TCONS_00000069 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000069
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1710

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000069 ID=TCONS_00000069|Name=|organism=Clytia hemisphaerica|type=transcript|length=1710bp
CTTGTGTCAAATTTCAAGATGGAAATTACCAAGTTTAGCGTTTTATGGAC
AGAGGTTGACAGAAATAGAGCAGCACAGCGGCCTTCGCTCAGCATGTTCA
TAGCAAACGATACAAGTACACCTTCTACACACGTCCGAAGAAGAGGCTCT
GTACAAAGTATAAATTCGGACACTGACTCACGTGGCGTGTATGATCAAAA
ACAATACAAACGACGACGTAGAAGAACCTGGGAACGAGGTGAAACGGAAA
ACTCGTTGAAACGAAACCCGAATAATGCACCGAGGATTCGGATCAATGTT
CGGGGACGGAAATATGAAACGTACATAGacACACTTGACCGTTTTCCAGA
CACGTTACTAGGCAACAAAGAACTTCGTAACCAATATTACAATGAACGTA
AAGAAGAAATTGTCTTGGGTAGAAATTATGAAGTCTTCGAAGCCGTGCTC
TTCTATTAccaatcaaatgggatcttggCAAGACCAGCTTGGGTTAgcga
aaaagattttgaaaaagaactaaaGTTTTATCAACTGCAACCATCCGAAT
CTGAAAAActgagaaaagaaaaagaagctcAGAAACAAGCGGCTAAAACG
TTAGCATCAGAGCGCCGCCCTGCTTATCAGAAACTCATATGGAACCTTAT
GGAACACCCTCGTTCATCAACGCCCGCCTTCACATGCGCCATTCTCAGTA
TCTTTACAATCATCATTTCAGTCGTTGTAATCTGTCTTGAAACGATGTCC
TCGATCACAGACGATCCTGATAAAAAACGAGGCTACATTAATcgcaaagt
tttattttatcttgAAACGACAGTCATGATATGGTTTACTATGGAGTATT
TATTGAGAATCATTTCAGCTCCCAGAACGTTCAAATTCATATTATCACCT
ACAGGAATAATAGATTTGGTTGTTATATTACCTTATTACATCAATATTAT
AATCGGTGAAGAAATCCGTTCGTTTAATTTAGCGGTATTCCGTATAGTGC
GAATGTTTCGCGTTTTCAGGATTTTCAAATTAACTCGATACAGTACCGGA
TTGAAAGTGCTGGGTCGTACTATTCTTGAAAGTTTTGGACAACTTGTTGC
TCTCTTTCTCTGCTTATTTTTGTCAGCGATTCTATTctccagttgtttat
tttttatcgaACACGATAGCTTGGACCATAATTCCGAAGTGTTTATTAGT
ATTCCGGACACTTTTTGGTACGTCATCATTACTATGACTTCGGTTGGTTA
CGGAGACGTCGTTCCGCGAACGTTAATTGGACGTGTAGTTGCTGCCTTTT
GCATGGTAACAGGAATTATAGTTTTGTTATGTTTACCAACACCCGTCTTT
GTGACGCATTTCGGACGATTTTATGAAGACGTCATCAGTAGGCCGGCCAC
TGAACAAGAAGAGGATGATGAATTGACCGACTCTGAGATTTGGCGTAATG
GTGAACACAATCTTATGATCCCAAGGTGGGTCAATGATGATGCGTGGAAG
GAGAAAATTAGGACTGATGTTAATCAGAATCTGACGTTACCAGGGTTAAA
TGTTTACTTGAGTACGTCTAATCTGTTTTTATCCAGAGCTTGCAGTCAAG
AAGTGTTGCATAGTATTCATAACTCACCAAGTAAGTAGAATctggtaatt
ttgaaaaatgttttttttgtaaaaattatatactttttgggttttaccaa
agaaataaag
Run BLAST on NCBI

protein sequence of TCONS_00000069-protein

>TCONS_00000069-protein ID=TCONS_00000069-protein|Name=TCONS_00000069-protein|organism=Clytia hemisphaerica|type=polypeptide|length=545bp
LVSNFKMEITKFSVLWTEVDRNRAAQRPSLSMFIANDTSTPSTHVRRRGS
VQSINSDTDSRGVYDQKQYKRRRRRTWERGETENSLKRNPNNAPRIRINV
RGRKYETYIDTLDRFPDTLLGNKELRNQYYNERKEEIVLGRNYEVFEAVL
FYYQSNGILARPAWVSEKDFEKELKFYQLQPSESEKLRKEKEAQKQAAKT
LASERRPAYQKLIWNLMEHPRSSTPAFTCAILSIFTIIISVVVICLETMS
SITDDPDKKRGYINRKVLFYLETTVMIWFTMEYLLRIISAPRTFKFILSP
TGIIDLVVILPYYINIIIGEEIRSFNLAVFRIVRMFRVFRIFKLTRYSTG
LKVLGRTILESFGQLVALFLCLFLSAILFSSCLFFIEHDSLDHNSEVFIS
IPDTFWYVIITMTSVGYGDVVPRTLIGRVVAAFCMVTGIIVLLCLPTPVF
VTHFGRFYEDVISRPATEQEEDDELTDSEIWRNGEHNLMIPRWVNDDAWK
EKIRTDVNQNLTLPGLNVYLSTSNLFLSRACSQEVLHSIHNSPSK
Run BLAST on NCBI

transcript from alignment at sc0000001:1521423..1530269+

