Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073829 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073829
Unique NameTCONS_00073829
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2664

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073829 ID=TCONS_00073829|Name=TCONS_00073829|organism=Clytia hemisphaerica|type=transcript|length=2664bp
CgaaaacaactttttcaaaatggtagagcAAAGCTGCGAGGTACAAGCTT
CTCCGGCGAGAACGTGACCGAAGGAAAAGATCTTTCCAGATCTTTCCATT
AAATGCTGGGTATTTCCAAATATTTACCAGGACAGCAATCTCTCACAATG
CCTACATTTATGTAATATGGAAAATTTgaacattatttttttattggtcA
TTTTGCTCTTTGATAAGCAAGAATGTGCTCCATCAGATGTGTATGACGAG
GAGCTGTCAATCAAGCAATTACAAAGTGGTCATGTTTATTCCCAATTTCA
ATTTGTTACAACATGGAACGTCAATGTGTTTGAGCAACAAATTCCTCCAC
ATTACAACTTCTTTCCAAAGTCTTTTGGTGAGATCCTCAGCAAATTTGGC
ATTGTAGAATTACATTTCTCGATGACACAAGGTCGATGGAGGCACAATAA
ATGGGGATATCCCTTGGATAGCGCACCGACGGGTGTTGAACTGTGGGTCT
GGTTCCACCCCAATCTAAACTCAAGTGTCGTTGATAAAAACTGGTCTGGA
TTAGTTCACTCACTTTCTGGCCAATTCTGCTCCTCCATCAATTTCATCAG
TAAAGCAGAAACTACATCGCCAGAATTTTCGTTCAAACCACTGGGTGTGT
GGCCTGAAGATACATTATCACCTCGACAACACCTCAGATATGCCACCATC
CCCAGGGAAACAGTGTGCACAGAAAATTTGACACCATGGAAGAAGATGTT
GCCTTGTGGTAACAGTGGTGGCGTGGGACTAGCAAGCTTGTTGAATGCAG
TGAAGTTATATGACTCTTCTTATCATTCGCTAGCTGTTCACCTTAGGTCT
GTCTGTCAGGCTGGCGACTGTTCAAAATTAGCATTAGAATATAAACAAAG
TGTTGCATCAGTTTTTGATCCACACCACAGAGGCTTTAACGGAGGATGGA
ATCTGAGATCGTTATTTGGAGGTGTGATTACCTCAAGATGTCCTTTGGCA
AGAAACAGTCAGGTCATCATTCATACAGACAAGATTGACGGTTTGAATCC
GAATCATTTCGAAAAGAAAATTATTTTGGTCAGTGGGAAAGACGTTGAAT
ATGCAGTATTTGATCTTACTAAGAAAGACTTGGTTAAGTTCCCTTTTGAT
GTTCAAGTGAAGATGAAAAATCGAGCAACAGTGACGGATTTGAAATCTTC
TTATATTTTGGTCCACAAATACACAACTGGTTACGGTGAGGAGTATGGTG
GAAGTACTTGCATTGTACGGAACACGCATGCGCACAAAAACATCACCCTT
TCCTACCTTGACGTCATCCCATATTTCGCGCGTGTTTATCTGCACACGTT
GAAATTACAAGTTAATGGTGTTCAAATAAAACCAGACAATTTGAAGTACA
CACCATGCTATCATCGAGAACGACCAGCAAAGTTGGAATTTCTTTTTACC
ATACCTCCACAAAGTGACGTCACCATTTCCATCCAGTTTgagaagatctt
tcaagattGGATGCAGCACCCACCGGATTCTCATCATGGTTTCTACATGT
CATCTTCAGTCATCAGTGGCATAGTTCCTTTTCATGAAGAGCTTGTAGAA
ACCATCCCTTCACTACATCATTCTATGTTTCGAGAAAGATTTGGTACGAC
CAGTGATGAAATGGTTTTCCGACGTATTTATTCCGAACCTTTACTCCTTC
GGATACCGTTACCCGATTTTAGTATGCCCTACAACGTCATTTGTCTGACG
TGTACCGTCATTGCAATCGGGTTCGGATCTATTTATAATTTAACAACACG
GACTTTTCAAGTTGAAGAGGTCAAGGAAAAACGAActttaaaagagaaaa
ttttaggGTTGTTCCGGAAAACAGAAACGctggaaaatgaagaagaagag
aatTCCGATGGATACATCCTTCCCATCATACTCCACGATATCTGAATCTG
TCCCCGTAATTCTGTTgaagtcatgtgaccaaattTGATTGACGTTTGAG
AAGCTTGTCGAGGTGTGTTCGAAGAATCCACGACGGAATTTCCCGATGAC
GTCTTGGCTGTGCTTCCAACCGATATTTCCGACAAGAATGGTTCGCTTTA
CACGCCGACACATCAAGTTAGAGTAGATGTATGTAAGAACTTTTTCGAAG
TCCTTTCCAGCTTGCTCACCTTCCTTTAGATTCCCGTTCAAGAAGAAGAC
AGCGCCCGGTTGATTTTTACACTCATCCTTGTTTTCTTCACTGTCCTCAA
CATCGCCCAACATTTTGAACAATCCTTCAAACCCTTTACCTATTTCAGAT
GGAAAATCTCTCTTTTTTCGGTTTTCAAGATTGCCGTGCATCTTTAGTTG
TGTCCATGAGACTTGTCCGAATTTTGTCCGATTTACTCCAGTGAAAACCT
CTTCATCATCCACCTGTTCAAATCGATCGCCTTTGTAAAGGATCGGGTta
caaatgacgtcatcagcacCCTTCATACATAGACTGTCGATCCCAGACTC
CTCGTAGTTAGTTGCCAACAGATCGTTTGCTTGTCGCAGTTCTCTGTATT
CTCCTTTTGTAATGTTTTGGATAGCAATGATCTggtcaatgaaaaaaaaa
tcacaaatcacAAAGCGACTCTTCCATTTCATGCTATTGTGATAACAACT
GAAGTCTAACGAGG
Run BLAST on NCBI

protein sequence of TCONS_00073829-protein

>TCONS_00073829-protein ID=TCONS_00073829-protein|Name=TCONS_00073829-protein|organism=Clytia hemisphaerica|type=polypeptide|length=592bp
MENLNIIFLLVILLFDKQECAPSDVYDEELSIKQLQSGHVYSQFQFVTTW
NVNVFEQQIPPHYNFFPKSFGEILSKFGIVELHFSMTQGRWRHNKWGYPL
DSAPTGVELWVWFHPNLNSSVVDKNWSGLVHSLSGQFCSSINFISKAETT
SPEFSFKPLGVWPEDTLSPRQHLRYATIPRETVCTENLTPWKKMLPCGNS
GGVGLASLLNAVKLYDSSYHSLAVHLRSVCQAGDCSKLALEYKQSVASVF
DPHHRGFNGGWNLRSLFGGVITSRCPLARNSQVIIHTDKIDGLNPNHFEK
KIILVSGKDVEYAVFDLTKKDLVKFPFDVQVKMKNRATVTDLKSSYILVH
KYTTGYGEEYGGSTCIVRNTHAHKNITLSYLDVIPYFARVYLHTLKLQVN
GVQIKPDNLKYTPCYHRERPAKLEFLFTIPPQSDVTISIQFEKIFQDWMQ
HPPDSHHGFYMSSSVISGIVPFHEELVETIPSLHHSMFRERFGTTSDEMV
FRRIYSEPLLLRIPLPDFSMPYNVICLTCTVIAIGFGSIYNLTTRTFQVE
EVKEKRTLKEKILGLFRKTETLENEEEENSDGYILPIILHDI
Run BLAST on NCBI

transcript from alignment at scaffold_98:196520..219918-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073829 ID=TCONS_00073829|Name=TCONS_00073829|organism=Clytia hemisphaerica|type=transcript|length=23399bp|location=Sequence derived from alignment at scaffold_98:196520..219918- (Clytia hemisphaerica)
CGAAAACAACTTTTTCAAAATGGTAGAGCAAAGCTGCGAGGTACAAGCTT CTCCGGCGAGAACGTGACCGAAGGAAAAGATCTTTCCAGATCTTTCCATT AAATGCTGGGTATTTCCAAATATTTACCAGGACAGCAATCTCTCACAATG CCTACATTTATGTAGTCAATACTCCATTCCATTCCAAGTAGCCTTTTCTA TTTAACTATTTCTATTATTTGTATTTGGTTGAGTTTGAGTTACAGGAAGC TTCTCTTTCAGGCCCATTTTCGCAACTATAGACGCTTTCAATTAGTGCCC CGTCAGCACCTTGAACTGACTTCCCAATTCCCCTGACATGGCATGGGTTC AACCAGGCAAAGCTTCATTCACTTACCAAGTGAACCGCTGCAAGTGGGGG AATCGAACCTCGCGTCCTCAGCAGTCGCCTGTGCAGCAACTAAGTCCAAG CCAAGGTCAATGATCACTATATCACGGCGCCTTTAGCAGTAGTTTTTGCG TAATAGACTGCTCTGGGTACAATGTTAGGTTGGATAGTTAAAACCTGGTA AACAGACCTTCTTTTCGCCTTTCCATCCGCCATATTGAATAGACCTTTTT TCAAAGAGGACGTCCTGTTGAATAATTATGTAGTCCAGCCATAAAAACAA TGATAGAGCCATGCATAATTACTGTATCATGCATNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTGCATATTGTAATAATTATGCATGGTTTTAT CATTGTTTTTCTGCTGGACTACATAATTATTCAACAGGGTGGCCTCTTTG AAAAAAGGTCTATTGTATGCAAAAATGGGCTCTTCCAGTTAAAGTCCGTT ATAGGGGGGTGGACGACAGCGGAATTCCGAGGCAAAATGTTTTTTTGAAA TTCCTGGATTTCCAATACAAAAGCAATTGAAACTCCTGGATTTCCGATAC AAAATCAATTTTTTGGTGGAAAAATCTGGAATTTCTGATACCTTTTTCAA AACTTTGACAAATTACGTGGAATTTCCAAGGGTTGAAATAAAAAATTGAG CAGAATTTCCGAAGCACTTTGAAAAATTGACTGGATTTCCGAGTGCTTTT TTTATCTGAAAATTCCCGTCATCCACCCCCTATATCAAATTTTTTCTGGA AGAGCCCAATTATGGTGGCCGAATTGCCGTGGTGAAATTCCCTTAGAAAG TATGCAAAACATATGCAAAAAGAAAGTATTAATATAAAACTTACCGTGAG TGGTCAATGAATGTGATAAAAAAGTGTGAGTTGTAAAAGTAATTACCTCT ATTATTCTGAATCCGTTGCTTGTGTTTAAAACGTTAACAATTTTGTAATG AAAAATTATGTTTTGTATAAGAAGCAACTAATGTTTTGGTTCAATTGGTT CAGTGTATCAAATCTCTCAGTTTAGTTGACACTTTGGTATCTTTGTTGCG TCACAGCGAAAGGTTTGTTTTTATTTCAGGTTGTATCTTTGAAAGACCCC ATCGGATTTAGGCAGGGCTGTCGGATTTAGGAGCACTCACGGTACATGCA TAATTGGCATTATATTAAAGTGTAATCTTGTAGAAGAAAGATTAAATTTG CTTCTTTTGAAAACTACAAATAATCAAATTCGCTCATCTCTTAGAACAAG CACTTCAAAAAACCATAACATTAGACATAAACTCAAGCTGAAAAATCACC CGCGAAGGTACAAAATTATCCTTATTCGACTGACGCTAAATTATTCTCCT GGGAATAGAACCGTCAGACAATCAAATCAAAACATTGATCTGAACCCTCT GAATGTGTGACGTCATAATCACTGCTTTCAGTTTGCGTGTTTTGAAAGTT TGATGTGTGTACTCCGTCTTGGTCAAATTTTTTAATGGCAGGAAAACAGA ATATGCAATGTCTTTAAGAACAAATTTCTAAAAGGCTTTTGTTGTTCTGT AAATATTTCTTTTTGGATTAAGAAATTCCATCTTTTATTGTTCTAATGAT TATGATATTTCTTTATAAGATGGTTTGTTGTCTTTTTAATCTTTGTGTAA ACTTGCATATGTTTTGCATATTTTCCAACTAAATCCAACCACGGCTTTTT CGTTCCTCTATTTTTGCATACAATTCAAGATGGCGGGTGGAAAGGCGAAA AGGTCTATTGTGCGACGTCGTCATTTTCAACCATGATCAGCCATTTACCT AAGAAATTGTAGAAAGGTTGTAGGTACAGCTACAGGACAGGATGATCTAG TAACACTGCTGTTATGGTTTGCTGAACCATTTCAATTTTTGATTGCAATG TTTCATTTTCCGTTCGATCCCAAATGTGGAAGCATACCCTACTCTAGAGT GGGTCTGATAAAGATTTTGTAGCACTTGAGTCGTGTTTCTGAGTCACTTT TCACCAAGTTTCTTTGTGTCATTTGCTTTAGCTCATATTATATTAGAAAT ATGAGTATATATTCCATTTCAAATCCATGGTTACACCAAGATATTTCGTC TTTTTTGCTATCTCAAGCTGTTGTCCGTGTATCTCGTATTTTGAATCAAT TATATTTCGTTTATTTGTCAGTGAAGCTGGAACTTTGATTTTTGAGGATT ACGATTTTACCAGCTTCACAGGATCGATTCTCAACAACAAAATACATCTT TTGGTCTTTGGGTATGGTTCTGACGTTTTTTCTTCAAAGGATATTGATCA CTTTCCTTTTCCTCTTGAGCGCGCAAGAAAAAAAAGAGTAGCCCGCATTA TTGCGCGGACGAATAAAGATGAGACGGCAACCTTGCACTGAGGGTGCTAC TTAGTTTCCGCCCTATTTTGCGCCCACGATAGAATGGTCCAAATACGGGG