TCONS_00000103 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000103
Unique NameTCONS_00000103
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length722

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000103 ID=TCONS_00000103|Name=TCONS_00000103|organism=Clytia hemisphaerica|type=transcript|length=722bp
atttcagAAAACAAAATCTAGTTGTAATGAATGTTATGAATAAATGTAAC
CCTGAGTGAAATGTAAACTGCACAATgtcaatttattttaaatgttcAAA
GTCGCTTTCAAGATTTACTCAAAGCCAAACTTGGAGGAAAGTTTTAAATA
CAACTCGTTCATATCACAATGAGTTAACTACAAGACCTGCATTGTTACAG
CCTGTCCTGTTCACCGCTGGAGTTAGCATAGGCTCTTTTGCAGGATGCTC
CATTCTTCAATATGAGcgtgtcaaaacaaagatgggtGAAGAATCTTCCA
TATCCAAGTTACTGAGGAGGCGTAAAGAAAAAGGATTTGAATTTCGAAAC
CAGATAAATAAATGGTGGAATGGTCTCCATGAAGGTCACAAAGTAGCAGT
TGGCTCTGCAGTCCCTTCCCTAGGGGCATCAGGAGCTCTTCTAGCTGTAC
TGGCAGCATGCTGTATTGAACGTCCAGACGCACGACTTTCCATAttattt
ctaccattttttacaTTCTCTGCTCAAACTGCACTATACAGTATTATAGC
AATAGATGTGACTGGTTTATTGTTACGATGGAAGTTATTTGATCATGCAG
GACATTTAGGTGGTACCTTATTTGGTAGCTGGTATGTTATGAAAGGACAT
GAATGGACTTGGGATAAAAGAGGTCCCTTTATAAGATGGTGGCATGAGTT
GCGCCAGtcaatgaatgaaaaa
Run BLAST on NCBI

protein sequence of TCONS_00000103-protein

>TCONS_00000103-protein ID=TCONS_00000103-protein|Name=TCONS_00000103-protein|organism=Clytia hemisphaerica|type=polypeptide|length=216bp
MSIYFKCSKSLSRFTQSQTWRKVLNTTRSYHNELTTRPALLQPVLFTAGV
SIGSFAGCSILQYERVKTKMGEESSISKLLRRRKEKGFEFRNQINKWWNG
LHEGHKVAVGSAVPSLGASGALLAVLAACCIERPDARLSILFLPFFTFSA
QTALYSIIAIDVTGLLLRWKLFDHAGHLGGTLFGSWYVMKGHEWTWDKRG
PFIRWWHELRQSMNEK
Run BLAST on NCBI

transcript from alignment at sc0000001:1934114..1935123+

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000103 ID=TCONS_00000103|Name=TCONS_00000103|organism=Clytia hemisphaerica|type=transcript|length=1010bp|location=Sequence derived from alignment at sc0000001:1934114..1935123+ (Clytia hemisphaerica)
atttcagAAAACAAAATCTAGTTGTAATGAATGTTATGAATAAATGTAAC CCTGAGTGAAATGTAAACTGCACAATgtcaatttattttaaatgttcAAA GTCGCTTTCAAGATTTACTCAAAGCCAAACTTGGAGGAAAGTTTTAAATA CAACTCGTTCATATCACAATGAGTTAACTACAAGACCTGCATTGTTACAG CCTGTCCTGTTCACCGCTGGAGTTAGCATAGGCTCTTTTGCAGGATGCTC CATTCTTCAATATGAGcgtgtcaaaacaaagatgggtGAAGAATCTTCCA TATCCAAGTTACTGAGGAGGCGTAAAGAAAAAGGATTTGAATTTCGAAAC CAGATAAATAAATGGTGGAATGGTCTCCATGAAGGTCACAAAGTAGCAGG TGTTATCATTGGCATGAATCTACTGGTATTTTCAGCATGGCAACTTAAAG GGTTACGTTCTTTTATGGTCAAGTGGTTCACTTCAACACCGGCTGTTAAA AAATCTTCACCATTGTTATTGTCTTGTTTTAGCCACAGTGACATTTGGCA TATCGGTGCAAACATGTTTGTGTTATGGAGTTTTGCACCACTCATTCAAT CTTTACTAGGCACTGAACAATTTATTGGTTTCTATACAGCAGGTGGTACA ATATCTTCTTTAGCAAGTTATTATTTCAAAGTAGCAGTTGGCTCTGCAGT CCCTTCCCTAGGGGCATCAGGAGCTCTTCTAGCTGTACTGGCAGCATGCT GTATTGAACGTCCAGACGCACGACTTTCCATAttatttctaccatttttt acaTTCTCTGCTCAAACTGCACTATACAGTATTATAGCAATAGATGTGAC TGGTTTATTGTTACGATGGAAGTTATTTGATCATGCAGGACATTTAGGTG GTACCTTATTTGGTAGCTGGTATGTTATGAAAGGACATGAATGGACTTGG GATAAAAGAGGTCCCTTTATAAGATGGTGGCATGAGTTGCGCCAGtcaat gaatgaaaaa

