Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00020087-protein ID=TCONS_00020087-protein|Name=TCONS_00020087-protein|organism=Clytia hemisphaerica|type=polypeptide|length=186bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00020087-protein vs. Swiss-Prot (Human)
Match: NDUF3 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Homo sapiens GN=NDUFAF3 PE=1 SV=1) HSP 1 Score: 129.798 bits (325), Expect = 2.500e-38 Identity = 60/111 (54.05%), Postives = 76/111 (68.47%), Query Frame = 0 Query: 70 VGRYSTQGFHIQGNKLYGPVALLPRSFYSWKVKDASDITVKSLQLFTVAEPKIEILVIGTGLKIERLSQEVRDYMRRHNIALEVLDTPNACSTFNFLLEENRMPGAALIPP 180 + Y+++GF I GN++ GP ALLP S W V DIT S LF + EP+IEI+V+GTG + ERL +V MR+ IA+EV DTPNAC+TFNFL E R+ GAALIPP Sbjct: 60 IDSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPP 170 The following BLAST results are available for this feature:
BLAST of TCONS_00020087-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|