GTATTCCAAATGATAAACAATGTTGTTCTAAGTATTTATTTTCTGAGAGA TGCAAATAGTATTATTGAATATTATTAACTTATTTATTTAAGTATTTTTG AGCGCAAATTTAAATACATGTGGTTAAATAGAAAGCAAATGATAGCAGTT CTGTTTATTCCTCAAACCCCTGGAAAAAGTTTTTTTCCTGACTTTTTTAC AAATCTCGGAAAAGAACTCCCATAGGAATTCCAATACACAACCCGATTAG TTAATTTCAGAACAGCTTCAAGAAAGTCATAATGGCAGATAATTTTGAAA GTTTGTTGATGGCTTGTTGATTCTTTAAAGAAAAAAGATAATGTATAGCT TTTTCTAATCCTGGAATATCAAGGTTCCAGCTGCACTGCTTGTTATCCTT AAAATCTTACACTTACACTTAAGGAACACAAGATGGTGCAGTTTGAGGAC ATAGACCTTGTATGTTCATGATAATAATTCATTTGTCTTTGACAAAACTG CTGTTGCCCGAGACAAAATAATCTATCCTGTTTGTATTCACAGGAAAAAT TTTTCGATTTCCACGGTTGGAAATTTCAAGTTTTCTTAGTTGGAAAAAAG ATAAAATCCAATGGAAAACCCAACCTGAAAATGTGGGACATTCTCCAAGG TTGGAAATTTTGCATTTTCCATGGCTTGGAATTTTCGTAAATCCAGGTTG AAAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTTTTTAAAATTCAGTTGGA AAAAAGCCAAAATCCAAATTTAACAAGGTTGCAATTTTCAAAAATCCAGG TGGAAAAAAGCCAAAATCCAAACCAAACAAGGTTGGAATTTTCGAAAATC TAGGTTGAAAAAAGCCCGAAATACAAGGTGGTTGGAAATTTCGAAAAATC CAGGTGGAAAAAAGCCGAAATACAAGGTTGGAATTTTTGTAAATTCAGTT GGAAAAAAGCCAAAATCCAAGCTAAACAAGGTTGGAAATTTCGAAAATTC NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA CCTATGGGTAATTTACGTTTTCCAAATCAGCTTAAGGTAATCGCTCAAAT TTCCAACCTTCAATTATAAAACCAAAATTTCCAACCCAAAAATATTGGAT TTCCAACCTTGGAAATCGAAAATTTTTTCCTGTGATTGGCTGCCGGGGAA AGTAATTTGACATGGTTTCACCCCCCCTTAGAAATCTGAAGTGAAGGGCA CCTAAGGCCAGGTTAGGGGCTGGGGGCTAATATTTTGCAATTCTTTGAGG TTACTTATTCATTGTGGTGGGGTACCTAGCTGTTTTGACGGAGGCTCTGG GGACTGTGTATATTTTCCAAATTAAATATTTCAAAATGTTTCAAATTATT GAATTTTTTTAGCCCAGCGCCCAGTTCCCCATCCAATTTTGATTCTCGTT TCTTTCCACGTCATCTTTTGCTATATCTTTCAAATGTGATTGTTTTGATT TACAGCCCTCATCTTTATAGCATAATATAATACTGTATAATAACAAAACA CCCAAAAAAATCATTAAGATTTTCGGAATGATAAAAAAAAAAAAATTGTG TCAAATCAAAAAAATTATCGACTGAATGGGGGTACCTAACTCAAAGCAAT TTCTTAAAAGAAAAGTGGACTGAGACCATGATTAAATAGACTGCAGGGAT CTCTTAGGTCTATTTGTTAACAATCTGATTTCTGGTTGCTAACATCTGCA GAAAAATGTCTGGAATTTTGCATAAGTCTTGAAAAACGTCTGGAAAGTTG GGAAATAATTCTGCAAATAGCGTAATTGGCTGGGAAAAGTTTAGAAATGG AGATTCCATTCTGGAAAAATAGTCAAAATATATAGTCTATTTTCAGTCTT CACAAAAAATGCATCCATCTATCTGTCTATCCATCTATCTGTCTATCTAT CTATATCTATATATTGACTTGACAAAGACAAACGTCGAAATATTGTACAC GTGTGTGTGTTTTTTCTGTGAAGCTATCTATATATTTAAGTAGCATTAAA TAAACATGTTTGTGAATGTTCATTATCACTACATAACTACTTTTTTTTAG CACTCAATTAAATTATCATAGATTTTTATGTAGTGATCTACATAAAAATC TATGATGATAATTTAATTAAGTGCTAAAAAATTGGGAGTATCAGCTAAGA TTCCATAGACATTTTGCTAATGAGGATGTCATGTTAAACAATTAAACTGA AATTATTAAATTATTAAGCTAAAATAATGACACATTTTTTATTAATGCAT AATTATTAAAAGCGCGCACTAATTTCTCTAAGCTTAGGGTGGTGCATTCT GTGAGGTTTGCATTCAAAGTAAAAGAAGAGTAGATTGTTTGCTACGATTG AATGAAAAACTTGAGTAGTGTAGTTCAGTAGTTTCAACTACTAAATAGAG ATTGAAATCAAAATATACTAATTAATCATCTGAGAATTAAAACCCATTTA TTTTGATCATTTGACTTTCTTTATAGATATGGAAAATTTGAACATTATTT TTTTATTGGTCATTTTGCTCTTTGATAAGCAAGAATGTGCTCCATCAGAT GTGTATGACGAGGAGCTGTCAATCAAGCAATTACAAAGTGGTCATGTTTA TTCCCAATTTCAATTTGTTACAACATGGAACGTCAATGTGTTTGAGCAAC AAATTCGTAAGTACTCAGGTCACAAATACCTAATTTCCCTGACCCCCTAA TATGTCCCAATCTCATTGAACAACAAACAAAAAGTAATGTTCATTTTAGA CGTTCAGTAATTTTGTTTTTTCAACAATATACAATTAATACCGGGTGGCC CACAAAAGAGTATAAGAGTTTGGAGGGTAACTGTGTCCGAAAAAAATTGA ATTTTAACTAAATTCTTTTTTCGTGGTAAAGAGGAAAGGCAAACTTAAAT GTTGATGTATCATTTTTTAATTTTGGAAAATTAGTTATCGAGATATGGAG GTTTAGTTTAAAGTCAAAAGTCATTATAAAAAACAGTTAAAAAACGTCAA AAAAGACAGTATCAAATTTGTATCAGAACAAACATCTTTCTTTTGATCAT TTGCTATTTCTTTGTCTTAAATGTTTCGTTAAGAAAAAAATAAGTAATAT CGAATTTTGGACAATTCCCAAATCGTCCTTTTGGAAATAAATAAAAAGTA CCAAAAGTAGCAAAAAGAATTTTCAACCTTTGTCATCCTTTTCTGAATCC TTCCGGTAAAAGAAATCAAAATATGCTTCTCACTCGATGTCTCTTTTTAT TTGTTAATTAATTAATTTGATACTGTCTTTTTTGATGTTTTTTGACTTTT GACTTTATACCTCCATATCTCGATAACTACTTTTCCAAAATTAAAAAATG ATACATCAAAATTTAAGTTTACCTTTCCTCTTTACCATGAAAAAATAATT TAGTTAAAATTTAATTTTTTTTCGGACACAGTTACCCTCCAAACTCTAAT ACTTTTTCGTGGGTCACCCGGTACATCTTCTTGAAGTCAATATTGTCATC TGCTTTTTAAGTTCTCTCTAACATTTCAAATTGTTTGAATTTGAAGTTGT TTCTAATTTGATCATGTTGATGTAACTGGGGCCTTATTTGACCTGTCTCT GTTTTCTTTGCAGCTCCACATTACAACTTCTTTCCAAAGTCTTTTGGTGA GATCCTCAGCAAATTTGGCATTGTAGAATTACATTTCTCGATGACACAAG GTCGATGGAGGCACAATAAATGGGGATATCCCTTGGATAGCGCACCGACG GGTGTTGAACTGTGGGTCTGGTTCCACCCCAATCTAAACTCAAGTGTGTA AGTTGTGAAATTTTTTCAATAATGAATAGAACAACGAACCCTTTCACACC CCAGAAATAAAAAATCCACTTGTTTCGAAAAACTCGTCCCTTCTTTAGTG TAAACTATATCAACACAAAATTGAATACAAGATCAAGCAATGAAGGTCTA CATCGTGCCCGTGCAGAAACTGCCGGACCTATATTGACGATGTCAGATTT TTGTAATCACCTTACAAATTTTAAGGTAGTATAGACTTTTTTTTAGCTGT TCTTACTACCCGTTCGTCAACATGAAATAAACTAGCACATACTTATTGTT TCATAGCGTTGATAAAAACTGGTCTGGATTAGTTCACTCACTTTCTGGCC AATTCTGCTCCTCCATCAATTTCATCAGTAAAGCAGAAACTACATCGCCA GAATTTTCGTTCAAACCACTGGGTGTGTGGCCTGAAGATACATTATCACC TCGACAACACCTCAGATATGCCACCATCCCCAGGGAAACAGTGTGCACAG AAAATTTGACACCATGGAAGAAGATGTTGCCTTGTGGTAACAGTGGTGGC GTAAGGCTCTTATTTTGTTTAGTTTCCTTGTTGCTGTTTTGTCTTTGTCC AGTTCCTTTCTTTTCCTCCCTTCAGAATAAGTTTACATATGTTAGAAAAT CAAGTTTTCTCAAATAAGATTTGGTTATGCTTCCCTTATTCCTTTATACT GTTTATGTATGTATAAACTTGGATCAAAATTTGGTGAGTTTGAATTACTC TTTTTTTTCAGGTGGGACTAGCAAGCTTGTTGAATGCAGTGAAGTTATAT GACTCTTCTTATCATTCGCTAGCTGTTCACCTTAGGTCTGTCTGTCAGGT AAGATTTATTGACATTTGATGCACGCTTTTACAATGTTTTCACAAATGCT GGTCAGTTTCAAGAAAAGCTGTTAGCTAAATGAAAAGATCTGAAACAAGG AAATGAGACAAGAATTGATCTTTACCGATGGACATTAAGAGCCAGTTTTT TTAAGAATGGGGCAGTTTGGGGCAGTTCCAATAGTTTGAAACTTAGATTT TTTTCATTTTTGGATATGTTGTTAAGTACAATGAACTGNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTACTCA GTTCATTGTACTTAACAACATATCCAAAAATGAAAAAAATCTAAGTTTCA AACTATTGGACCTGCCCCGCTCTTAAAAAAACTGGCTCTTAAGATGTTAC TTACCTTCTAAACTTCTTTCATAAGAACTCTAAGAAACCTTAAAGCATTC GGACCTTTTAAATTTCTCATTTCTAAAACTATTCATGATATGCACCATTG CAATGTCTTCTGAGAACCCAACAGCTGATTGGTTGAAAGTGACGTATTGA CTGATCACAATCAGCTATTCGCGGGTCCGTGATGTAATGTCAGAAGACAT TGCAATGGTGCATATCATGAATACTTGATAATGTTGTTAAATTAGCCCGA CCTTGTTTTCTTATGCTTCTTTCAAACGTGTATGTGAACATTAAGTTATG TCGTACCTTCACAGACTTGATACATTTTATCTCCTATTTCCCACAGGCTG GCGACTGTTCAAAATTAGCATTAGAATATAAACAAAGTGTTGCATCAGTT TTTGATCCACACCACAGAGGCTTTAACGGAGGTTAGTTTTTAAAGCCGTT TTGTTTTAACTTCTGAAACAATAGAATCATTGTTTTAATTGTATGCTTTT TGGTCTCATGTCTTCTTAAGTAAGGAAGTAAGTCTGCGACCGCAGTCGGA GGCGACCCGAAGGCTTCTTCTTCGATAGCTATCTACCCGAAGGTAGGGGA GGGCGCCACTCTTTCTCCTTTGGATTGCTCCACTTACCCTTGATCCTTCT CTTAATTGCTGAGCATCAAGCAGAGCAGCATCAAGTACCATTTTGAGAAT CTTTGGTATGACCCGGCTGGGGATTGAACCCACAATCTTGCGAACCGTAG CCGGATGCTCTACCACTGCACTACGGTTGCCATGTCTTCTTCGAGCACAT AGTAGATTGTCCAATTAGTAGAATGTGTTTGTATAGAATTTGAAAAATGA AACTACTTGGTGTCGCCCAGACACCAAAAATCAAAGTTTTTGAAAAATGA AAAGAAGCAGCCCTAGATATTCACCCAAGGAGCAAGTGTGTGAAGTTTCA GTCCAAACTGACCATTTTAAGTCCAGGCTAGATAAGGTCAACTGAAGTTT ATGTGAAATGTGAAATCACATTGACGGTTCAATATTGCAATCTTTTATTT CAGGATGGAATCTGAGATCGTTATTTGGAGGTGTGATTACCTCAAGATGT CCTTTGGCAAGAAACAGTCAGGTCATCATTCATACAGACAAGGTATTGTA TTTTTCGGCTTAATAAGACTGGACTTCTTGGTTTGCCGTCACCCGACCCT AGATTTTGGAAGTGGGTCGGTCGGTCGGTCGGAAAATTTTTTTATTTTGG TCTTTCATGGAATTTTTGTCGTGGCTGGCTCCGAAAAATCCTTGAACTTT TAGACAGTTCAAGAATTGCTTCCACGAAGGGCCACTATGAACAGAACAAG AACAGTAACAAAAAGGAGAAGGAAAATTGGATAACCAACAGTCCAGCCTA ATTGTTTATTTTTTGTTGGAACCACAAAATTCATTTTCACTGATATAATA ATTATCATATCATGTCTTCATATTTTTGAACTTCTTTTAAAATATCCATA ATATAATTCTATATTTGAGACTTTGTCTCTGGAAGTAGTTATTAAATCAA TATATTCCGCTTCGAAAGAGTTTTCCAAAGATCTTAGTATGGAGGTTTTT AGGATGATTTAGCTTTGTTTTGATTAATGAGAATTGAATTACGATTTCAC GTTCCAATGATACATCATAGAAGGATTTATCTATAAATTACAGAAAAACT TGAACTGCAATGTGTAGAATAAAAATTAAGATATATTTCGAACAGTCACG TCCATCATCAGTTTAAAAAAGTAAAAGCTACAAGCAAAATGTTCAATTTT TTCAAATAGTTGACAAAATCGCAGAAATCATATCCATATGGAAATACATA