TCONS_00000103-protein (polypeptide) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000103-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length216

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000103-protein ID=TCONS_00000103-protein|Name=|organism=Clytia hemisphaerica|type=polypeptide|length=216bp
MSIYFKCSKSLSRFTQSQTWRKVLNTTRSYHNELTTRPALLQPVLFTAGV
SIGSFAGCSILQYERVKTKMGEESSISKLLRRRKEKGFEFRNQINKWWNG
LHEGHKVAVGSAVPSLGASGALLAVLAACCIERPDARLSILFLPFFTFSA
QTALYSIIAIDVTGLLLRWKLFDHAGHLGGTLFGSWYVMKGHEWTWDKRG
PFIRWWHELRQSMNEK
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000051XLOC_000051Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000103TCONS_00000103Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR022764Peptidase_S54_rhomboid_dom
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004252 serine-type endopeptidase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022764Peptidase S54, rhomboid domainGENE3D1.20.1540.10coord: 28..190
e-value: 1.6E-12
score: 47.3
IPR022764Peptidase S54, rhomboid domainPFAMPF01694Rhomboidcoord: 111..192
e-value: 2.5E-11
score: 43.7
IPR022764Peptidase S54, rhomboid domainSUPERFAMILY144091Rhomboid-likecoord: 111..191

Blast
BLAST of TCONS_00000103-protein vs. Swiss-Prot (Human)
Match: PARL (Presenilins-associated rhomboid-like protein, mitochondrial OS=Homo sapiens GN=PARL PE=1 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 4.972e-39
Identity = 63/111 (56.76%), Postives = 79/111 (71.17%), Query Frame = 0
Query:  106 KVAVGSAVPSLGASGALLAVLAACCIERPDARLSILFLPFFTFSAQTALYSIIAIDVTGLLLRWKLFDHAGHLGGTLFGSWYVMKGHEWTWDKRGPFIRWWHELRQSMNEK 216
            KVA G   PSLGASGA++ VLAA C + P+ RL+I+FLP FTF+A  AL +IIA+D  G++L WK FDHA HLGG LFG WYV  GHE  W  R P ++ WHE+R +  +K
Sbjct:  264 KVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKK 374          
The following BLAST results are available for this feature:
BLAST of TCONS_00000103-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PARL4.972e-3956.76Presenilins-associated rhomboid-like protein, mito... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php