Coding sequence (CDS) from alignment at sc0000001:1934114..1935123+

>TCONS_00000103 ID=TCONS_00000103|Name=TCONS_00000103|organism=Clytia hemisphaerica|type=CDS|length=1296bp|location=Sequence derived from alignment at sc0000001:1934114..1935123+ (Clytia hemisphaerica)
ATgtcaatttattttaaatgttcAAAGTCGCTTTCAAGATTTACTCAAAG
CCAAACTTGGAGGAAAGTTTTAAATACAACTCGTTCATATCACAATGAGT
TAACTACAAGACCTGCATTGTTACAGCCTGTCCTGTTCACCGCTGGAGTT
AGCATAGGCTCTTTTGCAGGATGCTCCATTCTTCAATATGAGcgtgtcaa
aacaaagatgggtGAAGAATCTTCCATATCCAAGTTACTGAGGAGGCGTA
AAGAAAAAGGATTTGAATTTCGAAACCAGATAAATAAATGGTGGAATGGT
CTCCATGAAGGTCACAAAGTAGCAGTTGGCTCTGCAGTCCCTTCCCTAGG
GGCATCAGGAGCTCTTCTAGCTGTACTGGCAGCATGCTGTATTGAACGTC
CAGACGCACGACTTTCCATAttatttctaccattttttacaTTCTCTGCT
CAAACTGCACTATACAGTATTATAGCAATAGATGTGACTGGTTTATTGTT
ACGATGGAAGTTATTTGATCATGCAGGACATTTAGGTGGTACCTTATTTG
GTAGCTGGTATGTTATGAAAGGACATGAATGGACTTGGGATAAAAGAGGT
CCCTTTATAAGATGGTGGCATGAGTTGCGCCAGtcaatgaatgaaaaaAT
gtcaatttattttaaatgttcAAAGTCGCTTTCAAGATTTACTCAAAGCC
AAACTTGGAGGAAAGTTTTAAATACAACTCGTTCATATCACAATGAGTTA
ACTACAAGACCTGCATTGTTACAGCCTGTCCTGTTCACCGCTGGAGTTAG
CATAGGCTCTTTTGCAGGATGCTCCATTCTTCAATATGAGcgtgtcaaaa
caaagatgggtGAAGAATCTTCCATATCCAAGTTACTGAGGAGGCGTAAA
GAAAAAGGATTTGAATTTCGAAACCAGATAAATAAATGGTGGAATGGTCT
CCATGAAGGTCACAAAGTAGCAGTTGGCTCTGCAGTCCCTTCCCTAGGGG
CATCAGGAGCTCTTCTAGCTGTACTGGCAGCATGCTGTATTGAACGTCCA
GACGCACGACTTTCCATAttatttctaccattttttacaTTCTCTGCTCA
AACTGCACTATACAGTATTATAGCAATAGATGTGACTGGTTTATTGTTAC
GATGGAAGTTATTTGATCATGCAGGACATTTAGGTGGTACCTTATTTGGT
AGCTGGTATGTTATGAAAGGACATGAATGGACTTGGGATAAAAGAGGTCC
CTTTATAAGATGGTGGCATGAGTTGCGCCAGtcaatgaatgaaaaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000051XLOC_000051Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000103-proteinTCONS_00000103-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000103-exon-sc0000001-1491911889:1934114..1934512TCONS_00000103-exon-sc0000001-1491911889:1934114..1934512Clytia hemisphaericaexon
TCONS_00000103-exon-sc0000001-1510915933:1934114..1934512TCONS_00000103-exon-sc0000001-1510915933:1934114..1934512Clytia hemisphaericaexon
TCONS_00000103-exon-sc0000001-1491911889:1934801..1935123TCONS_00000103-exon-sc0000001-1491911889:1934801..1935123Clytia hemisphaericaexon
TCONS_00000103-exon-sc0000001-1510915933:1934801..1935123TCONS_00000103-exon-sc0000001-1510915933:1934801..1935123Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1934114..1935123 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
28.6957 32.8828 13.153 12.6981 14.9943 9.99672 10.5309 10.4982 10.8401 13.8272 10.2722 7.11729 8.12391 7.33829 8.38677 9.07314 20.8431 16.0236 6.72702 7.60888 12.1735 9.90099 44.2388 41.0894 8.79209 11.9577 7.70816 7.65589 27.8097 24.9629
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR022764Peptidase_S54_rhomboid_dom
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004252 serine-type endopeptidase activity
Blast
BLAST of TCONS_00000103 vs. Swiss-Prot (Human)
Match: PARL (Presenilins-associated rhomboid-like protein, mitochondrial OS=Homo sapiens GN=PARL PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 6.056e-28
Identity = 47/87 (54.02%), Postives = 61/87 (70.11%), Query Frame = 3
Query:  462 CIERPDARLSILFLPFFTFSAQTALYSIIAIDVTGLLLRWKLFDHAGHLGGTLFGSWYVMKGHEWTWDKRGPFIRWWHELRQSMNEK 722
            C + P+ RL+I+FLP FTF+A  AL +IIA+D  G++L WK FDHA HLGG LFG WYV  GHE  W  R P ++ WHE+R +  +K
Sbjct:  288 CTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKK 374          
The following BLAST results are available for this feature:
BLAST of TCONS_00000103 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PARL6.056e-2854.02Presenilins-associated rhomboid-like protein, mito... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php