ACACAAAGGTTAAAGATAAAAGAAATATTCAAGTCATAATATGTAATAGT TATCAGACATTTGCGAGTACAATACAAGAAATATTTTATGAGTTCCGAGA TTTTTTTGCACAATATTTTCCGAGCCTTTAAGCGAGGAAAATATGTAAAA AAATTTGAAACGAGTAAAATCTGTATTGTACACGAGCTTGCGTCTGATAA CTAGTTTATCGGTGACCAAAAAAACTTTTTTTGTTGGAAAAAAGCACAAG GCAGTTTTGTAGCAAAGTGACGTTAGATTGCTGCTACCGCTACAATGCAA CAACATCTTTTCGTCAATTTATATTTTTACATGTAAAATACNAGTGACGT TAGATTGCTGCTACCGCTACAATGCAACAACATCTTTTCGTCAATTTATA TTTTTACATATAAAATACAAGATATTATATTGTACTCTTTTTAACCAATC AGATTGCTGATATTTTTTGGATCGCCGATAAATTAATCAAACGCCAAAAA AAAAAAAATTAAGTCATAACATATATACACATAAAAACAATTAATCATTT TCTAATTCAAATACCCATGACTATCATTAAGCAGTAACAATGGAAACAGA ATAAAACCTTGACGAGCAGCTGTTTGCTTTTAAACTCGTCCTTTGTGTTC ATGCTAGGTTTTATCTCCCTAATAAATAGTGCCTCGATTGCCATTTGTCA ATAAATGTCATATCCAATAAATCTATAAATTGTCAAGGGTTTTATTTCTC TATTTCAAGAAGGAATAACGTGTGTCTTTATGAACTTGATTAAGCTCTAG CTACTACTCTCCACTTCCCTTGTGTTCATTATGTTAAAGACCAAACAAGT CAAGATATGGTAAACTTGCCGTATGCAGCAGGATACAAAATCAAAACAAA TGTCACATGTCAAAATAAAAGATCAAAACAAATATGGCTGATTTTGATTG TTTCAATTGTTTTAAAAGTTTGTTTTGGATACGTTTAATTATTCTTTAAT GACATGTGGTTCGTGCAATGTTTACATTTTACTACTTTTATGTCCCTTTA AAGATCAAACAAGTCGAGATATGGTAAACTTGCCAGTAATGAACGACGAC GCATCAACATATTTCTCTCAATGCTCAATTTCGCATCTGGTTTAGCCTGA AAATTCTTCATTGTAAAATCCATCTTGATCATAACACCTCGAAGAGTGGT CATCTTATAACAACTATAAACCTTTTATAAAAAGCATGAGGAGGTTAGGT TCGAGTTTACCAGGAAGGAGTCTTATATATTCGAAGAATTTGGACATCTT TTCCATAGTAAATTCATTACCAGTCCCTTAAAACCCGACCACGCAACTAA AGGTTGATGGGTGTATTATTTTGTAGTCATGGCAATTATGACAAGAGAAC AAAAGGCTTGAATAAAATAAAAGGGAACATCAATGTATCTATCTCATTTC AACCGCTTGGTTGACCTCTTGTCTCCGTTCCCTTAACCTTTCTTCTCGAA AATATTCACTTGTATTTTCCCCAGGAAAGAATAACATTCGAAGTGCTTTT TGTGTGTATATCAAGAAAACAATAACCACATTGTTGATAATGATTGCGAT GCATTGGAAGAGTTCTCTCAGTTGTGGCGATTGAGCATTAACGATAACAA AACTGACACCAAAAACAACAGTGAGTGTGAAAGTAGCATATACTAACACA GTTCCATCGTTGATAACACTTGGTAGATTGCGACCTCTAAATGCTTGGAT AGAACACATCAGTTGGATGATCATGGATGAAGCAATCACAACATTGAAAT GAAATGAATTATCACAAAAATGGAAACTTATCATTGTTTTTGAATCCATA GCTTCAGCACTTGTGATTGGTCTCTTGTGAATTGCTATGCCAACTAATGT ATTGACTGACGTCACCAAAACGATGATTATGAATACTTGGACCATTTTCG AACGTTGAACTTCTTCACTTGTAAGACGAACTTTACTCAAAAAAGCTTGA AGAAGTTTTTGTGATTTGATAAAAACAATACCAATGTTTATTACATAAAG CATGCTGATTGAAATCAATCTGGAGATGCATTTGTAAAAGTTTGGTGTCC CAATAAAAGTAGATGGGACAGTTACAAAGAGAAGTAATATTATTGACATG TGTATTAATGAAACTTTGTAGTCAGATACTGAAACCATAGGTGTTTTTCT CTTGAATATAAACAGGCTTAAAGAAAAACACGTGACCAATATACCAATGA TACTTAAAACCACCAAACAAAGAAATTGCGAGTCCAACAAACTATAATGT ACATTTTGATAAGGGTCTATGCACATGGTACGTTTCCCATCGTCAACATT GAATCTTCCAGTGCATTTCCGACACCTTCCACTACCGGACAGTGATTTGA TTGTATTTTTCGGACACAGAAGACATCTCCAAGCAAAATTATTTCCACTG ATATTACTGTAAACCATGTGATATCCTGCTGGACAAAGAGGTTTCTCGCA GGTGGTGAAATTTCTACTCTTTTTATAAAAATCGTCATCCAAAGTAATAG GCTTTACCCCTTTTAAAAGAAAGCGTCTATTTTTTCCTTCAAATATTAAA TATTCCGTTTTTTTATAGTCTTCATACGTTTTTTGAAGTTCTGAGCGAAT TTCCGCGAGTGAACCGTAGAAATAATTTAAACCATAAATATCGATCCATT CCATGTCATGCAGTTGGTCTGAGAATTTTTTCGCATTCCTAAGAGTACTA AATTTCAAGTAGGTCGGCAAAGATTGGAATAATCTTCTGAAATCTATAGT ATAGCTAATCTCCATAAGATTTGAAAAGAGATTGAGATCAAGCAATAGAA AATTATGAATAGCCAAATATTCTGCATTTTCAATAAATTTTCCACCCAAT CGCCAAGTTTGAAATATGGTGTACATATGAGTTATAGGGAAAAATGGTAA TTCTTCCTGAAATACAGCATAGACTTTGTTTAGAAAGATGGCTTGATCAG AGCTTGATCCGAAAAATATAACGAAAGGTTTTTGATCAGATTGGAGCATG TCTTTCACGAACGCTGTTTCATTGTTTACCTCCTGCCGAGCATCAATTTC GTAAATCTCCAGACAGATTTTTTGGTTTTGCAAATTTTCAACTGTTTTTC TGTAGTATGAACGATAGGGAAAATCATTTGTTGTTAAAAAGACGATGGTC AATTTTTCCCAACCTGCAAGCTCAATATATTGCGATGTTTCTGAAACCAA ACTGTTCACTGGGTTAAAAATGGATCCATCTTCTTCGATTCTGTGGTCTA TATCATACACTGGAGTTTGCTTGAAAATATTTTTCACGAAATTCGTCATT TCAAGTGAAGTGTACATGAAAAATGCAACGATTGAAGACTCTGTGAAGTT TTGTCCATTTTGTTGAATCTTGAATTGTTCATCAAGGACAAGATTTTGAA CAATTTCTGTCAACAAGGTGAAGTTACCACAAACATCATATTCCTTATAT TTCAATTCACCATTTATATCACAATCCGCCGAACAACCTTTAACAAAAGC GTATAATGTTTCGTTGATAAGTTTTTTATTGAAAACACTCATTATTCCTG CGTCAATATTAAGTCGAGTTCTGTTAACATTTCCAGTGCAGTTGGAGTAT ACCCCTATTTGGTGAAACGTGTAACATTCCAACTCCTCAACATGGAGTAA GATTGCCAGATGGATGAATACATTTCTCCATTTCATTTTTAAGAGACTTT GAGTAACTGAAGTTGACCAGAGCTTACAGAATATGTTGCTATGTTTTCAC TAACCAAACCCTTCTTCGCAAACAAAACGAGCCACAGATTGCCTTTTTAA TTTGAGAAAAACTTTCTATCAAGCTTTTATCGCTGGTAGGAGGCCAAAAA CAATAAAACCAATCTCCATATAAAAGAATCTTCAATAATTATTTTAATTT CAAACTAAGAAACTATCTTTTTTTCCTTGGTAAAAATAATATCCCCCATA CCTTGTTTAAGAATAATTGTACTGATTCGGAACATTAGACATCCAAAACA TTAAAATTAATCAATCTCTTTTCGCAATTAAAATATATAACCTATTTTGA TATTTTTTAATTAAAATTGATGTTCTAATTTCTTGGCGTAATTCTTAAAG GATTATCTTTTCTTATTGTGTTAAAGAAAAACCGGAGAAAAAGAAAATGT TTCAATATCGCACATTTGATAGCATATCCATTATTCCCTTATGCACATGG TAAACCTCCGAAGGCGCCCGGTGAGGGCGGTATTGACCTTGAAGTGTCGT TGGAGTGTGAAAAGTGGACCCTGTCAGATATGAATATTTGCTAAATTTGG AACCCTGTCAGAACGAAAAATTGAAAATCTGAAAATCTTTCAAAATAGCC AAACTCGACCCTGTCAGAAAAATTCCTTAGAAATTAGTAAATTTGGGAAT CTGTCATATCATAGGCTCACTTTTGCCTGAGAGTAAAAAGTTTTCAAACG ATCCAGTATTTTCGAATTTATTTTTCTTTTATTTTCGTTCGTTCATTCGT TCGTTCGTTATGAAAATTTTAAAACTTGAACAGAATGGTTAATTATAAAA GTGTTAGCTGTCGTAGCATGAAGTTAGAGCATCCAACTTAGAGAATCCCT ACTGGGTCATATCAACTATTCCAAATATGGTACTTGATGCTCAATTGAAG AGATGGATCAAGCGAAATTTGAATATGATCCAAAGAAAGAAGTAGTACCA TTCCCTATCTTCAGATAGACAGCCAGAGAAAAGGGAGCCTGTGGGCCACC TTCGACTGTTGTCGCAAACTTAAGTATTGAGGTTCTGCATGCGGCTTTTC AGATCAAATTTGGCTGATTGCGCATGTGCAAAATCAATTCACAAAAACCT TTATTTACTTTTTTTTTCATTTTAACAGATTGACGGTTTGAATCCGAATC ATTTCGAAAAGAAAATTATTTTGGTCAGTGGGAAAGACGTTGAATATGCA GTATTTGATCTTACTAAGAAAGGTAGGTCAATCTTCATCATTTTAGCCCG GAAGGGTTGGCCAATTGACGGTATTTGCAGCGAAAAATTTGCTTACTAAA ATTTGGTGAAATTCATATCAAACCTTTACAGTGCATTTTTTTCTCAATTT TTCAATCCTTGCTCTTTCTTAGATTTATTTAGATTTTCAACCTTACAGTG CATTTATAAAAAAGTCCACCCTTACAATGTAATTCTGCTATCTTGAGAAA AATCAATAAAAACATCCCTTTAGCCGCCGTACATAGCCGTCGACCAATTT GGTAAACTGCTTCCCCGGGGTTTTCGGAGCATATATAGGTTTTCGAATTA TGCTTGAACGAAACGATTCATACTACCTGAAAAATTTTTGGAGTAATTTT GATTAAAACGTATTTATTATCAAACTAGTTGGTAGATGAGATTTTAATAT AATAACGAAGAAATCCCATAGAATCACACCTAGATCAGGCTTTCGTTTAA ATTCTTTCTTTTCTTTTTCAGACTTGGTTAAGTTCCCTTTTGATGTTCAA GTGAAGATGAAAAATCGAGCAACAGGTTTTCGTTCTTCCCATTTATCATT TTTGTTTCATTAGAAGGTACTTGTCGTCGCTACTTTCATGGAGTACTCAT GGTCCGAATAATAGTAGAGGGGTCCGAATAAAAGGAGGGGGTCCAAAATC TTTTCAAAATATAAAGGGGGGGGGGGGGTCCGAAATTGTACCTCCAAAAA CCCCTCAAAATAATGTAATTACAATCCAAACAAATATTGTTGGATCGCAT GTCGATTGACCAAAGCAAGTGATAAAAATTTGCTCACAACCTGCAATCAG TTAAAAAAGAGGTCTTTTAATCTTTTCGTTATACTTTAACTTTAATTTAA TTATCATTTTCTCATTTTACTTTCAGTGACGGATTTGAAATCTTCTTATA TTTTGGTCCACAAATACACAACTGGTTGGTTTACTCTTTTAATTCATGTT ATTCATATATTCTACCGCTGTTTTATCAGCCGGAACATTAAAAACCATGT GGTATCTTCCCGGACTATTCTCTTCCTCGCTACGTATACTGTTGGTGCTC TGTAATTCGAAGTTCAACTATTCAATACGCTCCATTATTCGATAAAATTG AACAATAAACTCACATTCACGACGCTCTACCATTCGATACGTCCTGTTAT TCGATCAAAATCTAATTCCCCTTGAATATTGAAAGTCGATTTAGAGCGCG TCAGATGTACTATATCACTGTTACTTTCTTTGTATATTTACGTCACTTAA AGGATAAGTCTCTTTAACTCGAACCTCTATAACTTGTATGTCTCCTTAAG TCAAAAAAAGTTCTCCCGTTTTTTCACTTAACAATTCCTTATAAACTTCT TACTTTATAACTCGAAATTTCCATAATTCGAGCAGATTTGTGTTCCCCGT GCCTGTTTGAGTTATGGAAACTCAATTGTAAAAGTGTCGAAAAAACTACT CTCGGATACCTAAATAGTCGGGGGGTTTGGAATAAAAATGTCCTGGGTGG AAAATGTTCGAAAAGGAGGCTAATACTGCAAAATTAGGGCAAAAGAGGGA ACTTTCAAAATGTTTTTCCAAAAATCAATAAGTGGGGGCGGGGGGTTGTA ATAAGAATGTCCTGGCTGGGAAATTTTTGAAAAATTAATTAGCCCCCCCC CCCCGGTTATTAAGTACGTGAGAGTAAAAGAAGTAGCATTATTTCGTAAT TTCTGTCTCCCTTCTCACATACAGGTTACGGTGAGGAGTATGGTGGAAGT ACTTGCATTGTACGGAACACGCATGCGCACAAAAACATCACCCTTTCCTA CCTTGACGTCATCCCATATTTCGCGCGTGTTTATCTGCACACGTTGAAAT TACAAGTTAATGGTGTTCAAATAAAACCAGGTAACTATTTGTTTTGTTTT