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000069 ID=TCONS_00000069|Name=TCONS_00000069|organism=Clytia hemisphaerica|type=transcript|length=8847bp|location=Sequence derived from alignment at sc0000001:1521423..1530269+ (Clytia hemisphaerica)
CTTGTGTCAAATTTCAAGATGGAAATTACCAAGTTTAGCGTTTTATGGAC AGAGGTTAGTAAGAAAAATGGGTCTTATACTTTTCCTCCAAAAATTATCA CATTATAGGATttgttcatttaaaaaatttaccgGTCGGGGATACGTCCG TCGGGGAAACGTCCGGTCACCAATATTCGAATACTAACAGTTTGTCACTT TCTAACGAGGATGAACTGTAATATTGAGCTAGTTTCTCGAAGGGAAATCA CGAAGCCCAAGTACACATTTTTGCCATGTTCTTAAgatattcttaaaatt tcgtCGACTTCCAGCCATGTTCTCATAAActtggttctaataaaaaagaa cGTGTAGTATAGTACAGGCTAGATCAGTTCTTTTCGTTGGAAAGATTATC TCAGATGATGGATAGTAAAATCTTGaattgaagaaaatattatcacccct tctcacagaccgactgggaccccttcctactggaaaaactggacaaaata tcgttcccagtggaaaattattctCCATTTTCGTCcatattgaaaataat cagaaaagcAAATCCTCACTAAAAAGTattgttctattttttttatcccc actggattttctggctcgaaagctgtgaaaaaacatgggaatatcaatcc ccatcccAATTTTACCGGGACTTTGAAAAAGGGGGTGTATATTAGGGAGA TAAACTTTGAAATCTAACACTCTAATGGGTAAGTAAAGATTAGGCTTGAT AATGGATAGCGGAggatttcttaaaaatattttgaaagtacaATTTCTTT CTGACTTTGAACGAACGATAATGACTATGAAAATCGATCAATTATTGAGT GACTGTGCTAATAGTAATGATGTTTATATTTCAAAGTTAGtgaaaaatca gtgattttttgaaagttcataGGGCAGATAGATGGATAGATTCATTATGT TAGACTTGGTTGGAAATTCATTTCTATCGTGTGGCCTTTGAAGCCAAACA ATCAACATCGCGGTCGAGACAGGGCCCCTATAATTCGCGTTTTCCCCGTT TTTCGATACATTGTAAGGTATTGCACTGTGAGAGTTTTCATAGAAAGAAT GTTTATAGAGGAAAGAAAAATGTATGAGATATAGAAGAAGAGAATAGTGG AATGGCAGAAAATATAAGATAATTAGGAGGGggtataaagtaaaaaaaat atagAGGGAAAAGAAAATTGGGTTGAATATATATCTTCTATGGTGgcgat gaaaaagaaaagattttttgtgtGAATGAACATAAAcagattatttttgt tttatgtttgttgatcttaaacaaaaagtttgatactgaGCCCTTTTTAA AAGTTCGcgatttttactgatttttagtgagagaaaatgaagaaaaatgg aCGTCATTTGCTACCAatcatcttctttttcaattctttcattttctcat CTTGATTTAGGGGATAAGAATTAAGTAAAAAATTATCAGGAATGAATGAA ACGACTattttagtttgttttgtttggttttttaatgtttttctttttgg tgtTCTTTAAATAGGTTGCTAATTTTTATCCTTTAATACTATTTTAGATC TgatttagtttcatgttttttgtttacatgaTGAAGGGGGTTGGTACAGA GGTTTGACTTAAATTATCTTTTTCTAATGAAcatttaaaatgttaaaaat ttgttAGTTAAgttttctttatatttctttttgacTAATTTATTCACAAA TTGATTCACGCACATAGTtcaactttattttttaatatggtCTGTTtagt acatgtttttctttcgaATCTAACAGTCATCATGTTGTTTTGATTATACA TAGTAGACTTGTGGTAGACATGATAAATACAGCTACGTgctctcattttg aaaatatgaaattttaaatttccttGATTCACAACGCTGAAACATCttga atattttgttttgaatgattGTTGAGAGTGTCACCAgcatgaattttttg tttgggAATGAAGTAAGTTTGATCATTTTAAAAGAATGCAATCTAAGAct caaagattcttttttttataagaacaatgttttaagaacaacgaggctgg aaaatataagaacaatttaagaataatgctgACCCTGTGGAACTGCCGAG TTTCAAGAAATTCAaagatgttctttttttttaagatatctCAATCTTGC TCCTAAAATATAGGAACAgtataagaacaatctgaggATTAGAGGTTCAA AAATAAGAATGGTCGGTCCTTAAGAAAAGTTAAGACTACAAttcactggt tcttataaaaaaaggagtATACGGCATTAAAGTTAAACCCGTAGCCGACT AAGATTTCGACAgacctgtctcacagccccggtggaactctTTTTCTTAA TGggaataaaaattctattgttccaaggttaaaaaatccagtggggatgg ttttggagtgcaatttttaaacattgaatttcgagtggggatgaaatcaa agtcaattttccaatggggctaaaattccagggtattttccaacCGCGCT acattttccagtggggctggggttccAGCGGGTTTGTAACACAGGGGTGC ATTTTGTCAAAACGAAAAAGTTAGAGGGTTTGATCAGACGAAAAGCTGAG GCGTCAAAGAAGAAATGGACCAACTATGAAAAGCGGTTTCCGTGATGGCG