Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001345-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001345-protein
Unique NameTCONS_00001345-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length958

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001345-protein ID=TCONS_00001345-protein|Name=TCONS_00001345-protein|organism=Clytia hemisphaerica|type=polypeptide|length=958bp
LLLQEPTAEVIWRHSFFANFDLTKKSTLGFQDTRNLPCSSVGCFVSKKAS
KMANIEEAEITFQQQEPAQNEPPADLSSFQFVPEKIVDFSILQDGQRSYC
VRWKDSWLTEELLSLTYQHLINEFWSTAAANVNKEQTEKVKKSKATNIKI
INKQDNYEAVSVQPQYQTTSITVTSPGSATQQLVDNEANLKEMTETTAAA
QLIDHSGILKQQVIPKIPDQTGINANTLSSMVVTSDVTLAAYPNEANPPT
MIPQQPTIPKYQQALQQSISIQQQQLNPDSETGKVTFPKHVFSQARFVNK
KQQQTLVSSEQPRVNCDICQKSLKTKKMLWAHKVAVHFGGNFPCEICGKK
CITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRC
DVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHT
GTRDFICEICGSNFKRKQHLVTHMKTHLTEKKATDGSEEVYHCQACDESF
TLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDF
KCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFK
YKNALVKHMTTQHGILPSQDPSTELGIVVKKGIKRPHKCDVCSKRFKSKN
GLAKHKVNKHSLESENSIVILGEDGSKDLEEKGNVREEDEVDDDDDEDIE
TDSETETPQILQNQAIAEPQLLQNQSVELSSSSRQKSEPMEVDQQQPEMV
DHDDNVLHELDVTTNSDDKDATNNFRVVPIEHFNTSTGAGTSNVGSSADN
VPHQVITVDEATGQIILMTTNAPPSNQQDVKDNKTGPSDVGTNQIIPVDD
ASRASPIITVRESDQSTSAAFEGQAVDPSQIRALTSAAQQQQLTTGQLQQ
VQIGQILNQDGVTLASVPIQSVQGVGDGQNIINFSQGSNEQIVVLLSALN
SENIQQIQ
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000726XLOC_000726Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001345TCONS_00001345Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR016197Chromodomain-like
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003676 nucleic acid binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 550..573
e-value: 0.017
score: 24.3
coord: 314..337
e-value: 1.4
score: 17.9
coord: 427..449
e-value: 14.0
score: 11.9
coord: 455..477
e-value: 0.0013
score: 28.0
coord: 342..364
e-value: 0.0011
score: 28.2
coord: 398..421
e-value: 2.0
score: 17.4
coord: 370..392
e-value: 0.0065
score: 25.7
coord: 491..514
e-value: 0.44
score: 19.6
coord: 590..613
e-value: 0.0012
score: 28.1
coord: 637..660
e-value: 0.0023
score: 27.2
coord: 522..544
e-value: 220.0
score: 1.4
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 457..477
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 592..613
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 372..392
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 639..660
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 493..514
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 552..573
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 344..364
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 400..421
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 316..337
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 370..397
score: 12.487
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 637..665
score: 10.949
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 590..617
score: 9.93
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 342..369
score: 11.365
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 491..514
score: 9.245
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 398..426
score: 9.099
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 550..577
score: 10.263
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 455..482
score: 13.152
IPR013087Zinc finger C2H2-typeSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 364..416
IPR013087Zinc finger C2H2-typeSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 315..364
IPR013087Zinc finger C2H2-typeSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 449..509
IPR013087Zinc finger C2H2-typeSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 591..656
IPR013087Zinc finger C2H2-typeSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 523..568
NoneNo IPR availablePFAMPF00096zf-C2H2coord: 370..392
e-value: 3.6E-5
score: 23.9
coord: 591..613
e-value: 5.2E-4
score: 20.2
coord: 342..364
e-value: 0.0061
score: 16.9
NoneNo IPR availableGENE3D3.30.160.60coord: 383..407
e-value: 2.3E-10
score: 40.1
coord: 262..324
e-value: 0.058
score: 13.3
coord: 440..463
e-value: 2.2E-9
score: 37.0
coord: 325..352
e-value: 3.5E-8
score: 33.2
coord: 603..645
e-value: 1.4E-11
score: 44.0
NoneNo IPR availablePFAMPF13894zf-C2H2_4coord: 455..477
e-value: 3.4E-4
score: 21.1
NoneNo IPR availableGENE3D3.30.160.60coord: 646..750
e-value: 3.1E-5
score: 23.3
NoneNo IPR availableGENE3D2.160.10.10coord: 502..579
e-value: 1.8E-11
score: 43.6
NoneNo IPR availableGENE3D2.10.69.10coord: 408..439
e-value: 5.4E-4
score: 19.6
coord: 353..382
e-value: 3.9E-14
score: 52.1
coord: 464..501
e-value: 4.7E-11
score: 42.2
NoneNo IPR availableGENE3D2.40.50.40coord: 80..134
e-value: 0.0014
score: 17.9
NoneNo IPR availableGENE3D3.30.160.60coord: 580..602
e-value: 0.011
score: 15.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 672..710
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 725..749
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 820..845
NoneNo IPR availableCDDcd00024CHROMOcoord: 80..125
e-value: 0.00124637
score: 36.8583
IPR016197Chromo domain-likeSUPERFAMILY54160Chromo domain-likecoord: 68..126

