Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073520 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073520
Unique NameTCONS_00073520
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2342

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073520 ID=TCONS_00073520|Name=TCONS_00073520|organism=Clytia hemisphaerica|type=transcript|length=2342bp
gtttgtttacattcattcaattttacgtacatgttcTTCTTTCGTTTTGT
GCATTGTTGGTCGATAGTTGTGCTGGTTGTATATTTTAACCAGAGCTAAA
CATGACATTAATACATACTGTCAAGATTTTTCTAACTTGGGGAAGTACTT
GCTATCTTTTGTTGTGATTTAAAAGACTACGTACTACCAAAACTAATGTA
TATACAACATCCCAAACATCCCCGCGTAAATCAGATTTTGCCCGAAAAAT
CTTGTTTCTCCTGTCGTGTTGTTAAACTTCCACTGGATATAGACCTTTTC
GATAGTTCCATGACCATATTGAAAAGTATAGACAAAATAGCAACTATTGC
TAAAGGTGTATTTTACTTAGAGAAAGTAGACGTTTATATCTTTGTGAGAA
GCTGTCGTGCTGCTTCTTAAAGAGAAGGGAGATTTTATTCTGTTGATTTG
CTGGCTTACAGAATGTTTAGAAATAGTGATACTGCTCTACTTATGACTTT
TGTAAAATAACTGATTTGGGTTCTTTGCAAAATGTtgtaaacaaatcaaa
aacacaaaacatGACCCACATTGAAAGTTGAATAAAATGAGGACCAACAA
GTTCAATCatgcatcaaattttaaatacttaaaaagagaattttcaaaaa
tttgtctgggtcttgttttttttttatactcAACGTTGGTGTATtactaa
atgtaaacaaaacaggCGAACAAATCTTTAATTCACCAAATTGTGATGAG
AGACTTAACTTTCTTAAtcagatttgaaaatttgatattgttATGTCAGC
TTCTTTCTTTTCCCAAAATAATGAAAGCTATCTTTTTATTTTAGGCAATC
GATTATGAATTGTACAGCATTGTTTTTACATCCCCGGAAACAATTTTGGA
GAAGAATCGGAATATTCTGAAACAAAATCAATTCACCAAACGTATTGTCG
GTATTGCTGTTGATGAAAGTCACTGTGTTAAGAAATGagGAGAAGGTGAT
AAAGATTCTAATGCTTTTCGTAAATGGTACGGAAGATTGTCAGAAATTCG
ATCATTTTTATCAGCAGAAACACCCATGATAGCTATGACAGCCACAGCAA
CCTCAAGTGTACGTCAAGATATAATCGACAGTCTGGAGCTGTATCAACCC
TATATTTCTGTGGCTGTTCCATTTAAGCCAAATGTCAAGTATTTCCTACA
CTGCAATTCAACAAGAAATGTTGAACAGATTTTTTTGCCTTATGTCAAGG
ACATTCAGAACAATGGCTTTGAGGCTGAACGTGTAATTGTTTTTTGTCGG
ACGTCCCACCTTCTAAGGAAACTATTTGCTTTATTTGATGGCAAGTTCTC
GTCAAATTATCCTGACCTCCTGGTAAGACCATATGCACGCTACCATGCCC
ATACCGACGATGAAGTTAAAGCTATGATTAACGATTCGTTGGCACAGCCT
TATGGAAAAGTTCGCTTCTTGATGGCATCAATCGCTTTTGGTATGGGGGT
TGATTGTAAAGGACTTTACACCGTAATCCATTTTGGAGCCCCTAGTGATA
TTGATGATTATTTCCAAGAATCAGGAAGAGTTGGTCGGGATGGAGCCCAA
AGTCAAGCCATTTTGTTGACATCCCTCGCTGTCTAATATCACCCAATATA
TCAAAAGCCATGAAAGAATATtgtaaaaatacagaaaaatgcAGAAGACA
AATTTTGATGGGACAATACAGCACTGATTCGTTCAATATCACACCACTCC
ACCTCTGTTGTGATGTATGTGAAAAAAACTGTGAATGTGGCCAAAAAGAC
TGCCAGTCTTACAGATTGACCACCTTTGAAGTAAATGAAGAGACTCTCCT
GGTACCCAAAGAATGTTCTTTGAATTCTGATGGCATTCAGATTACAAATG
AACTATCTAAATTGAGAAAGTCGTTACTAGTTGTCAGCAATGTCATTTCA
CCAAGTATTTCCTCAGGATTCCCTCTTGAAGCTGTTGATGAAATTGTGAG
TATAGCTTCAAAAACTGTCACTGAGGAGGATCTATACACAAAGACTACAC
TAATGAATCAAGAAATGATTCCTAgagttttggaaattttgacacGAGCT
GTGAACtctttgaaatgaaaaactACGACGATGAATACTATTTTTCAAGT
GATGATAATGAATCAGATTCTGAAAACGAAAATAGACGCTATCGATTCGG
CAATAGTTCTCTTACTGAGAGTGACAGTgattaaaatacttttttatccC
AATTGACTATAGCATTATActgctttattttcttttttatttgaatattt
tttatttctgatttcTGATTGGTCACTAATACTTATCCATGT
Run BLAST on NCBI