TGATAAGGAACTTTTTCTTGCGTAATAACgtgttttgcaaattttttatt ccaTCTTTGAGTGATCAGAGGTCAAAGCGTGATTGTGAttggaaagattt ttgagccgtgatgcgtGATCTGGACTTTCTCAAAAGGAATGCGTgattat ccaaattttttatttattttcgtgatcgtgattgaagacaaaaaatagCG CAACATTGTGATAAATCATAcattcaatttttgaagtttAAATCTATCCT CTACTTTGAAATGACATGTATATGTGTTCATTGTACTGGGCTAAGTTACG TTAATAATACTCCGGTATAGATAATATTTTGATATCCCGCACTGGCATTG TTTGCACTCGTGGGTCTGTAAGAGAATTTGGCCAGGTTTGCTATTCAGAT TCGGAACGAATTAACCCAGTCGCTTTCGAGCATGAGGCAAGgaggttttg aatgttttgactAAACAACCAGTAAGATCGTCACATTCGCCATATCCTAT TAGCAAAGCGTGGTAttcgcagaatggatgatctgttacacgttttttta taccaacaaactatataagaacataaggcttcgacggccaaaattttcag aatatttttaaggctttatggactcaaaaacactcgatttcttaggaaaa tgggtaaaaatggtcaaaaatttgttaaaataagaacatgctaaggaCAT CTCTTAGTGAAGAGTATGAGATGACAGACTTTTGAAAGATGAGGAAGAGA GAAGAAACCACATATGATTCTAGACACGCGGTAGGGGGCGAAGCAAAGCA GCTACCTCCATTTAATCGTGATTCGAATTAAAATAACTGAGATAAATCGA AATTAATTTGCCATTCAAAAGGGTAGGGTTTCATTTTTCATAGATTCCAA TTGAAATCTATGACGACTGCATAATGAATTGAATATGTCAAAATGAATTC GATAGCCAGGGGAGGTGCTATTGTTTCgactgttcttttttgtttcctGT CTGTGATTTGATGTATCGAAAATCATTTCCGTGTAAAGTTAACGTGACAT GTGgggaagttgaatttttctGAGTCAGTTTATTTTCTGAGTCAGTTTAT TTTCTGGTGTAAAAAATATTGAACCGTTGAACAGATTTAGTGTTGATACT ACTAGAATTCCAAAATGACTCCACAGTCAACAGATGATGAGGTAGGATTT ATCAACATTCTCCAATATACCGTGTGCATCAAGAAAAAGTTGATTCTTTT TTATTCTATATAGGAAAActcaacttaaattttggtatatgaAGCTTCAG TTCAGTCAATCAAAACCTAtgtttaaaaacctgaaaattttgaCCTACCT AAAATGACAAAATCACACTTGCgtatgtttcttttctcttctaACTCCAC ACTTAACAAATTATAAGGTGGGATTCAATAACATTCTCCAATATACAAGC AAACTTTCTTCCTTGAGTAAATTATTCACTGtatgtttcttttgtttctc ttttctaaaactttttaaaactgCAATCTACAGTACTAACggtacccggg gggggggggNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcaattttttcaaa atctgtcgTTGCTATACATGAGGATATTTATAAGATTTTTCAGGAAAGTT GTGAACGATTGCCGCGTTTACgcttgtatttttttaaattaaaatgccgt ttgaagaaactttttgttaatttaatgCAGGCTGTGTACTGTATTAAACA TTTTCACTTACACACCTCAAAAGCAAGCTCAgtaatatgcttgtaatatg cttattttttagacaaattcaggTCTTGGTATgcttatgcttataaaaaa aacatgtagtctaGATATTTTGCCCAAatatgctagaattttgaccattt tttgctcaaaaaggattgaaaattTGGGAGGAAATGTACTCTAAGGGAAC GGTACTCTTTACCAGAGCAGAGTGTCTATATCTTACGTACTGTGTGACTT AGTATAGCCTTTCACTATCCCAACACATGATTTCTCTAGCACTCTGTGGG ACAGGGTtgaggaaaaagccgtggtcgttTGCCGCAGTGGTAGTTACAGA GCCAAAGCCGATCGAGCACCAAATAACGCCCCACGCAGCGAAGCCCATAG TGATAAAGAGGCGGTGCAACAACAAGACAGTTAAGTCTGTGTGTGGATAA GCCTGGTGTTATGTAGTGCGTTAATGAATTATGAATGAAATTCCGTATGT ATCGGGTCTGGCATTATACATTCAGATATTGGGTACATCTACCTTGAAAT AACACAAAACCAAGCTGGCGAATAACTCACAAAATTCGGTCAATTCGGTT CGTCTCTCGAAGTATtcggaaattttcattttcagtggataCCTATGTTT TCATTTAAGTACGGTACATCTGCTGGAACAAAGTAGTTTTGCCGTTTTTA ACAAGCCAatgcaaaattttataaaatttgaaatttttcttcaagcCTGT GCTTATCATATTTGCATGACAACTTTAACACCTTGAGTGAAAAGGCTCTG TTGGACAGATTCTATTATGAATAAAATCAACATCTTAAGTGTGAAATGGG TAAATATTAAGTTCAGTGAATTTCCAAATACTGTATATAAGCGAGCCTCA AAGAAAAGCTGCAAACTTAAATTACCATCTGCAATGCTTGAAACTTTTCC AGACAGTAGGGTTTAGAAAGTGAGAGAGCTTTTAACTTATTCCTGTCaag actatatatatatatatacggGATTGACGGCATATTTAAGAACGTCATAA