GTTTTGGATAATTTGATATCGCTTGCTTACACATAAAATTTTACTTTACA AGCTTGGCAGGCATGTGGAGCAAGATTGGTTAGAAACAAGGTAAGAAAAA ACAATATTACACCGGCCTGATATAAAACATGTGTCTGATATGAAATGGGG ACATTTATGTAACACTAAAATCTTTAAGGTCTAGTTTAGACGATCTGCTC TATCCTCGTTTCTGTTCTGACGAACGCTGTCAGAGAAATGCGACTCTAAT GTCTATTGTTTTGTTTTGAAGTTAATATGATGATTTTTCTCTTATACCCG AATTGTCGTTATTCTCTATTTAGCTTAAATTAATTGCATAAATGCAAGAA ACAACTTCACTGTACTCATGACTCAAGCAAGCTTGGCATTGTTTAATAGC GTACAGTTAATGCCTCCCCGTTTTATATGGAAAGACAGATGTGTTAATTT ATTTTTACAGTAGTGCATTATTCGGGATTTATCAGCAAGGGTTGGTTTTC CTCGTATGGGGCTCATATGTTAAGACTTTAAAGGTAATACAATAGGGGTC TTACCCCTCAAAAAGACAAGATGAGGACAATTTGGTTCGTTTTTCTGTAG ACAATTTGAAGTACACACCATGCTATCATCGAGAACGACCAGCAAAGTTG GAATTTCTTTTTACCATACCTCCACAAAGTGACGTCACCATTTCCATCCA GTTTGAGAAGATCTTTCAAGATTGGATGCAGCACCCACCGGATTCTCATC ATGGTTTCTACATGTCATCTTCAGTCATCAGTGGCATAGTTCCTTTTCAT GAAGAGCTTGTAGAAACCATCCCTTCACTACATCATTCTATGTTTCGAGA AAGGTATCAACTATTTTTTTTTAAAGATATATCTTAAGCCTTTCAAACCC AAGTGACGTGTATCTACGTTCAAAATCGGCTAATATACCAAGTGTCTGAT ATAAGTCTTTATCCCTTGATTTGAAAGGGAAATGATTTTTGAAAGAGCAT AAAAAATATCTTTCCAACTGTACTTAAACCAAGCTCTCAGACTTCAAGCT ATTTATGCCAGCTTTAAGTCTTGGATTTAAAAAAATGTTACGCGCCGGAT AGGCAATAAATGAATGCACAGAAGAAGCTAAAACTTAAGGAATAGACCAG CGGCCGAGGTAGTGAATTGTGTCACTTCGTAGGGCACCCCTTAGATCAGG GCAAATTTATGATATTATACACCTAATAGGCTGTAGAATTGACAAAAAAA TTTGCCCTTCGAATCTCCTGCAGTTTTCGAGTGAATCGAATTTTAGTTAA TCGATAGAACTTATCAAGGGTCCCCCTTTACTAACGGTTTTTTCGAAGGC TGAACATCAAATATCTGAGGCTACCAACGGATTCAGCGTGAAAAGTAGAT GAAGAAAATGGGGTTATTTGTTAAGTTTCGACCACCTGGTGCCGAGAAAT GACATTTTTAAGGCAATTAGTCTATTAGGAGCATAATATCAAAAATTTGC CCTGATCTAAGGGGTGCCCTACGGAAACCATTTTTAAGGCCTTTTCTGAA TCTCGGACGCTGGTCTATAACATTCCGATGACCATATAACTTTGGGTTCA TTTTTTTTTCTGCTAATTTCCTTTGAAATTGCACGCTTTATAAGAATAAT TTCTATAAGAGTATCAGGGTTGGATTTCAGAGTTAGAACAATAGGCCTAT TGTTTAGAACAATAGAAAAATAAAAATAATGCTCACCCTCAGCCAAAGTA CACTATTCTTATAAAAAAAGCGTGTATCAAGTTTAGGAGGGAGTAAATTC ACATTTGTTCAACCTAACTCTTATTTTTCATAGATTTGGTACGACCAGTG ATGAAATGGTTTTCCGACGTATTTATTCCGAACCTTTACTCCTTCGGATA CCGTTACCCGATTTTAGTATGCCCTACAACGTCATTTGTCTGACGTGTAC CGTCATTGCAATCGGGTTCGGATCTATTTATAATTTAACAACACGGACTT TTCAAGTTGAAGAGGTCAAGGAAAAACGAACTTTAAAAGAGAAAATTTTA GGGTTGTTCCGGAAAACAGAAACGCTGGAAAATGAAGAAGAAGAGAATTC CGATGGATAGTAAGTTTCTTTATTTTACATAAATCATTTTTACCATGCGC ATATTTTTTATCCTCTTTTGTATATAATTAGGTATCTTTTTCATAATTAC TTTAAAACATTACATAAGATGTATTCTTAAAATCCAATTGTTGATAATGT TTCCTTTAATGTTTTCAAGGGAAATCCAAATTTGTATTTTTCGGACGTTT TGTTTCAAATTTCGGACGTTTTGCCTATATTTTTGATCATCGAGTGATGG AAAGCAACGAACGATGGTGCTATGAATCGCTCTTTGATTTGTTGCTTAGC ATCCTTCCCATCATACTCCACGATATCTGAATCTGTCCCCGTAATTCTGT TGAAGTCATGTGACCAAATTTGATTGACGTTTGAGAAGCTTGTCGAGGTG TGTTCGAAGAATCCACGACGGAATTTCCCGATGACGTCTTGGCTGTGCTT CCAACCGATATTTCCGACAAGAATGGTTCGCTTTACACGCCGACACATCA AGTTAGAGTAGATGTATGTAAGAACTTTTTCGAAGTCCTTTCCAGCTTGC TCACCTTCCTTTAGATTCCCGTTCAAGAAGAAGACAGCGCCCGGTTGATT TTTACACTCATCCTTGTTTTCTTCACTGTCCTCAACATCGCCCAACATTT TGAACAATCCTTCAAACCCTTTACCTATTTCAGATGGAAAATCTCTCTTT TTTCGGTTTTCAAGATTGCCGTGCATCTTTAGTTGTGTCCATGAGACTTG TCCGAATTTTGTCCGATTTACTCCAGTGAAAACCTCTTCATCATCCACCT GTTCAAATCGATCGCCTTTGTAAAGGATCGGGTTACAAATGACGTCATCA GCACCCTTCATACATAGACTGTCGATCCCAGACTCCTCGTAGTTAGTTGC CAACAGATCGTTTGCTTGTCGCAGTTCTCTGTATTCTCCTTTTGTAATGT TTTGGATAGCAATGATCTGGTCAATGAAAAAAAAATCACAAATCACAAAG CGACTCTTCCATTTCATGCTATTGTGATAACAACTGAAGTCTAACGAGG

Coding sequence (CDS) from alignment at scaffold_98:196520..219918-

>TCONS_00073829 ID=TCONS_00073829|Name=TCONS_00073829|organism=Clytia hemisphaerica|type=CDS|length=23127bp|location=Sequence derived from alignment at scaffold_98:196520..219918- (Clytia hemisphaerica)
CATCCTTCCCATCATACTCCACGATATCTGAATTTGGTACGACCAGTGAT
GAAATGGTTTTCCGACGTATTTATTCCGAACCTTTACTCCTTCGGATACC
GTTACCCGATTTTAGTATGCCCTACAACGTCATTTGTCTGACGTGTACCG
TCATTGCAATCGGGTTCGGATCTATTTATAATTTAACAACACGGACTTTT
CAAGTTGAAGAGGTCAAGGAAAAACGAACTTTAAAAGAGAAAATTTTAGG
GTTGTTCCGGAAAACAGAAACGCTGGAAAATGAAGAAGAAGAGAATTCCG
ATGGATAACAATTTGAAGTACACACCATGCTATCATCGAGAACGACCAGC
AAAGTTGGAATTTCTTTTTACCATACCTCCACAAAGTGACGTCACCATTT
CCATCCAGTTTGAGAAGATCTTTCAAGATTGGATGCAGCACCCACCGGAT
TCTCATCATGGTTTCTACATGTCATCTTCAGTCATCAGTGGCATAGTTCC
TTTTCATGAAGAGCTTGTAGAAACCATCCCTTCACTACATCATTCTATGT
TTCGAGAAAGGTTACGGTGAGGAGTATGGTGGAAGTACTTGCATTGTACG
GAACACGCATGCGCACAAAAACATCACCCTTTCCTACCTTGACGTCATCC
CATATTTCGCGCGTGTTTATCTGCACACGTTGAAATTACAAGTTAATGGT
GTTCAAATAAAACCAGTGACGGATTTGAAATCTTCTTATATTTTGGTCCA
CAAATACACAACTGACTTGGTTAAGTTCCCTTTTGATGTTCAAGTGAAGA
TGAAAAATCGAGCAACAGATTGACGGTTTGAATCCGAATCATTTCGAAAA
GAAAATTATTTTGGTCAGTGGGAAAGACGTTGAATATGCAGTATTTGATC
TTACTAAGAAAGGATGGAATCTGAGATCGTTATTTGGAGGTGTGATTACC
TCAAGATGTCCTTTGGCAAGAAACAGTCAGGTCATCATTCATACAGACAA
GGCTGGCGACTGTTCAAAATTAGCATTAGAATATAAACAAAGTGTTGCAT
CAGTTTTTGATCCACACCACAGAGGCTTTAACGGAGGTGGGACTAGCAAG
CTTGTTGAATGCAGTGAAGTTATATGACTCTTCTTATCATTCGCTAGCTG
TTCACCTTAGGTCTGTCTGTCAGCGTTGATAAAAACTGGTCTGGATTAGT
TCACTCACTTTCTGGCCAATTCTGCTCCTCCATCAATTTCATCAGTAAAG
CAGAAACTACATCGCCAGAATTTTCGTTCAAACCACTGGGTGTGTGGCCT
GAAGATACATTATCACCTCGACAACACCTCAGATATGCCACCATCCCCAG
GGAAACAGTGTGCACAGAAAATTTGACACCATGGAAGAAGATGTTGCCTT
GTGGTAACAGTGGTGGCCTCCACATTACAACTTCTTTCCAAAGTCTTTTG
GTGAGATCCTCAGCAAATTTGGCATTGTAGAATTACATTTCTCGATGACA
CAAGGTCGATGGAGGCACAATAAATGGGGATATCCCTTGGATAGCGCACC
GACGGGTGTTGAACTGTGGGTCTGGTTCCACCCCAATCTAAACTCAAGTG
TATGGAAAATTTGAACATTATTTTTTTATTGGTCATTTTGCTCTTTGATA
AGCAAGAATGTGCTCCATCAGATGTGTATGACGAGGAGCTGTCAATCAAG
CAATTACAAAGTGGTCATGTTTATTCCCAATTTCAATTTGTTACAACATG
GAACGTCAATGTGTTTGAGCAACAAATTCCATCCTTCCCATCATACTCCA
CGATATCTGAATTTGGTACGACCAGTGATGAAATGGTTTTCCGACGTATT
TATTCCGAACCTTTACTCCTTCGGATACCGTTACCCGATTTTAGTATGCC
CTACAACGTCATTTGTCTGACGTGTACCGTCATTGCAATCGGGTTCGGAT
CTATTTATAATTTAACAACACGGACTTTTCAAGTTGAAGAGGTCAAGGAA
AAACGAACTTTAAAAGAGAAAATTTTAGGGTTGTTCCGGAAAACAGAAAC
GCTGGAAAATGAAGAAGAAGAGAATTCCGATGGATAACAATTTGAAGTAC
ACACCATGCTATCATCGAGAACGACCAGCAAAGTTGGAATTTCTTTTTAC
CATACCTCCACAAAGTGACGTCACCATTTCCATCCAGTTTGAGAAGATCT
TTCAAGATTGGATGCAGCACCCACCGGATTCTCATCATGGTTTCTACATG
TCATCTTCAGTCATCAGTGGCATAGTTCCTTTTCATGAAGAGCTTGTAGA
AACCATCCCTTCACTACATCATTCTATGTTTCGAGAAAGGTTACGGTGAG
GAGTATGGTGGAAGTACTTGCATTGTACGGAACACGCATGCGCACAAAAA
CATCACCCTTTCCTACCTTGACGTCATCCCATATTTCGCGCGTGTTTATC
TGCACACGTTGAAATTACAAGTTAATGGTGTTCAAATAAAACCAGTGACG
GATTTGAAATCTTCTTATATTTTGGTCCACAAATACACAACTGACTTGGT
TAAGTTCCCTTTTGATGTTCAAGTGAAGATGAAAAATCGAGCAACAGATT
GACGGTTTGAATCCGAATCATTTCGAAAAGAAAATTATTTTGGTCAGTGG
GAAAGACGTTGAATATGCAGTATTTGATCTTACTAAGAAAGGATGGAATC
TGAGATCGTTATTTGGAGGTGTGATTACCTCAAGATGTCCTTTGGCAAGA
AACAGTCAGGTCATCATTCATACAGACAAGGCTGGCGACTGTTCAAAATT
AGCATTAGAATATAAACAAAGTGTTGCATCAGTTTTTGATCCACACCACA
GAGGCTTTAACGGAGGTGGGACTAGCAAGCTTGTTGAATGCAGTGAAGTT
ATATGACTCTTCTTATCATTCGCTAGCTGTTCACCTTAGGTCTGTCTGTC
AGCGTTGATAAAAACTGGTCTGGATTAGTTCACTCACTTTCTGGCCAATT
CTGCTCCTCCATCAATTTCATCAGTAAAGCAGAAACTACATCGCCAGAAT
TTTCGTTCAAACCACTGGGTGTGTGGCCTGAAGATACATTATCACCTCGA
CAACACCTCAGATATGCCACCATCCCCAGGGAAACAGTGTGCACAGAAAA
TTTGACACCATGGAAGAAGATGTTGCCTTGTGGTAACAGTGGTGGCCTCC
ACATTACAACTTCTTTCCAAAGTCTTTTGGTGAGATCCTCAGCAAATTTG
GCATTGTAGAATTACATTTCTCGATGACACAAGGTCGATGGAGGCACAAT
AAATGGGGATATCCCTTGGATAGCGCACCGACGGGTGTTGAACTGTGGGT
CTGGTTCCACCCCAATCTAAACTCAAGTGTATGGAAAATTTGAACATTAT
TTTTTTATTGGTCATTTTGCTCTTTGATAAGCAAGAATGTGCTCCATCAG
ATGTGTATGACGAGGAGCTGTCAATCAAGCAATTACAAAGTGGTCATGTT
TATTCCCAATTTCAATTTGTTACAACATGGAACGTCAATGTGTTTGAGCA
ACAAATTCCATCCTTCCCATCATACTCCACGATATCTGAATTTGGTACGA