Blast
BLAST of TCONS_00001345-protein vs. Swiss-Prot (Human)
Match: ZN226 (Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2)

HSP 1 Score: 149.443 bits (376), Expect = 6.826e-37
Identity = 120/397 (30.23%), Postives = 169/397 (42.57%), Query Frame = 0
Query:  291 VFSQARFVNKKQQQTLVSSEQPRVNCDICQKSLKTKKMLWAHKVAVHFGGN-FPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEK--------------------KATDGSEEVYHCQACDESFTLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDFKCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFKYKNALVKHMTTQHGILP----------SQDPSTELGIVVKKGIKRPHKCDVCSKRFKSKNGLAKHK 656
             FSQA  +  +  Q L + E+P   CD C KS      L +H+  VH G   + CE CGK  I  + L  H   H+ E+ + C+ CG  + R S L  H  VH  EK++ C VC   F + S L+ H    H+  K  +C+ C    +       H + HTG + + CEICG  F +  +L  H K H  EK                    +     E+ Y C+ C + F+ + DLK HC       G++   C  C K  + + ++  H   H G + FKC  C + F R AHL  H      ++P              CD C K FK+   L  H     G  P          SQ  S +L   V  G ++P+KCDVC K F   + L  H+
Sbjct:  371 AFSQASHL--QDHQRLHTGEKP-FKCDACGKSFSRNSHLQSHQ-RVHTGEKPYKCEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKSYICTVCGKGFTLSSNLQAH-QRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCRIH---TGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKP------------YKCDECGKGFKWSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLHQSVHTG-EKPYKCDVCGKVFSRSSQLQSHQ 746          

HSP 2 Score: 132.494 bits (332), Expect = 1.732e-31
Identity = 92/311 (29.58%), Postives = 139/311 (44.69%), Query Frame = 0
Query:  299 NKKQQQTLVSSEQPRVNCDICQKSLKTKKMLWAHKVAVHFGGN-FPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEKKATDGSEEVYHCQACDESFTLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDFKCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFKYKNALVKH 608
            N +  Q + + E+P   C+ C KS +       H + VH G   + CEICGK     + L+ H  +HS E+ F C+ CG  + + S L  H  +H  EK ++C+ C   F  +++LK HC   H+  K   C  C    +    +  H   H+G + F CE CG +F R  HL  H K H  +K         Y C  C + F   ++L  H    H   G++   C  C K    + S+ LH   H G + +KC +C + F R + L  H      E+P              C++C KSF +++ L  H
Sbjct:  489 NLQAHQRVHTGEKP-YKCNECGKSFRRNSHYQVH-LVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCRI-HTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKP--------YKCDECGKGFKWSLNLDMH-QRVH--TGEKPYKCGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKP------------YKCEICGKSFSWRSNLTVH 773          

HSP 3 Score: 128.257 bits (321), Expect = 3.038e-30
Identity = 95/353 (26.91%), Postives = 145/353 (41.08%), Query Frame = 0
Query:  313 RVNCDICQKSLKTKKMLWAHKVAVHFGGNFPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEKKATDGSEEVYHCQACDESFTLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDFKCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFKYKNALVKHMTTQHGILPSQDPSTELGIVVKKGIK---------RPHKCDVCSKRFKSKNGLAKHK 656
            ++ CD C K       L  H+        + C+ CGK     + L  H   H+ E+ + C+ CG A+ + SHL  H R+H  EK F+CD C  +F   S L+ H    H+  K  +C  C         +Y H   HTG + + CE CG  F R   L  H   H  EK         Y C  C + FTL  +L+AH    H   G++   C  C K  + +    +H + H G + +KC +C + F + ++L  H      E+P              C+ C + F   + L  H     G  P +      G   +  +K         +P+ C+ C K F+  + L  H+
Sbjct:  306 KLKCDECGKEFSQGAHLQTHQKVHVIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSH-QRVHTGEKPYKCEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKS--------YICTVCGKGFTLSSNLQAH-QRVH--TGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKP------------FKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQ 634          

