Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00067882-protein ID=TCONS_00067882-protein|Name=TCONS_00067882-protein|organism=Clytia hemisphaerica|type=polypeptide|length=634bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00067882-protein vs. Swiss-Prot (Human)
Match: PRCC (Proline-rich protein PRCC OS=Homo sapiens GN=PRCC PE=1 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 1.675e-19 Identity = 48/106 (45.28%), Postives = 70/106 (66.04%), Query Frame = 0 Query: 534 IDQEAMRALQGRKRRRGEEINIIDVNAQDLQVDKDEYL-KNLT----VESGYKNKAPQDAGISSQQKRKHQITYLAFQAKEREFELRQSWADSRASKQQTQSKYGF 634 ID EA + LQG++ R EEIN +++ D +++ K+LT ++S K K Q G QQ+RKHQITYL QAKERE EL+ +W++++ S++QTQ+KYGF Sbjct: 389 IDDEAFKRLQGKRNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTG---QQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYGF 491 The following BLAST results are available for this feature:
BLAST of TCONS_00067882-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|