protein sequence of TCONS_00073520-protein

>TCONS_00073520-protein ID=TCONS_00073520-protein|Name=TCONS_00073520-protein|organism=Clytia hemisphaerica|type=polypeptide|length=186bp
MIAMTATATSSVRQDIIDSLELYQPYISVAVPFKPNVKYFLHCNSTRNVE
QIFLPYVKDIQNNGFEAERVIVFCRTSHLLRKLFALFDGKFSSNYPDLLV
RPYARYHAHTDDEVKAMINDSLAQPYGKVRFLMASIAFGMGVDCKGLYTV
IHFGAPSDIDDYFQESGRVGRDGAQSQAILLTSLAV
Run BLAST on NCBI

transcript from alignment at scaffold_94:11756..14718+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073520 ID=TCONS_00073520|Name=TCONS_00073520|organism=Clytia hemisphaerica|type=transcript|length=2963bp|location=Sequence derived from alignment at scaffold_94:11756..14718+ (Clytia hemisphaerica)
gtttgtttacattcattcaattttacgtacatgttcTTCTTTCGTTTTGT GCATTGTTGGTCGATAGTTGTGCTGGTTGTATATTTTAACCAGAGCTAAA CATGACATTAATACATACTGTCAAGATTTTTCTAACTTGGGGAAGTACTT GCTATCTTTTGTTGTGATTTAAAAGACTACGTACTACCAAAACTAATGTA TATACAACATCCCAAACATCCCCGCGTAAATCAGATTTTGCCCGAAAAAT CTTGTTTCTCCTGTCGTGTTGTTAAACTTCCACTGGATATAGACCTTTTC GATAGTTCCATGACCATATTGAAAAGTATAGACAAAATAGCAACTATTGC TAAAGGTGTATTTTACTTAGAGAAAGTAGACGTTTATATCTTTGTGAGAA GCTGTCGTGCTGCTTCTTAAAGAGAAGGGAGATTTTATTCTGTTGATTTG CTGGCTTACAGAATGTTTAGAAATAGTGATACTGCTCTACTTATGACTTT TGTAAAATAACTGATTTGGGTTCTTTGCAAAATGTtgtaaacaaatcaaa aacacaaaacatGACCCACATTGAAAGTTGAATAAAATGAGGACCAACAA GTTCAATCatgcatcaaattttaaatacttaaaaagagaattttcaaaaa tttgtctgggtcttgttttttttttatactcAACGTTGGTGTATtactaa atgtaaacaaaacaggCGAACAAATCTTTAATTCACCAAATTGTGATGAG AGACTTAACTTTCTTAAtcagatttgaaaatttgatattgttATGTCAGC TTCTTTCTTTTCCCAAAATAATGAAAGCTATCTTTTTATTTTAGGCAATC GATTATGAATTGTACAGCATTGTTTTTACATCCCCGGAAACAATTTTGGA GAAGAATCGGAATATTCTGAAACAAAATCAATTCACCAAACGTATTGTCG GTATTGCTGTTGATGAAAGTCACTGTGTTAAGAAATGGTATGATGATTGG TACTATTTCAgactgttttttattttgatgactTTACCCTATTGTGAAAG TCGTAAAAATGTAAGATTTGCATTATCTTTAAGGTGATTATTCACAACTT TTTAAAGGATAGGAAGGAACTTGTGTAGTTAATTTTACTACAATAGGTGT ATattgaaaatagtatttttctTGGTATATAGCTTTGACTAACATGatag actttttttcaaaaaggacgtcctattgaataattatgtagtccagccat aaaaacaatgatagagccatgcataattaatgtatcatgcatattgtaat aattatatgcatggttttatcattgtttttctgctggacgacataattat tcaacagggtggcctctttgaaaaaaggtctattgaccaagcaaagaaaa agaaatcatcTTTACATCATATCCTTAAATCTATTGGAAAGCTTTGAATA CCTTTGTTTAAAACAATACGAAAGataatcagcaaaatttcaccACCCAG AAAATTGACAACAAATTTTAAAAACGTTTATTTTCAGAAGAACACTATTG AATGATGAATAAATACCaaagattttttctaaattctattaatttctatt tttttcagagGAGAAGGTGATAAAGATTCTAATGCTTTTCGTAAATGGTA CGGAAGATTGTCAGAAATTCGATCATTTTTATCAGCAGAAACACCCATGA TAGCTATGACAGCCACAGCAACCTCAAGTGTACGTCAAGATATAATCGAC AGTCTGGAGCTGTATCAACCCTATATTTCTGTGGCTGTTCCATTTAAGCC AAATGTCAAGTATTTCCTACACTGCAATTCAACAAGAAATGTTGAACAGA TTTTTTTGCCTTATGTCAAGGACATTCAGAACAATGGCTTTGAGGCTGAA CGTGTAATTGTTTTTTGTCGGACGTCCCACCTTCTAAGGAAACTATTTGC TTTATTTGATGGCAAGTTCTCGTCAAATTATCCTGACCTCCTGGTAAGAC CATATGCACGCTACCATGCCCATACCGACGATGAAGTTAAAGCTATGATT AACGATTCGTTGGCACAGCCTTATGGAAAAGTTCGCTTCTTGATGGCATC AATCGCTTTTGGTATGGGGGTTGATTGTAAAGGACTTTACACCGTAATCC ATTTTGGAGCCCCTAGTGATATTGATGATTATTTCCAAGAATCAGGAAGA GTTGGTCGGGATGGAGCCCAAAGTCAAGCCATTTTGTTGACATCCCTCGC TGTCTAATATCACCCAATATATCAAAAGCCATGAAAGAATATtgtaaaaa tacagaaaaatgcAGAAGACAAATTTTGATGGGACAATACAGCACTGATT CGTTCAATATCACACCACTCCACCTCTGTTGTGATGTATGTGAAAAAAAC TGTGAATGTGGCCAAAAAGACTGCCAGTCTTACAGATTGACCACCTTTGA AGTAAATGAAGAGACTCTCCTGGTACCCAAAGAATGTTCTTTGAATTCTG ATGGCATTCAGATTACAAATGAACTATCTAAATTGAGAAAGTCGTTACTA GTTGTCAGCAATGTCATTTCACCAAGTATTTCCTCAGGATTCCCTCTTGA AGCTGTTGATGAAATTGTGAGTATAGCTTCAAAAACTGTCACTGAGGAGG ATCTATACACAAAGACTACACTAATGAATCAAGAAATGATTCCTAgagtt ttggaaattttgacacGAGCTGTGAACtctttgaaatgaaaaactACGAC GATGAATACTATTTTTCAAGTGATGATAATGAATCAGATTCTGAAAACGA AAATAGACGCTATCGATTCGGCAATAGTTCTCTTACTGAGAGTGACAGTg attaaaatacttttttatccCAATTGACTATAGCATTATActgctttatt ttcttttttatttgaatattttttatttctgatttcTGATTGGTCACTAA TACTTATCCATGT