HSP 4 Score: 124.02 bits (310), Expect = 7.435e-29
Identity = 92/330 (27.88%), Postives = 139/330 (42.12%), Query Frame = 0
Query:  336 VHFGGNFPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEKKATDGSEEVYHCQACDESFTLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDFKCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFKYKNALVKHMTTQHGILP----------SQDPSTELGIVVKKGIKRPHKCDVCSKRFKSKNGLAKH 655
            VH G    C+ CGK+   GA L+ H   H  E+ + C+ CG  + R S L  H +VH  EK + C+ C   F   S L+DH    H+  K  +C  C         +  H   HTG + + CE CG  F    +L  H + H  EK         Y C+ C + F+    L+AH    H   G++S  C  C K   +S ++  H   H G + +KC  C + F+R +H   H +    E+P              C++C K F   + L  H        P          +Q    ++  ++  G ++P+KC+ C K F  +  L  H
Sbjct:  301 VHVGEKLKCDECGKEFSQGAHLQTHQKVHVIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEECGRAFSQASHLQDH-QRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGFICSSNLYIHQRVHTGEKP--------YKCEECGKGFSRPSSLQAH-QGVH--TGEKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKP------------YKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIHTG-EKPYKCEECGKGFSRRADLKIH 605          

HSP 5 Score: 87.4261 bits (215), Expect = 1.591e-17
Identity = 62/187 (33.16%), Postives = 92/187 (49.20%), Query Frame = 0
Query:  308 SSEQPRVNCDICQKSLKTKKMLWAHKVAVHFGGN-FPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWS-HLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEK--KATDGSEEV 490
            + E+P  NC+ C K  +    L AH+  VH G   F CE CGK     A L+ H   H+ ++ + C  CG  +K WS +L  H RVH  EK ++C  C   F   S L+ H  + H+  K  +C VC         +  H   HTG + + CEICG +F  + +L  H + H+ +K  K+  G + +
Sbjct:  610 TGEKP-YNCEECGKVFRQASNLLAHQ-RVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKPYKCDECGKGFK-WSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLH-QSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIHVGDKSYKSNRGGKNI 792          

HSP 6 Score: 87.0409 bits (214), Expect = 2.321e-17
Identity = 90/349 (25.79%), Postives = 138/349 (39.54%), Query Frame = 0
Query:  326 KKMLWAHKVAVHFG-GNFPCEICGKKCITGAELRRHMTSHSTERRFVCQYCGLAYKRWSHLYQHLRVHEEEKNFRCDVCHLNFKVQSELKDHCFAEHSDGKMVQCSVCKHKLQTPLAVYHHSMKHTGTRDFICEICGSNFKRKQHLVTHMKTHLTEKKATDGSEEVYHCQACDESFTLKMDLKAHCTAAHPLLGDESVACRTCQKRLKVSHSVYLHGLRHFGARDFKCTLCNQFFKRKAHLLRHSLDRHPEQPRERKKRTVQVDGITCDLCQKSFKYKNALVKHMTTQHGILP----------SQDPSTELGIVVKKGIKRPHKCDVCSKRFKSKNGLAKHKVNKHSLE 663
            K + + H   +H G  ++ C  C K     +    H    S E+   C   G  +     L  H +VH  EK  +CD C   F   + L+ H    H   K  +C  C        A+  H   HT  + + CE CG  F +  HL  H + H  EK         + C AC +SF+    L++H    H   G++   C  C K    S ++Y+H   H G + +KC  C + F R + L  H      E+               C +C K F   + L  H     G  P           ++   ++ +VV  G ++P+KC++C K F   + L  H+   HS+E
Sbjct:  235 KILTFDHNSMIHTGQKSYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKVHVGEK-LKCDECGKEFSQGAHLQTH-QKVHVIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEECGRAFSQASHLQDHQRLHTGEKP--------FKCDACGKSFSRNSHLQSH-QRVH--TGEKPYKCEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKS------------YICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTG-EKPYKCEICGKGFSQSSYLQIHQ-KAHSIE 556          
The following BLAST results are available for this feature:
BLAST of TCONS_00001345-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ZN2266.826e-3730.23Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 ... [more]
back to top