CCAGTGATGAAATGGTTTTCCGACGTATTTATTCCGAACCTTTACTCCTT
CGGATACCGTTACCCGATTTTAGTATGCCCTACAACGTCATTTGTCTGAC
GTGTACCGTCATTGCAATCGGGTTCGGATCTATTTATAATTTAACAACAC
GGACTTTTCAAGTTGAAGAGGTCAAGGAAAAACGAACTTTAAAAGAGAAA
ATTTTAGGGTTGTTCCGGAAAACAGAAACGCTGGAAAATGAAGAAGAAGA
GAATTCCGATGGATAACAATTTGAAGTACACACCATGCTATCATCGAGAA
CGACCAGCAAAGTTGGAATTTCTTTTTACCATACCTCCACAAAGTGACGT
CACCATTTCCATCCAGTTTGAGAAGATCTTTCAAGATTGGATGCAGCACC
CACCGGATTCTCATCATGGTTTCTACATGTCATCTTCAGTCATCAGTGGC
ATAGTTCCTTTTCATGAAGAGCTTGTAGAAACCATCCCTTCACTACATCA
TTCTATGTTTCGAGAAAGGTTACGGTGAGGAGTATGGTGGAAGTACTTGC
ATTGTACGGAACACGCATGCGCACAAAAACATCACCCTTTCCTACCTTGA
CGTCATCCCATATTTCGCGCGTGTTTATCTGCACACGTTGAAATTACAAG
TTAATGGTGTTCAAATAAAACCAGTGACGGATTTGAAATCTTCTTATATT
TTGGTCCACAAATACACAACTGACTTGGTTAAGTTCCCTTTTGATGTTCA
AGTGAAGATGAAAAATCGAGCAACAGATTGACGGTTTGAATCCGAATCAT
TTCGAAAAGAAAATTATTTTGGTCAGTGGGAAAGACGTTGAATATGCAGT
ATTTGATCTTACTAAGAAAGGATGGAATCTGAGATCGTTATTTGGAGGTG
TGATTACCTCAAGATGTCCTTTGGCAAGAAACAGTCAGGTCATCATTCAT
ACAGACAAGGCTGGCGACTGTTCAAAATTAGCATTAGAATATAAACAAAG
TGTTGCATCAGTTTTTGATCCACACCACAGAGGCTTTAACGGAGGTGGGA
CTAGCAAGCTTGTTGAATGCAGTGAAGTTATATGACTCTTCTTATCATTC
GCTAGCTGTTCACCTTAGGTCTGTCTGTCAGCGTTGATAAAAACTGGTCT
GGATTAGTTCACTCACTTTCTGGCCAATTCTGCTCCTCCATCAATTTCAT
CAGTAAAGCAGAAACTACATCGCCAGAATTTTCGTTCAAACCACTGGGTG
TGTGGCCTGAAGATACATTATCACCTCGACAACACCTCAGATATGCCACC
ATCCCCAGGGAAACAGTGTGCACAGAAAATTTGACACCATGGAAGAAGAT
GTTGCCTTGTGGTAACAGTGGTGGCCTCCACATTACAACTTCTTTCCAAA
GTCTTTTGGTGAGATCCTCAGCAAATTTGGCATTGTAGAATTACATTTCT
CGATGACACAAGGTCGATGGAGGCACAATAAATGGGGATATCCCTTGGAT
AGCGCACCGACGGGTGTTGAACTGTGGGTCTGGTTCCACCCCAATCTAAA
CTCAAGTGTATGGAAAATTTGAACATTATTTTTTTATTGGTCATTTTGCT
CTTTGATAAGCAAGAATGTGCTCCATCAGATGTGTATGACGAGGAGCTGT
CAATCAAGCAATTACAAAGTGGTCATGTTTATTCCCAATTTCAATTTGTT
ACAACATGGAACGTCAATGTGTTTGAGCAACAAATTCCATCCTTCCCATC
ATACTCCACGATATCTGAATTTGGTACGACCAGTGATGAAATGGTTTTCC
GACGTATTTATTCCGAACCTTTACTCCTTCGGATACCGTTACCCGATTTT
AGTATGCCCTACAACGTCATTTGTCTGACGTGTACCGTCATTGCAATCGG
GTTCGGATCTATTTATAATTTAACAACACGGACTTTTCAAGTTGAAGAGG
TCAAGGAAAAACGAACTTTAAAAGAGAAAATTTTAGGGTTGTTCCGGAAA
ACAGAAACGCTGGAAAATGAAGAAGAAGAGAATTCCGATGGATAACAATT
TGAAGTACACACCATGCTATCATCGAGAACGACCAGCAAAGTTGGAATTT
CTTTTTACCATACCTCCACAAAGTGACGTCACCATTTCCATCCAGTTTGA
GAAGATCTTTCAAGATTGGATGCAGCACCCACCGGATTCTCATCATGGTT
TCTACATGTCATCTTCAGTCATCAGTGGCATAGTTCCTTTTCATGAAGAG
CTTGTAGAAACCATCCCTTCACTACATCATTCTATGTTTCGAGAAAGGTT
ACGGTGAGGAGTATGGTGGAAGTACTTGCATTGTACGGAACACGCATGCG
CACAAAAACATCACCCTTTCCTACCTTGACGTCATCCCATATTTCGCGCG
TGTTTATCTGCACACGTTGAAATTACAAGTTAATGGTGTTCAAATAAAAC
CAGTGACGGATTTGAAATCTTCTTATATTTTGGTCCACAAATACACAACT
GACTTGGTTAAGTTCCCTTTTGATGTTCAAGTGAAGATGAAAAATCGAGC
AACAGATTGACGGTTTGAATCCGAATCATTTCGAAAAGAAAATTATTTTG
GTCAGTGGGAAAGACGTTGAATATGCAGTATTTGATCTTACTAAGAAAGG
ATGGAATCTGAGATCGTTATTTGGAGGTGTGATTACCTCAAGATGTCCTT
TGGCAAGAAACAGTCAGGTCATCATTCATACAGACAAGGCTGGCGACTGT
TCAAAATTAGCATTAGAATATAAACAAAGTGTTGCATCAGTTTTTGATCC
ACACCACAGAGGCTTTAACGGAGGTGGGACTAGCAAGCTTGTTGAATGCA
GTGAAGTTATATGACTCTTCTTATCATTCGCTAGCTGTTCACCTTAGGTC
TGTCTGTCAGCGTTGATAAAAACTGGTCTGGATTAGTTCACTCACTTTCT
GGCCAATTCTGCTCCTCCATCAATTTCATCAGTAAAGCAGAAACTACATC
GCCAGAATTTTCGTTCAAACCACTGGGTGTGTGGCCTGAAGATACATTAT
CACCTCGACAACACCTCAGATATGCCACCATCCCCAGGGAAACAGTGTGC
ACAGAAAATTTGACACCATGGAAGAAGATGTTGCCTTGTGGTAACAGTGG
TGGCCTCCACATTACAACTTCTTTCCAAAGTCTTTTGGTGAGATCCTCAG
CAAATTTGGCATTGTAGAATTACATTTCTCGATGACACAAGGTCGATGGA
GGCACAATAAATGGGGATATCCCTTGGATAGCGCACCGACGGGTGTTGAA
CTGTGGGTCTGGTTCCACCCCAATCTAAACTCAAGTGTATGGAAAATTTG
AACATTATTTTTTTATTGGTCATTTTGCTCTTTGATAAGCAAGAATGTGC
TCCATCAGATGTGTATGACGAGGAGCTGTCAATCAAGCAATTACAAAGTG
GTCATGTTTATTCCCAATTTCAATTTGTTACAACATGGAACGTCAATGTG
TTTGAGCAACAAATTCCATCCTTCCCATCATACTCCACGATATCTGAATT
TGGTACGACCAGTGATGAAATGGTTTTCCGACGTATTTATTCCGAACCTT
TACTCCTTCGGATACCGTTACCCGATTTTAGTATGCCCTACAACGTCATT
TGTCTGACGTGTACCGTCATTGCAATCGGGTTCGGATCTATTTATAATTT
AACAACACGGACTTTTCAAGTTGAAGAGGTCAAGGAAAAACGAACTTTAA
AAGAGAAAATTTTAGGGTTGTTCCGGAAAACAGAAACGCTGGAAAATGAA
GAAGAAGAGAATTCCGATGGATAACAATTTGAAGTACACACCATGCTATC
ATCGAGAACGACCAGCAAAGTTGGAATTTCTTTTTACCATACCTCCACAA
AGTGACGTCACCATTTCCATCCAGTTTGAGAAGATCTTTCAAGATTGGAT
GCAGCACCCACCGGATTCTCATCATGGTTTCTACATGTCATCTTCAGTCA
TCAGTGGCATAGTTCCTTTTCATGAAGAGCTTGTAGAAACCATCCCTTCA
CTACATCATTCTATGTTTCGAGAAAGGTTACGGTGAGGAGTATGGTGGAA
GTACTTGCATTGTACGGAACACGCATGCGCACAAAAACATCACCCTTTCC
TACCTTGACGTCATCCCATATTTCGCGCGTGTTTATCTGCACACGTTGAA
ATTACAAGTTAATGGTGTTCAAATAAAACCAGTGACGGATTTGAAATCTT
CTTATATTTTGGTCCACAAATACACAACTGACTTGGTTAAGTTCCCTTTT
GATGTTCAAGTGAAGATGAAAAATCGAGCAACAGATTGACGGTTTGAATC
CGAATCATTTCGAAAAGAAAATTATTTTGGTCAGTGGGAAAGACGTTGAA
TATGCAGTATTTGATCTTACTAAGAAAGGATGGAATCTGAGATCGTTATT
TGGAGGTGTGATTACCTCAAGATGTCCTTTGGCAAGAAACAGTCAGGTCA
TCATTCATACAGACAAGGCTGGCGACTGTTCAAAATTAGCATTAGAATAT
AAACAAAGTGTTGCATCAGTTTTTGATCCACACCACAGAGGCTTTAACGG
AGGTGGGACTAGCAAGCTTGTTGAATGCAGTGAAGTTATATGACTCTTCT
TATCATTCGCTAGCTGTTCACCTTAGGTCTGTCTGTCAGCGTTGATAAAA
ACTGGTCTGGATTAGTTCACTCACTTTCTGGCCAATTCTGCTCCTCCATC
AATTTCATCAGTAAAGCAGAAACTACATCGCCAGAATTTTCGTTCAAACC
ACTGGGTGTGTGGCCTGAAGATACATTATCACCTCGACAACACCTCAGAT
ATGCCACCATCCCCAGGGAAACAGTGTGCACAGAAAATTTGACACCATGG
AAGAAGATGTTGCCTTGTGGTAACAGTGGTGGCCTCCACATTACAACTTC
TTTCCAAAGTCTTTTGGTGAGATCCTCAGCAAATTTGGCATTGTAGAATT
ACATTTCTCGATGACACAAGGTCGATGGAGGCACAATAAATGGGGATATC
CCTTGGATAGCGCACCGACGGGTGTTGAACTGTGGGTCTGGTTCCACCCC
AATCTAAACTCAAGTGTATGGAAAATTTGAACATTATTTTTTTATTGGTC
ATTTTGCTCTTTGATAAGCAAGAATGTGCTCCATCAGATGTGTATGACGA
GGAGCTGTCAATCAAGCAATTACAAAGTGGTCATGTTTATTCCCAATTTC
AATTTGTTACAACATGGAACGTCAATGTGTTTGAGCAACAAATTCCATCC
TTCCCATCATACTCCACGATATCTGAATTTGGTACGACCAGTGATGAAAT
GGTTTTCCGACGTATTTATTCCGAACCTTTACTCCTTCGGATACCGTTAC
CCGATTTTAGTATGCCCTACAACGTCATTTGTCTGACGTGTACCGTCATT
GCAATCGGGTTCGGATCTATTTATAATTTAACAACACGGACTTTTCAAGT
TGAAGAGGTCAAGGAAAAACGAACTTTAAAAGAGAAAATTTTAGGGTTGT
TCCGGAAAACAGAAACGCTGGAAAATGAAGAAGAAGAGAATTCCGATGGA
TAACAATTTGAAGTACACACCATGCTATCATCGAGAACGACCAGCAAAGT
TGGAATTTCTTTTTACCATACCTCCACAAAGTGACGTCACCATTTCCATC
CAGTTTGAGAAGATCTTTCAAGATTGGATGCAGCACCCACCGGATTCTCA
TCATGGTTTCTACATGTCATCTTCAGTCATCAGTGGCATAGTTCCTTTTC
ATGAAGAGCTTGTAGAAACCATCCCTTCACTACATCATTCTATGTTTCGA
GAAAGGTTACGGTGAGGAGTATGGTGGAAGTACTTGCATTGTACGGAACA
CGCATGCGCACAAAAACATCACCCTTTCCTACCTTGACGTCATCCCATAT
TTCGCGCGTGTTTATCTGCACACGTTGAAATTACAAGTTAATGGTGTTCA
AATAAAACCAGTGACGGATTTGAAATCTTCTTATATTTTGGTCCACAAAT
ACACAACTGACTTGGTTAAGTTCCCTTTTGATGTTCAAGTGAAGATGAAA
AATCGAGCAACAGATTGACGGTTTGAATCCGAATCATTTCGAAAAGAAAA
TTATTTTGGTCAGTGGGAAAGACGTTGAATATGCAGTATTTGATCTTACT
AAGAAAGGATGGAATCTGAGATCGTTATTTGGAGGTGTGATTACCTCAAG
ATGTCCTTTGGCAAGAAACAGTCAGGTCATCATTCATACAGACAAGGCTG
GCGACTGTTCAAAATTAGCATTAGAATATAAACAAAGTGTTGCATCAGTT
TTTGATCCACACCACAGAGGCTTTAACGGAGGTGGGACTAGCAAGCTTGT
TGAATGCAGTGAAGTTATATGACTCTTCTTATCATTCGCTAGCTGTTCAC
CTTAGGTCTGTCTGTCAGCGTTGATAAAAACTGGTCTGGATTAGTTCACT
CACTTTCTGGCCAATTCTGCTCCTCCATCAATTTCATCAGTAAAGCAGAA
ACTACATCGCCAGAATTTTCGTTCAAACCACTGGGTGTGTGGCCTGAAGA
TACATTATCACCTCGACAACACCTCAGATATGCCACCATCCCCAGGGAAA
CAGTGTGCACAGAAAATTTGACACCATGGAAGAAGATGTTGCCTTGTGGT
AACAGTGGTGGCCTCCACATTACAACTTCTTTCCAAAGTCTTTTGGTGAG
ATCCTCAGCAAATTTGGCATTGTAGAATTACATTTCTCGATGACACAAGG
TCGATGGAGGCACAATAAATGGGGATATCCCTTGGATAGCGCACCGACGG
GTGTTGAACTGTGGGTCTGGTTCCACCCCAATCTAAACTCAAGTGTATGG
AAAATTTGAACATTATTTTTTTATTGGTCATTTTGCTCTTTGATAAGCAA
