Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00043642-protein ID=TCONS_00043642-protein|Name=TCONS_00043642-protein|organism=Clytia hemisphaerica|type=polypeptide|length=105bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00043642-protein vs. Swiss-Prot (Human)
Match: CCNB1 (G2/mitotic-specific cyclin-B1 OS=Homo sapiens GN=CCNB1 PE=1 SV=1) HSP 1 Score: 85.5001 bits (210), Expect = 5.645e-21 Identity = 45/102 (44.12%), Postives = 65/102 (63.73%), Query Frame = 0 Query: 1 LVDYDMATLLPSQIAAAASYLSTQLLDKEKAEWTPTLAHYSTYSEAAIFPIVCQMAKLVLTMNMEGSKYQAVKSKYAESKFMKISRYPVLVGPYMRELADQV 102 ++DYDM PSQIAA A L+ ++LD EWTPTL HY +Y+E ++ P++ +AK V+ +N +K+ VK+KYA SK KIS P L +++LA V Sbjct: 331 MLDYDMVHFPPSQIAAGAFCLALKILDN--GEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAV 430 The following BLAST results are available for this feature:
BLAST of TCONS_00043642-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|