tacagtctccataactcgaacacgttcgggaacacaaatttgttcgagtt aaagagatttcgagatatggagtaaggtttacaTGGCATAACTgcggacg agaaaacttgttcgagttaaggagatattcgagttaaagaggttcgagtt aaagagactctactgtaattCTAAGCAGGGAACTCTCAGCAGGCACACAa cgctgtttcaacgttcatctaacgttatatggacgttgtgaacgttagat aaacgttgaaacaacgttgtatgccagCTGGGTAGTTATTGATGATAAGT GTAGCCAAGTCTGAGAAGAAAACGTTTCAAATTCTTCATTTTATAAATTG ATAGGTTGACAGAAATAGAGCAGCACAGCGGCCTTCGCTCAGCATGTTCA TAGCAAACGATACAAGTACACCTTCTACACACGTCCGAAGAAGAGGCTCT GTACAAAGTATAAATTCGGACACTGACTCACGTGGCGTGTATGATCAAAA ACAATACAAACGACGACGTAGAAGAACCTGGGAACGAGGTGAAACGGAAA ACTCGTTGAAACGAAACCCGAATAATGCACCGAGGATTCGGATCAATGTT CGGGGACGGAAATATGAAACGTACATAGGTAAGATAGttgaatttccatt tttcattgaaaactgaaaaacctCCAGTGTCACATCACGATTTGAATTAT TTCAAACTCCTACAGGGTCAATGAATGGATAGACATTATTTGAGGCTAGA AAAGCGTTGCTTCCAGCTCAAAGATTATCCAGAGGTCAGAAAGTTGGTAC ggattttttttgtaagaagcctttgttcttttaacttttttagttttaag cctaaagatgtttttattttcaccactttgtgggtatttctttccatttt cctaagaaatcgggtgttttagagtccgcaaagccttgaaatgttcttgc cttgttcttaaaatgttggCCATCGAaacattatgttcttatattctTTG CAAAAAACATGTATCAATTAGATAGTGAGAAGGCNGTTCTTAAAATGTTG GCCATCGAaacattatgttcttatattctTTGCAAAAAACATGTAAATTA GATAGTGAGAAAGGTACTTTCAAATAAGTTTCCATAATATTAAACAAATT CtccattttctttttattagacACACTTGACCGTTTTCCAGACACGTTAC TAGGCAACAAAGAACTTCGTAACCAATATTACAATGAACGTAAAGAAGAA ATTGTCTTGGGTAGAAATTATGAAGTCTTCGAAGCCGTGCTCTTCTATTA ccaatcaaatgggatcttggGTAAGTTTTTAAGAAGACAAAACTCTCAca acaagttttcaaaaaatcttggcGGAAATTACAATAAATCTTTTGTCCCA TGGATCTTTGACCAAAGCCTTACCCTTACAAGCAAAACGGAAATCGTACA AACAAGTTACGCAACTATACGATAAAGTCGTTCTTTCTAATAATATTGAT TTAATCAAGATAATCAGGAATTTTATACACCATTAGCATcagcatcccct atatcaaaacatatcagagggaaTGCGTGCAGCCTAATAGAATTTTAAAC ATTATTCCATTCCAGCAAGACCAGCTTGGGTTAgcgaaaaagattttgaa aaagaactaaaGTTTTATCAACTGCAACCATCCGAATCTGAAAAActgag aaaagaaaaagaagctcAGAAACAAGCGGCTAAAACGTTAGCATCAGAGC GCCGCCCTGCTTATCAGAAACTCATATGGAACCTTATGGAACACCCTCGT TCATCAACGCCCGCCTTCACATGCGCCATTCTCAGTATCTTTACAATCAT CATTTCAGTCGTTGTAATCTGTCTTGAAACGATGTCCTCGATCACAGACG ATCCTGATAAAAAACGAGGCTACATTAATcgcaaagttttattttatctt gAAACGACAGTCATGATATGGTTTACTATGGAGTATTTATTGAGAATCAT TTCAGCTCCCAGAACGTTCAAATTCATATTATCACCTACAGGAATAATAG ATTTGGTTGTTATATTACCTTATTACATCAATATTATAATCGGTGAAGAA ATCCGTTCGTTTAATTTAGCGGTATTCCGTATAGTGCGAATGTTTCGCGT TTTCAGGATTTTCAAATTAACTCGATACAGTACCGGATTGAAAGTGCTGG GTCGTACTATTCTTGAAAGTTTTGGACAACTTGTTGCTCTCTTTCTCTGC TTATTTTTGTCAGCGATTCTATTctccagttgtttattttttatcgaACA CGATAGCTTGGACCATAATTCCGAAGTGTTTATTAGTATTCCGGACACTT TTTGGTACGTCATCATTACTATGACTTCGGTTGGTTACGGAGACGTCGTT CCGCGAACGTTAATTGGACGTGTAGTTGCTGCCTTTTGCATGGTAACAGG AATTATAGTTTTGTTATGTTTACCAACACCCGTCTTTGTGACGCATTTCG GACGATTTTATGAAGACGTCATCAGTAGGCCGGCCACTGAACAAGAAGAG GATGATGAATTGACCGACTCTGAGATTTGGCGTAATGGTGAACACAATCT TATGATCCCAAGGTGGGTCAATGATGATGCGTGGAAGGAGAAAATTAGGA CTGATGTTAATCAGAATCTGACGTTACCAGGGTTAAATGTTTACTTGAGT ACGTCTAATCTGTTTTTATCCAGAGCTTGCAGTCAAGAAGTGTTGCATAG TATTCATAACTCACCAAGTAAGTAGAATctggtaattttgaaaaatgttt tttttgtaaaaattatatactttttgggttttaccaaagaaataaag