GAATGTGCTCCATCAGATGTGTATGACGAGGAGCTGTCAATCAAGCAATT
ACAAAGTGGTCATGTTTATTCCCAATTTCAATTTGTTACAACATGGAACG
TCAATGTGTTTGAGCAACAAATTCCATCCTTCCCATCATACTCCACGATA
TCTGAATTTGGTACGACCAGTGATGAAATGGTTTTCCGACGTATTTATTC
CGAACCTTTACTCCTTCGGATACCGTTACCCGATTTTAGTATGCCCTACA
ACGTCATTTGTCTGACGTGTACCGTCATTGCAATCGGGTTCGGATCTATT
TATAATTTAACAACACGGACTTTTCAAGTTGAAGAGGTCAAGGAAAAACG
AACTTTAAAAGAGAAAATTTTAGGGTTGTTCCGGAAAACAGAAACGCTGG
AAAATGAAGAAGAAGAGAATTCCGATGGATAACAATTTGAAGTACACACC
ATGCTATCATCGAGAACGACCAGCAAAGTTGGAATTTCTTTTTACCATAC
CTCCACAAAGTGACGTCACCATTTCCATCCAGTTTGAGAAGATCTTTCAA
GATTGGATGCAGCACCCACCGGATTCTCATCATGGTTTCTACATGTCATC
TTCAGTCATCAGTGGCATAGTTCCTTTTCATGAAGAGCTTGTAGAAACCA
TCCCTTCACTACATCATTCTATGTTTCGAGAAAGGTTACGGTGAGGAGTA
TGGTGGAAGTACTTGCATTGTACGGAACACGCATGCGCACAAAAACATCA
CCCTTTCCTACCTTGACGTCATCCCATATTTCGCGCGTGTTTATCTGCAC
ACGTTGAAATTACAAGTTAATGGTGTTCAAATAAAACCAGTGACGGATTT
GAAATCTTCTTATATTTTGGTCCACAAATACACAACTGACTTGGTTAAGT
TCCCTTTTGATGTTCAAGTGAAGATGAAAAATCGAGCAACAGATTGACGG
TTTGAATCCGAATCATTTCGAAAAGAAAATTATTTTGGTCAGTGGGAAAG
ACGTTGAATATGCAGTATTTGATCTTACTAAGAAAGGATGGAATCTGAGA
TCGTTATTTGGAGGTGTGATTACCTCAAGATGTCCTTTGGCAAGAAACAG
TCAGGTCATCATTCATACAGACAAGGCTGGCGACTGTTCAAAATTAGCAT
TAGAATATAAACAAAGTGTTGCATCAGTTTTTGATCCACACCACAGAGGC
TTTAACGGAGGTGGGACTAGCAAGCTTGTTGAATGCAGTGAAGTTATATG
ACTCTTCTTATCATTCGCTAGCTGTTCACCTTAGGTCTGTCTGTCAGCGT
TGATAAAAACTGGTCTGGATTAGTTCACTCACTTTCTGGCCAATTCTGCT
CCTCCATCAATTTCATCAGTAAAGCAGAAACTACATCGCCAGAATTTTCG
TTCAAACCACTGGGTGTGTGGCCTGAAGATACATTATCACCTCGACAACA
CCTCAGATATGCCACCATCCCCAGGGAAACAGTGTGCACAGAAAATTTGA
CACCATGGAAGAAGATGTTGCCTTGTGGTAACAGTGGTGGCCTCCACATT
ACAACTTCTTTCCAAAGTCTTTTGGTGAGATCCTCAGCAAATTTGGCATT
GTAGAATTACATTTCTCGATGACACAAGGTCGATGGAGGCACAATAAATG
GGGATATCCCTTGGATAGCGCACCGACGGGTGTTGAACTGTGGGTCTGGT
TCCACCCCAATCTAAACTCAAGTGTATGGAAAATTTGAACATTATTTTTT
TATTGGTCATTTTGCTCTTTGATAAGCAAGAATGTGCTCCATCAGATGTG
TATGACGAGGAGCTGTCAATCAAGCAATTACAAAGTGGTCATGTTTATTC
CCAATTTCAATTTGTTACAACATGGAACGTCAATGTGTTTGAGCAACAAA
TTCCATCCTTCCCATCATACTCCACGATATCTGAATTTGGTACGACCAGT
GATGAAATGGTTTTCCGACGTATTTATTCCGAACCTTTACTCCTTCGGAT
ACCGTTACCCGATTTTAGTATGCCCTACAACGTCATTTGTCTGACGTGTA
CCGTCATTGCAATCGGGTTCGGATCTATTTATAATTTAACAACACGGACT
TTTCAAGTTGAAGAGGTCAAGGAAAAACGAACTTTAAAAGAGAAAATTTT
AGGGTTGTTCCGGAAAACAGAAACGCTGGAAAATGAAGAAGAAGAGAATT
CCGATGGATAACAATTTGAAGTACACACCATGCTATCATCGAGAACGACC
AGCAAAGTTGGAATTTCTTTTTACCATACCTCCACAAAGTGACGTCACCA
TTTCCATCCAGTTTGAGAAGATCTTTCAAGATTGGATGCAGCACCCACCG
GATTCTCATCATGGTTTCTACATGTCATCTTCAGTCATCAGTGGCATAGT
TCCTTTTCATGAAGAGCTTGTAGAAACCATCCCTTCACTACATCATTCTA
TGTTTCGAGAAAGGTTACGGTGAGGAGTATGGTGGAAGTACTTGCATTGT
ACGGAACACGCATGCGCACAAAAACATCACCCTTTCCTACCTTGACGTCA
TCCCATATTTCGCGCGTGTTTATCTGCACACGTTGAAATTACAAGTTAAT
GGTGTTCAAATAAAACCAGTGACGGATTTGAAATCTTCTTATATTTTGGT
CCACAAATACACAACTGACTTGGTTAAGTTCCCTTTTGATGTTCAAGTGA
AGATGAAAAATCGAGCAACAGATTGACGGTTTGAATCCGAATCATTTCGA
AAAGAAAATTATTTTGGTCAGTGGGAAAGACGTTGAATATGCAGTATTTG
ATCTTACTAAGAAAGGATGGAATCTGAGATCGTTATTTGGAGGTGTGATT
ACCTCAAGATGTCCTTTGGCAAGAAACAGTCAGGTCATCATTCATACAGA
CAAGGCTGGCGACTGTTCAAAATTAGCATTAGAATATAAACAAAGTGTTG
CATCAGTTTTTGATCCACACCACAGAGGCTTTAACGGAGGTGGGACTAGC
AAGCTTGTTGAATGCAGTGAAGTTATATGACTCTTCTTATCATTCGCTAG
CTGTTCACCTTAGGTCTGTCTGTCAGCGTTGATAAAAACTGGTCTGGATT
AGTTCACTCACTTTCTGGCCAATTCTGCTCCTCCATCAATTTCATCAGTA
AAGCAGAAACTACATCGCCAGAATTTTCGTTCAAACCACTGGGTGTGTGG
CCTGAAGATACATTATCACCTCGACAACACCTCAGATATGCCACCATCCC
CAGGGAAACAGTGTGCACAGAAAATTTGACACCATGGAAGAAGATGTTGC
CTTGTGGTAACAGTGGTGGCCTCCACATTACAACTTCTTTCCAAAGTCTT
TTGGTGAGATCCTCAGCAAATTTGGCATTGTAGAATTACATTTCTCGATG
ACACAAGGTCGATGGAGGCACAATAAATGGGGATATCCCTTGGATAGCGC
ACCGACGGGTGTTGAACTGTGGGTCTGGTTCCACCCCAATCTAAACTCAA
GTGTATGGAAAATTTGAACATTATTTTTTTATTGGTCATTTTGCTCTTTG
ATAAGCAAGAATGTGCTCCATCAGATGTGTATGACGAGGAGCTGTCAATC
AAGCAATTACAAAGTGGTCATGTTTATTCCCAATTTCAATTTGTTACAAC
ATGGAACGTCAATGTGTTTGAGCAACAAATTCCATCCTTCCCATCATACT
CCACGATATCTGAATTTGGTACGACCAGTGATGAAATGGTTTTCCGACGT
ATTTATTCCGAACCTTTACTCCTTCGGATACCGTTACCCGATTTTAGTAT
GCCCTACAACGTCATTTGTCTGACGTGTACCGTCATTGCAATCGGGTTCG
GATCTATTTATAATTTAACAACACGGACTTTTCAAGTTGAAGAGGTCAAG
GAAAAACGAACTTTAAAAGAGAAAATTTTAGGGTTGTTCCGGAAAACAGA
AACGCTGGAAAATGAAGAAGAAGAGAATTCCGATGGATAACAATTTGAAG
TACACACCATGCTATCATCGAGAACGACCAGCAAAGTTGGAATTTCTTTT
TACCATACCTCCACAAAGTGACGTCACCATTTCCATCCAGTTTGAGAAGA
TCTTTCAAGATTGGATGCAGCACCCACCGGATTCTCATCATGGTTTCTAC
ATGTCATCTTCAGTCATCAGTGGCATAGTTCCTTTTCATGAAGAGCTTGT
AGAAACCATCCCTTCACTACATCATTCTATGTTTCGAGAAAGGTTACGGT
GAGGAGTATGGTGGAAGTACTTGCATTGTACGGAACACGCATGCGCACAA
AAACATCACCCTTTCCTACCTTGACGTCATCCCATATTTCGCGCGTGTTT
ATCTGCACACGTTGAAATTACAAGTTAATGGTGTTCAAATAAAACCAGTG
ACGGATTTGAAATCTTCTTATATTTTGGTCCACAAATACACAACTGACTT
GGTTAAGTTCCCTTTTGATGTTCAAGTGAAGATGAAAAATCGAGCAACAG
ATTGACGGTTTGAATCCGAATCATTTCGAAAAGAAAATTATTTTGGTCAG
TGGGAAAGACGTTGAATATGCAGTATTTGATCTTACTAAGAAAGGATGGA
ATCTGAGATCGTTATTTGGAGGTGTGATTACCTCAAGATGTCCTTTGGCA
AGAAACAGTCAGGTCATCATTCATACAGACAAGGCTGGCGACTGTTCAAA
ATTAGCATTAGAATATAAACAAAGTGTTGCATCAGTTTTTGATCCACACC
ACAGAGGCTTTAACGGAGGTGGGACTAGCAAGCTTGTTGAATGCAGTGAA
GTTATATGACTCTTCTTATCATTCGCTAGCTGTTCACCTTAGGTCTGTCT
GTCAGCGTTGATAAAAACTGGTCTGGATTAGTTCACTCACTTTCTGGCCA
ATTCTGCTCCTCCATCAATTTCATCAGTAAAGCAGAAACTACATCGCCAG
AATTTTCGTTCAAACCACTGGGTGTGTGGCCTGAAGATACATTATCACCT
CGACAACACCTCAGATATGCCACCATCCCCAGGGAAACAGTGTGCACAGA
AAATTTGACACCATGGAAGAAGATGTTGCCTTGTGGTAACAGTGGTGGCC
TCCACATTACAACTTCTTTCCAAAGTCTTTTGGTGAGATCCTCAGCAAAT
TTGGCATTGTAGAATTACATTTCTCGATGACACAAGGTCGATGGAGGCAC
AATAAATGGGGATATCCCTTGGATAGCGCACCGACGGGTGTTGAACTGTG
GGTCTGGTTCCACCCCAATCTAAACTCAAGTGTATGGAAAATTTGAACAT
TATTTTTTTATTGGTCATTTTGCTCTTTGATAAGCAAGAATGTGCTCCAT
CAGATGTGTATGACGAGGAGCTGTCAATCAAGCAATTACAAAGTGGTCAT
GTTTATTCCCAATTTCAATTTGTTACAACATGGAACGTCAATGTGTTTGA
GCAACAAATTCCATCCTTCCCATCATACTCCACGATATCTGAATTTGGTA
CGACCAGTGATGAAATGGTTTTCCGACGTATTTATTCCGAACCTTTACTC
CTTCGGATACCGTTACCCGATTTTAGTATGCCCTACAACGTCATTTGTCT
GACGTGTACCGTCATTGCAATCGGGTTCGGATCTATTTATAATTTAACAA
CACGGACTTTTCAAGTTGAAGAGGTCAAGGAAAAACGAACTTTAAAAGAG
AAAATTTTAGGGTTGTTCCGGAAAACAGAAACGCTGGAAAATGAAGAAGA
AGAGAATTCCGATGGATAACAATTTGAAGTACACACCATGCTATCATCGA
GAACGACCAGCAAAGTTGGAATTTCTTTTTACCATACCTCCACAAAGTGA
CGTCACCATTTCCATCCAGTTTGAGAAGATCTTTCAAGATTGGATGCAGC
ACCCACCGGATTCTCATCATGGTTTCTACATGTCATCTTCAGTCATCAGT
GGCATAGTTCCTTTTCATGAAGAGCTTGTAGAAACCATCCCTTCACTACA
TCATTCTATGTTTCGAGAAAGGTTACGGTGAGGAGTATGGTGGAAGTACT
TGCATTGTACGGAACACGCATGCGCACAAAAACATCACCCTTTCCTACCT
TGACGTCATCCCATATTTCGCGCGTGTTTATCTGCACACGTTGAAATTAC
AAGTTAATGGTGTTCAAATAAAACCAGTGACGGATTTGAAATCTTCTTAT
ATTTTGGTCCACAAATACACAACTGACTTGGTTAAGTTCCCTTTTGATGT
TCAAGTGAAGATGAAAAATCGAGCAACAGATTGACGGTTTGAATCCGAAT
CATTTCGAAAAGAAAATTATTTTGGTCAGTGGGAAAGACGTTGAATATGC
AGTATTTGATCTTACTAAGAAAGGATGGAATCTGAGATCGTTATTTGGAG
GTGTGATTACCTCAAGATGTCCTTTGGCAAGAAACAGTCAGGTCATCATT
CATACAGACAAGGCTGGCGACTGTTCAAAATTAGCATTAGAATATAAACA
AAGTGTTGCATCAGTTTTTGATCCACACCACAGAGGCTTTAACGGAGGTG
GGACTAGCAAGCTTGTTGAATGCAGTGAAGTTATATGACTCTTCTTATCA
TTCGCTAGCTGTTCACCTTAGGTCTGTCTGTCAGCGTTGATAAAAACTGG
TCTGGATTAGTTCACTCACTTTCTGGCCAATTCTGCTCCTCCATCAATTT
CATCAGTAAAGCAGAAACTACATCGCCAGAATTTTCGTTCAAACCACTGG
GTGTGTGGCCTGAAGATACATTATCACCTCGACAACACCTCAGATATGCC
ACCATCCCCAGGGAAACAGTGTGCACAGAAAATTTGACACCATGGAAGAA
GATGTTGCCTTGTGGTAACAGTGGTGGCCTCCACATTACAACTTCTTTCC
AAAGTCTTTTGGTGAGATCCTCAGCAAATTTGGCATTGTAGAATTACATT
TCTCGATGACACAAGGTCGATGGAGGCACAATAAATGGGGATATCCCTTG
