKKMLWAHKVAVHFGGN-FPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEK--------------------KATDGSEEVYHCQACDESFTLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDFKCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFKYKNALVKHMTTQHGILP----------SQDPSTELGIVVKKGIKRPHKCDVCSKRFKSKNGLAKHK 1969
             FSQA  +  +  Q L + E+P   CD C KS      L +H+  VH G   + CE CGK  I  + L  H   H+ E+ + C+ CG  + R S L  H  VH  EK++ C VC   F + S L+ H    H+  K  +C+ C    +       H + HTG + + CEICG  F +  +L  H K H  EK                    +     E+ Y C+ C + F+ + DLK HC       G++   C  C K  + + ++  H   H G + FKC  C + F R AHL  H      ++P              CD C K FK+   L  H     G  P          SQ  S +L   V  G ++P+KCDVC K F   + L  H+
Sbjct:  371 AFSQASHL--QDHQRLHTGEKP-FKCDACGKSFSRNSHLQSHQ-RVHTGEKPYKCEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKSYICTVCGKGFTLSSNLQAHQRV-HTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCRIH---TGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKP------------YKCDECGKGFKWSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLHQSVHTG-EKPYKCDVCGKVFSRSSQLQSHQ 746          

HSP 2 Score: 133.265 bits (334), Expect = 1.150e-31
Identity = 92/311 (29.58%), Postives = 139/311 (44.69%), Query Frame = 2
Query:  896 NKKQQQTLVSSEQPRVNCDICQKSLKTKKMLWAHKVAVHFGGN-FPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEKKATDGSEEVYHCQACDESFTLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDFKCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFKYKNALVKH 1825
            N +  Q + + E+P   C+ C KS +       H + VH G   + CEICGK     + L+ H  +HS E+ F C+ CG  + + S L  H  +H  EK ++C+ C   F  +++LK HC   H+  K   C  C    +    +  H   H+G + F CE CG +F R  HL  H K H  +K         Y C  C + F   ++L  H    H   G++   C  C K    + S+ LH   H G + +KC +C + F R + L  H      E+P              C++C KSF +++ L  H
Sbjct:  489 NLQAHQRVHTGEKP-YKCNECGKSFRRNSHYQVH-LVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCRI-HTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKP--------YKCDECGKGFKWSLNLDMH-QRVH--TGEKPYKCGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKP------------YKCEICGKSFSWRSNLTVH 773          

HSP 3 Score: 129.798 bits (325), Expect = 1.393e-30
Identity = 95/353 (26.91%), Postives = 145/353 (41.08%), Query Frame = 2
Query:  938 RVNCDICQKSLKTKKMLWAHKVAVHFGGNFPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEKKATDGSEEVYHCQACDESFTLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDFKCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFKYKNALVKHMTTQHGILPSQDPSTELGIVVKKGIK---------RPHKCDVCSKRFKSKNGLAKHK 1969
            ++ CD C K       L  H+        + C+ CGK     + L  H   H+ E+ + C+ CG A+ + SHL  H R+H  EK F+CD C  +F   S L+ H    H+  K  +C  C         +Y H   HTG + + CE CG  F R   L  H   H  EK         Y C  C + FTL  +L+AH    H   G++   C  C K  + +    +H + H G + +KC +C + F + ++L  H      E+P              C+ C + F   + L  H     G  P +      G   +  +K         +P+ C+ C K F+  + L  H+
Sbjct:  306 KLKCDECGKEFSQGAHLQTHQKVHVIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRV-HTGEKPYKCEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKS--------YICTVCGKGFTLSSNLQAH-QRVH--TGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKP------------FKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQ 634          

HSP 4 Score: 124.79 bits (312), Expect = 5.089e-29
Identity = 92/330 (27.88%), Postives = 139/330 (42.12%), Query Frame = 2
Query: 1007 VHFGGNFPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEKKATDGSEEVYHCQACDESFTLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDFKCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFKYKNALVKHMTTQHGILP----------SQDPSTELGIVVKKGIKRPHKCDVCSKRFKSKNGLAKH 1966
            VH G    C+ CGK+   GA L+ H   H  E+ + C+ CG  + R S L  H +VH  EK + C+ C   F   S L+DH    H+  K  +C  C         +  H   HTG + + CE CG  F    +L  H + H  EK         Y C+ C + F+    L+AH    H   G++S  C  C K   +S ++  H   H G + +KC  C + F+R +H   H +    E+P              C++C K F   + L  H        P          +Q    ++  ++  G ++P+KC+ C K F  +  L  H
Sbjct:  301 VHVGEKLKCDECGKEFSQGAHLQTHQKVHVIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEECGRAFSQASHLQDH-QRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGFICSSNLYIHQRVHTGEKP--------YKCEECGKGFSRPSSLQAH-QGVH--TGEKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKP------------YKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIHTG-EKPYKCEECGKGFSRRADLKIH 605          

HSP 5 Score: 94.7449 bits (234), Expect = 1.261e-19
Identity = 72/261 (27.59%), Postives = 117/261 (44.83%), Query Frame = 2
Query:  875 FSQARFVNKKQQQTLVSSEQPRVNCDICQKSLKTKKMLWAHKVAVHFGGN-FPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEKKATDGSEEVYHCQACDESFTLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDFK 1654
            FSQ+ ++   Q+   +  E+P   C+ C +       L  H++ +H G   + CE CGK     A+L+ H   H+ E+ + C+ CG  +++ S+L  H RVH  EK F+C+ C  +F   + L+ H    H+  K  +C  C    +  L +  H   HTG + + C  CG  F +   L  H   H  EK         Y C  C + F+    L++H    H   G++   C  C K      ++ +H   H G + +K
Sbjct:  540 FSQSSYLQIHQKAHSI--EKP-FKCEECGQGFNQSSRLQIHQL-IHTGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAH-QKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLHQSVHTGEKP--------YKCDVCGKVFSRSSQLQSH-QRVH--TGEKPYKCEICGKSFSWRSNLTVHHRIHVGDKSYK 784          

HSP 6 Score: 87.8113 bits (216), Expect = 1.696e-17
Identity = 60/186 (32.26%), Postives = 90/186 (48.39%), Query Frame = 2
Query:  923 SSEQPRVNCDICQKSLKTKKMLWAHKVAVHFGGN-FPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEK--KATDGSEEV 1471
            + E+P  NC+ C K  +    L AH+  VH G   F CE CGK     A L+ H   H+ ++ + C  CG  +K   +L  H RVH  EK ++C  C   F   S L+ H  + H+  K  +C VC         +  H   HTG + + CEICG +F  + +L  H + H+ +K  K+  G + +
Sbjct:  610 TGEKP-YNCEECGKVFRQASNLLAHQ-RVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLH-QSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIHVGDKSYKSNRGGKNI 792          
The following BLAST results are available for this feature:
BLAST of TCONS_00001345 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ZN2265.401e-3730.23Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 ... [more]
back to top