Coding sequence (CDS) from alignment at sc0000001:1521423..1530269+

>TCONS_00000069 ID=TCONS_00000069|Name=|organism=Clytia hemisphaerica|type=CDS|length=6552bp|location=Sequence derived from alignment at sc0000001:1521423..1530269+ (Clytia hemisphaerica)
CTTGTGTCAAATTTCAAGATGGAAATTACCAAGTTTAGCGTTTTATGGAC
AGAGGTTGACAGAAATAGAGCAGCACAGCGGCCTTCGCTCAGCATGTTCA
TAGCAAACGATACAAGTACACCTTCTACACACGTCCGAAGAAGAGGCTCT
GTACAAAGTATAAATTCGGACACTGACTCACGTGGCGTGTATGATCAAAA
ACAATACAAACGACGACGTAGAAGAACCTGGGAACGAGGTGAAACGGAAA
ACTCGTTGAAACGAAACCCGAATAATGCACCGAGGATTCGGATCAATGTT
CGGGGACGGAAATATGAAACGTACATAGacACACTTGACCGTTTTCCAGA
CACGTTACTAGGCAACAAAGAACTTCGTAACCAATATTACAATGAACGTA
AAGAAGAAATTGTCTTGGGTAGAAATTATGAAGTCTTCGAAGCCGTGCTC
TTCTATTAccaatcaaatgggatcttggCAAGACCAGCTTGGGTTAgcga
aaaagattttgaaaaagaactaaaGTTTTATCAACTGCAACCATCCGAAT
CTGAAAAActgagaaaagaaaaagaagctcAGAAACAAGCGGCTAAAACG
TTAGCATCAGAGCGCCGCCCTGCTTATCAGAAACTCATATGGAACCTTAT
GGAACACCCTCGTTCATCAACGCCCGCCTTCACATGCGCCATTCTCAGTA
TCTTTACAATCATCATTTCAGTCGTTGTAATCTGTCTTGAAACGATGTCC
TCGATCACAGACGATCCTGATAAAAAACGAGGCTACATTAATcgcaaagt
tttattttatcttgAAACGACAGTCATGATATGGTTTACTATGGAGTATT
TATTGAGAATCATTTCAGCTCCCAGAACGTTCAAATTCATATTATCACCT
ACAGGAATAATAGATTTGGTTGTTATATTACCTTATTACATCAATATTAT
AATCGGTGAAGAAATCCGTTCGTTTAATTTAGCGGTATTCCGTATAGTGC
GAATGTTTCGCGTTTTCAGGATTTTCAAATTAACTCGATACAGTACCGGA
TTGAAAGTGCTGGGTCGTACTATTCTTGAAAGTTTTGGACAACTTGTTGC
TCTCTTTCTCTGCTTATTTTTGTCAGCGATTCTATTctccagttgtttat
tttttatcgaACACGATAGCTTGGACCATAATTCCGAAGTGTTTATTAGT
ATTCCGGACACTTTTTGGTACGTCATCATTACTATGACTTCGGTTGGTTA
CGGAGACGTCGTTCCGCGAACGTTAATTGGACGTGTAGTTGCTGCCTTTT
GCATGGTAACAGGAATTATAGTTTTGTTATGTTTACCAACACCCGTCTTT
GTGACGCATTTCGGACGATTTTATGAAGACGTCATCAGTAGGCCGGCCAC
TGAACAAGAAGAGGATGATGAATTGACCGACTCTGAGATTTGGCGTAATG
GTGAACACAATCTTATGATCCCAAGGTGGGTCAATGATGATGCGTGGAAG
GAGAAAATTAGGACTGATGTTAATCAGAATCTGACGTTACCAGGGTTAAA
TGTTTACTTGAGTACGTCTAATCTGTTTTTATCCAGAGCTTGCAGTCAAG
AAGTGTTGCATAGTATTCATAACTCACCAAGTAAGTAGCTTGTGTCAAAT
TTCAAGATGGAAATTACCAAGTTTAGCGTTTTATGGACAGAGGTTGACAG
AAATAGAGCAGCACAGCGGCCTTCGCTCAGCATGTTCATAGCAAACGATA
CAAGTACACCTTCTACACACGTCCGAAGAAGAGGCTCTGTACAAAGTATA
AATTCGGACACTGACTCACGTGGCGTGTATGATCAAAAACAATACAAACG
ACGACGTAGAAGAACCTGGGAACGAGGTGAAACGGAAAACTCGTTGAAAC
GAAACCCGAATAATGCACCGAGGATTCGGATCAATGTTCGGGGACGGAAA
TATGAAACGTACATAGacACACTTGACCGTTTTCCAGACACGTTACTAGG
CAACAAAGAACTTCGTAACCAATATTACAATGAACGTAAAGAAGAAATTG
TCTTGGGTAGAAATTATGAAGTCTTCGAAGCCGTGCTCTTCTATTAccaa
tcaaatgggatcttggCAAGACCAGCTTGGGTTAgcgaaaaagattttga
aaaagaactaaaGTTTTATCAACTGCAACCATCCGAATCTGAAAAActga
gaaaagaaaaagaagctcAGAAACAAGCGGCTAAAACGTTAGCATCAGAG
CGCCGCCCTGCTTATCAGAAACTCATATGGAACCTTATGGAACACCCTCG
TTCATCAACGCCCGCCTTCACATGCGCCATTCTCAGTATCTTTACAATCA
TCATTTCAGTCGTTGTAATCTGTCTTGAAACGATGTCCTCGATCACAGAC
GATCCTGATAAAAAACGAGGCTACATTAATcgcaaagttttattttatct
tgAAACGACAGTCATGATATGGTTTACTATGGAGTATTTATTGAGAATCA
TTTCAGCTCCCAGAACGTTCAAATTCATATTATCACCTACAGGAATAATA
GATTTGGTTGTTATATTACCTTATTACATCAATATTATAATCGGTGAAGA
AATCCGTTCGTTTAATTTAGCGGTATTCCGTATAGTGCGAATGTTTCGCG