GATAGCGCACCGACGGGTGTTGAACTGTGGGTCTGGTTCCACCCCAATCT
AAACTCAAGTGTATGGAAAATTTGAACATTATTTTTTTATTGGTCATTTT
GCTCTTTGATAAGCAAGAATGTGCTCCATCAGATGTGTATGACGAGGAGC
TGTCAATCAAGCAATTACAAAGTGGTCATGTTTATTCCCAATTTCAATTT
GTTACAACATGGAACGTCAATGTGTTTGAGCAACAAATTCCATCCTTCCC
ATCATACTCCACGATATCTGAATTTGGTACGACCAGTGATGAAATGGTTT
TCCGACGTATTTATTCCGAACCTTTACTCCTTCGGATACCGTTACCCGAT
TTTAGTATGCCCTACAACGTCATTTGTCTGACGTGTACCGTCATTGCAAT
CGGGTTCGGATCTATTTATAATTTAACAACACGGACTTTTCAAGTTGAAG
AGGTCAAGGAAAAACGAACTTTAAAAGAGAAAATTTTAGGGTTGTTCCGG
AAAACAGAAACGCTGGAAAATGAAGAAGAAGAGAATTCCGATGGATAACA
ATTTGAAGTACACACCATGCTATCATCGAGAACGACCAGCAAAGTTGGAA
TTTCTTTTTACCATACCTCCACAAAGTGACGTCACCATTTCCATCCAGTT
TGAGAAGATCTTTCAAGATTGGATGCAGCACCCACCGGATTCTCATCATG
GTTTCTACATGTCATCTTCAGTCATCAGTGGCATAGTTCCTTTTCATGAA
GAGCTTGTAGAAACCATCCCTTCACTACATCATTCTATGTTTCGAGAAAG
GTTACGGTGAGGAGTATGGTGGAAGTACTTGCATTGTACGGAACACGCAT
GCGCACAAAAACATCACCCTTTCCTACCTTGACGTCATCCCATATTTCGC
GCGTGTTTATCTGCACACGTTGAAATTACAAGTTAATGGTGTTCAAATAA
AACCAGTGACGGATTTGAAATCTTCTTATATTTTGGTCCACAAATACACA
ACTGACTTGGTTAAGTTCCCTTTTGATGTTCAAGTGAAGATGAAAAATCG
AGCAACAGATTGACGGTTTGAATCCGAATCATTTCGAAAAGAAAATTATT
TTGGTCAGTGGGAAAGACGTTGAATATGCAGTATTTGATCTTACTAAGAA
AGGATGGAATCTGAGATCGTTATTTGGAGGTGTGATTACCTCAAGATGTC
CTTTGGCAAGAAACAGTCAGGTCATCATTCATACAGACAAGGCTGGCGAC
TGTTCAAAATTAGCATTAGAATATAAACAAAGTGTTGCATCAGTTTTTGA
TCCACACCACAGAGGCTTTAACGGAGGTGGGACTAGCAAGCTTGTTGAAT
GCAGTGAAGTTATATGACTCTTCTTATCATTCGCTAGCTGTTCACCTTAG
GTCTGTCTGTCAGCGTTGATAAAAACTGGTCTGGATTAGTTCACTCACTT
TCTGGCCAATTCTGCTCCTCCATCAATTTCATCAGTAAAGCAGAAACTAC
ATCGCCAGAATTTTCGTTCAAACCACTGGGTGTGTGGCCTGAAGATACAT
TATCACCTCGACAACACCTCAGATATGCCACCATCCCCAGGGAAACAGTG
TGCACAGAAAATTTGACACCATGGAAGAAGATGTTGCCTTGTGGTAACAG
TGGTGGCCTCCACATTACAACTTCTTTCCAAAGTCTTTTGGTGAGATCCT
CAGCAAATTTGGCATTGTAGAATTACATTTCTCGATGACACAAGGTCGAT
GGAGGCACAATAAATGGGGATATCCCTTGGATAGCGCACCGACGGGTGTT
GAACTGTGGGTCTGGTTCCACCCCAATCTAAACTCAAGTGTATGGAAAAT
TTGAACATTATTTTTTTATTGGTCATTTTGCTCTTTGATAAGCAAGAATG
TGCTCCATCAGATGTGTATGACGAGGAGCTGTCAATCAAGCAATTACAAA
GTGGTCATGTTTATTCCCAATTTCAATTTGTTACAACATGGAACGTCAAT
GTGTTTGAGCAACAAATTCCATCCTTCCCATCATACTCCACGATATCTGA
ATTTGGTACGACCAGTGATGAAATGGTTTTCCGACGTATTTATTCCGAAC
CTTTACTCCTTCGGATACCGTTACCCGATTTTAGTATGCCCTACAACGTC
ATTTGTCTGACGTGTACCGTCATTGCAATCGGGTTCGGATCTATTTATAA
TTTAACAACACGGACTTTTCAAGTTGAAGAGGTCAAGGAAAAACGAACTT
TAAAAGAGAAAATTTTAGGGTTGTTCCGGAAAACAGAAACGCTGGAAAAT
GAAGAAGAAGAGAATTCCGATGGATAACAATTTGAAGTACACACCATGCT
ATCATCGAGAACGACCAGCAAAGTTGGAATTTCTTTTTACCATACCTCCA
CAAAGTGACGTCACCATTTCCATCCAGTTTGAGAAGATCTTTCAAGATTG
GATGCAGCACCCACCGGATTCTCATCATGGTTTCTACATGTCATCTTCAG
TCATCAGTGGCATAGTTCCTTTTCATGAAGAGCTTGTAGAAACCATCCCT
TCACTACATCATTCTATGTTTCGAGAAAGGTTACGGTGAGGAGTATGGTG
GAAGTACTTGCATTGTACGGAACACGCATGCGCACAAAAACATCACCCTT
TCCTACCTTGACGTCATCCCATATTTCGCGCGTGTTTATCTGCACACGTT
GAAATTACAAGTTAATGGTGTTCAAATAAAACCAGTGACGGATTTGAAAT
CTTCTTATATTTTGGTCCACAAATACACAACTGACTTGGTTAAGTTCCCT
TTTGATGTTCAAGTGAAGATGAAAAATCGAGCAACAGATTGACGGTTTGA
ATCCGAATCATTTCGAAAAGAAAATTATTTTGGTCAGTGGGAAAGACGTT
GAATATGCAGTATTTGATCTTACTAAGAAAGGATGGAATCTGAGATCGTT
ATTTGGAGGTGTGATTACCTCAAGATGTCCTTTGGCAAGAAACAGTCAGG
TCATCATTCATACAGACAAGGCTGGCGACTGTTCAAAATTAGCATTAGAA
TATAAACAAAGTGTTGCATCAGTTTTTGATCCACACCACAGAGGCTTTAA
CGGAGGTGGGACTAGCAAGCTTGTTGAATGCAGTGAAGTTATATGACTCT
TCTTATCATTCGCTAGCTGTTCACCTTAGGTCTGTCTGTCAGCGTTGATA
AAAACTGGTCTGGATTAGTTCACTCACTTTCTGGCCAATTCTGCTCCTCC
ATCAATTTCATCAGTAAAGCAGAAACTACATCGCCAGAATTTTCGTTCAA
ACCACTGGGTGTGTGGCCTGAAGATACATTATCACCTCGACAACACCTCA
GATATGCCACCATCCCCAGGGAAACAGTGTGCACAGAAAATTTGACACCA
TGGAAGAAGATGTTGCCTTGTGGTAACAGTGGTGGCCTCCACATTACAAC
TTCTTTCCAAAGTCTTTTGGTGAGATCCTCAGCAAATTTGGCATTGTAGA
ATTACATTTCTCGATGACACAAGGTCGATGGAGGCACAATAAATGGGGAT
ATCCCTTGGATAGCGCACCGACGGGTGTTGAACTGTGGGTCTGGTTCCAC
CCCAATCTAAACTCAAGTGTATGGAAAATTTGAACATTATTTTTTTATTG
GTCATTTTGCTCTTTGATAAGCAAGAATGTGCTCCATCAGATGTGTATGA
CGAGGAGCTGTCAATCAAGCAATTACAAAGTGGTCATGTTTATTCCCAAT
TTCAATTTGTTACAACATGGAACGTCAATGTGTTTGAGCAACAAATTCCA
TCCTTCCCATCATACTCCACGATATCTGAATTTGGTACGACCAGTGATGA
AATGGTTTTCCGACGTATTTATTCCGAACCTTTACTCCTTCGGATACCGT
TACCCGATTTTAGTATGCCCTACAACGTCATTTGTCTGACGTGTACCGTC
ATTGCAATCGGGTTCGGATCTATTTATAATTTAACAACACGGACTTTTCA
AGTTGAAGAGGTCAAGGAAAAACGAACTTTAAAAGAGAAAATTTTAGGGT
TGTTCCGGAAAACAGAAACGCTGGAAAATGAAGAAGAAGAGAATTCCGAT
GGATAACAATTTGAAGTACACACCATGCTATCATCGAGAACGACCAGCAA
AGTTGGAATTTCTTTTTACCATACCTCCACAAAGTGACGTCACCATTTCC
ATCCAGTTTGAGAAGATCTTTCAAGATTGGATGCAGCACCCACCGGATTC
TCATCATGGTTTCTACATGTCATCTTCAGTCATCAGTGGCATAGTTCCTT
TTCATGAAGAGCTTGTAGAAACCATCCCTTCACTACATCATTCTATGTTT
CGAGAAAGGTTACGGTGAGGAGTATGGTGGAAGTACTTGCATTGTACGGA
ACACGCATGCGCACAAAAACATCACCCTTTCCTACCTTGACGTCATCCCA
TATTTCGCGCGTGTTTATCTGCACACGTTGAAATTACAAGTTAATGGTGT
TCAAATAAAACCAGTGACGGATTTGAAATCTTCTTATATTTTGGTCCACA
AATACACAACTGACTTGGTTAAGTTCCCTTTTGATGTTCAAGTGAAGATG
AAAAATCGAGCAACAGATTGACGGTTTGAATCCGAATCATTTCGAAAAGA
AAATTATTTTGGTCAGTGGGAAAGACGTTGAATATGCAGTATTTGATCTT
ACTAAGAAAGGATGGAATCTGAGATCGTTATTTGGAGGTGTGATTACCTC
AAGATGTCCTTTGGCAAGAAACAGTCAGGTCATCATTCATACAGACAAGG
CTGGCGACTGTTCAAAATTAGCATTAGAATATAAACAAAGTGTTGCATCA
GTTTTTGATCCACACCACAGAGGCTTTAACGGAGGTGGGACTAGCAAGCT
TGTTGAATGCAGTGAAGTTATATGACTCTTCTTATCATTCGCTAGCTGTT
CACCTTAGGTCTGTCTGTCAGCGTTGATAAAAACTGGTCTGGATTAGTTC
ACTCACTTTCTGGCCAATTCTGCTCCTCCATCAATTTCATCAGTAAAGCA
GAAACTACATCGCCAGAATTTTCGTTCAAACCACTGGGTGTGTGGCCTGA
AGATACATTATCACCTCGACAACACCTCAGATATGCCACCATCCCCAGGG
AAACAGTGTGCACAGAAAATTTGACACCATGGAAGAAGATGTTGCCTTGT
GGTAACAGTGGTGGCCTCCACATTACAACTTCTTTCCAAAGTCTTTTGGT
GAGATCCTCAGCAAATTTGGCATTGTAGAATTACATTTCTCGATGACACA
AGGTCGATGGAGGCACAATAAATGGGGATATCCCTTGGATAGCGCACCGA
CGGGTGTTGAACTGTGGGTCTGGTTCCACCCCAATCTAAACTCAAGTGTA
TGGAAAATTTGAACATTATTTTTTTATTGGTCATTTTGCTCTTTGATAAG
CAAGAATGTGCTCCATCAGATGTGTATGACGAGGAGCTGTCAATCAAGCA
ATTACAAAGTGGTCATGTTTATTCCCAATTTCAATTTGTTACAACATGGA
ACGTCAATGTGTTTGAGCAACAAATTC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045848XLOC_045848Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073829-exon-scaffold_98-1575043694:219755..219918TCONS_00073829-exon-scaffold_98-1575043694:219755..219918Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:213413..213592TCONS_00073829-exon-scaffold_98-1575043694:213413..213592Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:212272..212455TCONS_00073829-exon-scaffold_98-1575043694:212272..212455Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:211719..211962TCONS_00073829-exon-scaffold_98-1575043694:211719..211962Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:211421..211507TCONS_00073829-exon-scaffold_98-1575043694:211421..211507Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:208038..208122TCONS_00073829-exon-scaffold_98-1575043694:208038..208122Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:207327..207415TCONS_00073829-exon-scaffold_98-1575043694:207327..207415Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:201597..201690TCONS_00073829-exon-scaffold_98-1575043694:201597..201690Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:201044..201097TCONS_00073829-exon-scaffold_98-1575043694:201044..201097Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:200645..200692TCONS_00073829-exon-scaffold_98-1575043694:200645..200692Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:199689..199844TCONS_00073829-exon-scaffold_98-1575043694:199689..199844Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:198816..199068TCONS_00073829-exon-scaffold_98-1575043694:198816..199068Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:197560..197835TCONS_00073829-exon-scaffold_98-1575043694:197560..197835Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1575043694:196520..197269TCONS_00073829-exon-scaffold_98-1575043694:196520..197269Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:219755..219918TCONS_00073829-exon-scaffold_98-1510915933:219755..219918Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:213413..213592TCONS_00073829-exon-scaffold_98-1510915933:213413..213592Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:212272..212455TCONS_00073829-exon-scaffold_98-1510915933:212272..212455Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:211719..211962TCONS_00073829-exon-scaffold_98-1510915933:211719..211962Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:211421..211507TCONS_00073829-exon-scaffold_98-1510915933:211421..211507Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:208038..208122TCONS_00073829-exon-scaffold_98-1510915933:208038..208122Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:207327..207415TCONS_00073829-exon-scaffold_98-1510915933:207327..207415Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:201597..201690TCONS_00073829-exon-scaffold_98-1510915933:201597..201690Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:201044..201097TCONS_00073829-exon-scaffold_98-1510915933:201044..201097Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:200645..200692TCONS_00073829-exon-scaffold_98-1510915933:200645..200692Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:199689..199844TCONS_00073829-exon-scaffold_98-1510915933:199689..199844Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:198816..199068TCONS_00073829-exon-scaffold_98-1510915933:198816..199068Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:197560..197835TCONS_00073829-exon-scaffold_98-1510915933:197560..197835Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1510915933:196520..197269TCONS_00073829-exon-scaffold_98-1510915933:196520..197269Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:219755..219918TCONS_00073829-exon-scaffold_98-1491911889:219755..219918Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:213413..213592TCONS_00073829-exon-scaffold_98-1491911889:213413..213592Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:212272..212455TCONS_00073829-exon-scaffold_98-1491911889:212272..212455Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:211719..211962TCONS_00073829-exon-scaffold_98-1491911889:211719..211962Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:211421..211507TCONS_00073829-exon-scaffold_98-1491911889:211421..211507Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:208038..208122TCONS_00073829-exon-scaffold_98-1491911889:208038..208122Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:207327..207415TCONS_00073829-exon-scaffold_98-1491911889:207327..207415Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:201597..201690TCONS_00073829-exon-scaffold_98-1491911889:201597..201690Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:201044..201097TCONS_00073829-exon-scaffold_98-1491911889:201044..201097Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:200645..200692TCONS_00073829-exon-scaffold_98-1491911889:200645..200692Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:199689..199844TCONS_00073829-exon-scaffold_98-1491911889:199689..199844Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:198816..199068TCONS_00073829-exon-scaffold_98-1491911889:198816..199068Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:197560..197835TCONS_00073829-exon-scaffold_98-1491911889:197560..197835Clytia hemisphaericaexon
TCONS_00073829-exon-scaffold_98-1491911889:196520..197269TCONS_00073829-exon-scaffold_98-1491911889:196520..197269Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073829-proteinTCONS_00073829-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_98supercontigscaffold_98:196520..219918 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
10.7405 10.6674 3.16666 1.25087 8.04946 6.17084 6.96957 5.54581 6.5313 6.6872 8.07434 5.24527 6.01797 5.4251 4.88031 6.45608 14.1735 12.0692 1.63568 5.43911 0.704891 4.61318 0.00226911 7.36783 0 0 3.20603 0.0258007 3.84589 5.5426
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007245PIG-T
Vocabulary: Biological Process
TermDefinition
GO:0016255attachment of GPI anchor to protein
Vocabulary: Cellular Component
TermDefinition
GO:0042765GPI-anchor transamidase complex
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016255 attachment of GPI anchor to protein
cellular_component GO:0042765 GPI-anchor transamidase complex
Blast
BLAST of TCONS_00073829 vs. Swiss-Prot (Human)
Match: PIGT (GPI transamidase component PIG-T OS=Homo sapiens GN=PIGT PE=1 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 2.811e-125
Identity = 224/560 (40.00%), Postives = 318/560 (56.79%), Query Frame = 2
Query:  230 PSDVYDEELSIKQLQSGHVYSQFQFVTTWNVNVFEQQIPPHYNFFPKSFGEILSKFGIVELHFSMTQGRWRHNKWGYPLDSAPTGVELWVWFHPNLNSSVVDKNWSGLVHSLSGQFCSSINFISKAETTSPEFSFKPLGVWPEDTLSPRQHLRYATIPRETVCTENLTPWKKMLPCGNSGGVGLASLLNAVKLYDSSYHSLAVHLRSVCQAGDCSKLALEYKQSVASVFDPHHRG-FNGGWNLRSLFGGVITSRCPLARNSQVIIHTDKIDGLN--------PNHFEKKIILVSGKDVEYAVFDLTKKDLVKFP--FDVQVKMKNRATVTDLKSSYILVHKXXXXXXXXXXXSTCIVRNTHAHKNITLSYLDVIPYFARVYLHTLKLQVNGVQIKPDNLKYTPCYHRERPAKLEFLFTIPPQSDVTISIQFEKIFQDWMQHPPDSHHGFYMSSSVISGIVPFHEELVETIPS--LHHSMFRERFGTTSDEMVFRRIYSEPLLLRIPLPDFSMPYNVICLTCTVIAIGFGSIYNLTTRTFQVEEVKEKRTLKEKILGLFRK 1870
            P D   EEL I  L SG V + FQF T W+  +  + +  HY  FPK+ G+++SK+ + ELH S TQG WR   WG P   AP+G ELWVWF   +    VDK+W  L + LSG FC+S+NFI    T +P  SFKPLG+   DT      LRYA +PRE VCTENLTPWKK+LPC  S   GL+ LL A +L+ +SYHS AVH+R VC+   C+ ++ E +Q+++ VFD    G     W+L  +F   +T  CPLA  S+V +     +  N        P    + +IL  G    YA++DL    ++      ++Q+K K           ++   +Y +GYG + G  + ++ NTH ++   +  LD +P++ R+Y+HTL +   G + KP  + Y P   R +P  LE L  +P  S   +SIQFE+    W ++ PD +HGFY+S SV+S +VP    +V   P       +F   F  +     F R+Y+EPLL+ +P PDFSMPYNVICLTCTV+A+ +GS YNL TRTF +EE +    L +++  L R+
Sbjct:   26 PRDSLREELVITPLPSGDVAATFQFRTRWDSELQREGVS-HYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTVTD--VDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGL-ANDT--DHYFLRYAVLPREVVCTENLTPWKKLLPC--SSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSISWELRQTLSVVFDAFITGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITTYNQDNETLEVHPPPTTTYQDVIL--GTRKTYAIYDLLDTAMINNSRNLNIQLKWKRPPENEAPPVPFLHAQRYVSGYGLQKGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQDRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVP---SMVAAKPVDWEESPLFNSLFPVSDGSNYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCYGSFYNLLTRTFHIEEPRTG-GLAKRLANLIRR 571          
The following BLAST results are available for this feature:
BLAST of TCONS_00073829 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PIGT2.811e-12540.00GPI transamidase component PIG-T OS=Homo sapiens G... [more]
back to top