Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00000103-protein ID=TCONS_00000103-protein|Name=TCONS_00000103-protein|organism=Clytia hemisphaerica|type=polypeptide|length=216bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00000103-protein vs. Swiss-Prot (Human)
Match: PARL (Presenilins-associated rhomboid-like protein, mitochondrial OS=Homo sapiens GN=PARL PE=1 SV=2) HSP 1 Score: 137.887 bits (346), Expect = 4.972e-39 Identity = 63/111 (56.76%), Postives = 79/111 (71.17%), Query Frame = 0 Query: 106 KVAVGSAVPSLGASGALLAVLAACCIERPDARLSILFLPFFTFSAQTALYSIIAIDVTGLLLRWKLFDHAGHLGGTLFGSWYVMKGHEWTWDKRGPFIRWWHELRQSMNEK 216 KVA G PSLGASGA++ VLAA C + P+ RL+I+FLP FTF+A AL +IIA+D G++L WK FDHA HLGG LFG WYV GHE W R P ++ WHE+R + +K Sbjct: 264 KVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKK 374 The following BLAST results are available for this feature:
BLAST of TCONS_00000103-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|