TTTTCAGGATTTTCAAATTAACTCGATACAGTACCGGATTGAAAGTGCTG
GGTCGTACTATTCTTGAAAGTTTTGGACAACTTGTTGCTCTCTTTCTCTG
CTTATTTTTGTCAGCGATTCTATTctccagttgtttattttttatcgaAC
ACGATAGCTTGGACCATAATTCCGAAGTGTTTATTAGTATTCCGGACACT
TTTTGGTACGTCATCATTACTATGACTTCGGTTGGTTACGGAGACGTCGT
TCCGCGAACGTTAATTGGACGTGTAGTTGCTGCCTTTTGCATGGTAACAG
GAATTATAGTTTTGTTATGTTTACCAACACCCGTCTTTGTGACGCATTTC
GGACGATTTTATGAAGACGTCATCAGTAGGCCGGCCACTGAACAAGAAGA
GGATGATGAATTGACCGACTCTGAGATTTGGCGTAATGGTGAACACAATC
TTATGATCCCAAGGTGGGTCAATGATGATGCGTGGAAGGAGAAAATTAGG
ACTGATGTTAATCAGAATCTGACGTTACCAGGGTTAAATGTTTACTTGAG
TACGTCTAATCTGTTTTTATCCAGAGCTTGCAGTCAAGAAGTGTTGCATA
GTATTCATAACTCACCAAGTAAGTAGCTTGTGTCAAATTTCAAGATGGAA
ATTACCAAGTTTAGCGTTTTATGGACAGAGGTTGACAGAAATAGAGCAGC
ACAGCGGCCTTCGCTCAGCATGTTCATAGCAAACGATACAAGTACACCTT
CTACACACGTCCGAAGAAGAGGCTCTGTACAAAGTATAAATTCGGACACT
GACTCACGTGGCGTGTATGATCAAAAACAATACAAACGACGACGTAGAAG
AACCTGGGAACGAGGTGAAACGGAAAACTCGTTGAAACGAAACCCGAATA
ATGCACCGAGGATTCGGATCAATGTTCGGGGACGGAAATATGAAACGTAC
ATAGacACACTTGACCGTTTTCCAGACACGTTACTAGGCAACAAAGAACT
TCGTAACCAATATTACAATGAACGTAAAGAAGAAATTGTCTTGGGTAGAA
ATTATGAAGTCTTCGAAGCCGTGCTCTTCTATTAccaatcaaatgggatc
ttggCAAGACCAGCTTGGGTTAgcgaaaaagattttgaaaaagaactaaa
GTTTTATCAACTGCAACCATCCGAATCTGAAAAActgagaaaagaaaaag
aagctcAGAAACAAGCGGCTAAAACGTTAGCATCAGAGCGCCGCCCTGCT
TATCAGAAACTCATATGGAACCTTATGGAACACCCTCGTTCATCAACGCC
CGCCTTCACATGCGCCATTCTCAGTATCTTTACAATCATCATTTCAGTCG
TTGTAATCTGTCTTGAAACGATGTCCTCGATCACAGACGATCCTGATAAA
AAACGAGGCTACATTAATcgcaaagttttattttatcttgAAACGACAGT
CATGATATGGTTTACTATGGAGTATTTATTGAGAATCATTTCAGCTCCCA
GAACGTTCAAATTCATATTATCACCTACAGGAATAATAGATTTGGTTGTT
ATATTACCTTATTACATCAATATTATAATCGGTGAAGAAATCCGTTCGTT
TAATTTAGCGGTATTCCGTATAGTGCGAATGTTTCGCGTTTTCAGGATTT
TCAAATTAACTCGATACAGTACCGGATTGAAAGTGCTGGGTCGTACTATT
CTTGAAAGTTTTGGACAACTTGTTGCTCTCTTTCTCTGCTTATTTTTGTC
AGCGATTCTATTctccagttgtttattttttatcgaACACGATAGCTTGG
ACCATAATTCCGAAGTGTTTATTAGTATTCCGGACACTTTTTGGTACGTC
ATCATTACTATGACTTCGGTTGGTTACGGAGACGTCGTTCCGCGAACGTT
AATTGGACGTGTAGTTGCTGCCTTTTGCATGGTAACAGGAATTATAGTTT
TGTTATGTTTACCAACACCCGTCTTTGTGACGCATTTCGGACGATTTTAT
GAAGACGTCATCAGTAGGCCGGCCACTGAACAAGAAGAGGATGATGAATT
GACCGACTCTGAGATTTGGCGTAATGGTGAACACAATCTTATGATCCCAA
GGTGGGTCAATGATGATGCGTGGAAGGAGAAAATTAGGACTGATGTTAAT
CAGAATCTGACGTTACCAGGGTTAAATGTTTACTTGAGTACGTCTAATCT
GTTTTTATCCAGAGCTTGCAGTCAAGAAGTGTTGCATAGTATTCATAACT
CACCAAGTAAGTAGCTTGTGTCAAATTTCAAGATGGAAATTACCAAGTTT
AGCGTTTTATGGACAGAGGTTGACAGAAATAGAGCAGCACAGCGGCCTTC
GCTCAGCATGTTCATAGCAAACGATACAAGTACACCTTCTACACACGTCC
GAAGAAGAGGCTCTGTACAAAGTATAAATTCGGACACTGACTCACGTGGC
GTGTATGATCAAAAACAATACAAACGACGACGTAGAAGAACCTGGGAACG
AGGTGAAACGGAAAACTCGTTGAAACGAAACCCGAATAATGCACCGAGGA
TTCGGATCAATGTTCGGGGACGGAAATATGAAACGTACATAGacACACTT
GACCGTTTTCCAGACACGTTACTAGGCAACAAAGAACTTCGTAACCAATA
TTACAATGAACGTAAAGAAGAAATTGTCTTGGGTAGAAATTATGAAGTCT
TCGAAGCCGTGCTCTTCTATTAccaatcaaatgggatcttggCAAGACCA
GCTTGGGTTAgcgaaaaagattttgaaaaagaactaaaGTTTTATCAACT
GCAACCATCCGAATCTGAAAAActgagaaaagaaaaagaagctcAGAAAC
AAGCGGCTAAAACGTTAGCATCAGAGCGCCGCCCTGCTTATCAGAAACTC
ATATGGAACCTTATGGAACACCCTCGTTCATCAACGCCCGCCTTCACATG
CGCCATTCTCAGTATCTTTACAATCATCATTTCAGTCGTTGTAATCTGTC
TTGAAACGATGTCCTCGATCACAGACGATCCTGATAAAAAACGAGGCTAC
ATTAATcgcaaagttttattttatcttgAAACGACAGTCATGATATGGTT
TACTATGGAGTATTTATTGAGAATCATTTCAGCTCCCAGAACGTTCAAAT
TCATATTATCACCTACAGGAATAATAGATTTGGTTGTTATATTACCTTAT
TACATCAATATTATAATCGGTGAAGAAATCCGTTCGTTTAATTTAGCGGT
ATTCCGTATAGTGCGAATGTTTCGCGTTTTCAGGATTTTCAAATTAACTC
GATACAGTACCGGATTGAAAGTGCTGGGTCGTACTATTCTTGAAAGTTTT
GGACAACTTGTTGCTCTCTTTCTCTGCTTATTTTTGTCAGCGATTCTATT
ctccagttgtttattttttatcgaACACGATAGCTTGGACCATAATTCCG
AAGTGTTTATTAGTATTCCGGACACTTTTTGGTACGTCATCATTACTATG
ACTTCGGTTGGTTACGGAGACGTCGTTCCGCGAACGTTAATTGGACGTGT
AGTTGCTGCCTTTTGCATGGTAACAGGAATTATAGTTTTGTTATGTTTAC
CAACACCCGTCTTTGTGACGCATTTCGGACGATTTTATGAAGACGTCATC
AGTAGGCCGGCCACTGAACAAGAAGAGGATGATGAATTGACCGACTCTGA
GATTTGGCGTAATGGTGAACACAATCTTATGATCCCAAGGTGGGTCAATG
ATGATGCGTGGAAGGAGAAAATTAGGACTGATGTTAATCAGAATCTGACG
TTACCAGGGTTAAATGTTTACTTGAGTACGTCTAATCTGTTTTTATCCAG
AGCTTGCAGTCAAGAAGTGTTGCATAGTATTCATAACTCACCAAGTAAGT
AG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000035XLOC_000035Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000069-exon-sc0000001-1491911889:1521423..1521476TCONS_00000069-exon-sc0000001-1491911889:1521423..1521476Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1510915933:1521423..1521476TCONS_00000069-exon-sc0000001-1510915933:1521423..1521476Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1575043694:1521423..1521476TCONS_00000069-exon-sc0000001-1575043694:1521423..1521476Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1491911889:1527777..1528050TCONS_00000069-exon-sc0000001-1491911889:1527777..1528050Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1510915933:1527777..1528050TCONS_00000069-exon-sc0000001-1510915933:1527777..1528050Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1575043694:1527777..1528050TCONS_00000069-exon-sc0000001-1575043694:1527777..1528050Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1491911889:1528593..1528742TCONS_00000069-exon-sc0000001-1491911889:1528593..1528742Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1510915933:1528593..1528742TCONS_00000069-exon-sc0000001-1510915933:1528593..1528742Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1575043694:1528593..1528742TCONS_00000069-exon-sc0000001-1575043694:1528593..1528742Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1491911889:1529038..1530269TCONS_00000069-exon-sc0000001-1491911889:1529038..1530269Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1510915933:1529038..1530269TCONS_00000069-exon-sc0000001-1510915933:1529038..1530269Clytia hemisphaericaexon
TCONS_00000069-exon-sc0000001-1575043694:1529038..1530269TCONS_00000069-exon-sc0000001-1575043694:1529038..1530269Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000069-proteinTCONS_00000069-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1521423..1530269 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.41816 1.19854 0.294382 0.261824 2.80496 0.348709 3.43383 1.59196 2.0316 3.50332 2.46311 2.42419 0.484773 2.98747 2.72386 2.80715 2.66153 1.34492 4.57287 2.91587 1.98818 2.2405 2.92687 3.37546 0.395924 4.07671 0.421327 0 1.31171 4.76994e-06
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR028325VG_K_chnl
IPR005821Ion_trans_dom
IPR003131T1-type_BTB
IPR011333SKP1/BTB/POZ
Vocabulary: Biological Process
TermDefinition
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0051260protein homooligomerization
Vocabulary: Molecular Function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
Vocabulary: Cellular Component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006811 ion transport
biological_process GO:0006813 potassium ion transport
biological_process GO:0051260 protein homooligomerization
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016020 membrane
cellular_component GO:0008076 voltage-gated potassium channel complex
molecular_function GO:0005216 ion channel activity
molecular_function GO:0005249 voltage-gated potassium channel activity
Blast
BLAST of TCONS_00000069 vs. Swiss-Prot (Human)
Match: KCNA1 (Potassium voltage-gated channel subfamily A member 1 OS=Homo sapiens GN=KCNA1 PE=1 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 8.489e-65
Identity = 151/402 (37.56%), Postives = 231/402 (57.46%), Query Frame = 1
Query:  304 GRKYETYIDTLDRFPDTLLGNKELRNQYYNERKEEIVLGRNYEVFEAVLFYYQSNGILARPAWVSEKDFEKELKFYQLQPSESEKLRXXXXXXXXXXXTLASERRP----AYQKLIWNLMEHPRSSTPAFTCAXXXXXXXXXXXXXXCLETMSSITDDPDKKRGYINR--------------KVLFYLETTVMIWFTMEYLLRIISAPRTFKFILSPTGIIDLVVILPYYINIIIGEEI----------RSFNLAXXXXXXXXXXXXXXKLTRYSTGLKVLGRTILESFGQLVALFLCLFLSAILFSSCLFFIEHDSLDHNSEVFISIPDTFWYVIITMTSVGYGDVVPRTLIGRVVAAFCMVTGIIVLLCLPTPVFVTHFGRFYEDVISRPATEQEEDDEL 1425
            G ++ET + TL +FP+TLLGN + R +Y++  + E    RN   F+A+L+YYQS G L RP  V    F +E+KFY+L     EK R+++         +  E RP     YQ+ +W L E+P SS PA   AI+S+  I+IS+V+ CLET+  + DD D   G ++R                 F +ET  +IWF+ E ++R  + P    F  +    ID+V I+PY+I   +G EI          ++ +LA+ R++R+ RVFRIFKL+R+S GL++LG+T+  S  +L  L   LF+  ILFSS ++F E +  + +   F SIPD FW+ +++MT+VGYGD+ P T+ G++V + C + G++  + LP PV V++F  FY        TE EE  +L
Sbjct:   45 GLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGF-------IKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFT-GTVHRIDNTTVIYNSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFIT--LGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESH---FSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLT-IALPVPVIVSNFNYFYHR-----ETEGEEQAQL 427          
The following BLAST results are available for this feature:
BLAST of TCONS_00000069 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KCNA18.489e-6537.56Potassium voltage-gated channel subfamily A member... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php