Coding sequence (CDS) from alignment at scaffold_94:11756..14718+

>TCONS_00073520 ID=TCONS_00073520|Name=TCONS_00073520|organism=Clytia hemisphaerica|type=CDS|length=561bp|location=Sequence derived from alignment at scaffold_94:11756..14718+ (Clytia hemisphaerica)
ATGATAGCTATGACAGCCACAGCAACCTCAAGTGTACGTCAAGATATAAT
CGACAGTCTGGAGCTGTATCAACCCTATATTTCTGTGGCTGTTCCATTTA
AGCCAAATGTCAAGTATTTCCTACACTGCAATTCAACAAGAAATGTTGAA
CAGATTTTTTTGCCTTATGTCAAGGACATTCAGAACAATGGCTTTGAGGC
TGAACGTGTAATTGTTTTTTGTCGGACGTCCCACCTTCTAAGGAAACTAT
TTGCTTTATTTGATGGCAAGTTCTCGTCAAATTATCCTGACCTCCTGGTA
AGACCATATGCACGCTACCATGCCCATACCGACGATGAAGTTAAAGCTAT
GATTAACGATTCGTTGGCACAGCCTTATGGAAAAGTTCGCTTCTTGATGG
CATCAATCGCTTTTGGTATGGGGGTTGATTGTAAAGGACTTTACACCGTA
ATCCATTTTGGAGCCCCTAGTGATATTGATGATTATTTCCAAGAATCAGG
AAGAGTTGGTCGGGATGGAGCCCAAAGTCAAGCCATTTTGTTGACATCCC
TCGCTGTCTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045634XLOC_045634Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073520-proteinTCONS_00073520-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073520-exon-scaffold_94-1491911889:11756..12742TCONS_00073520-exon-scaffold_94-1491911889:11756..12742Clytia hemisphaericaexon
TCONS_00073520-exon-scaffold_94-1510915933:11756..12742TCONS_00073520-exon-scaffold_94-1510915933:11756..12742Clytia hemisphaericaexon
TCONS_00073520-exon-scaffold_94-1575043694:11756..12742TCONS_00073520-exon-scaffold_94-1575043694:11756..12742Clytia hemisphaericaexon
TCONS_00073520-exon-scaffold_94-1491911889:13364..14718TCONS_00073520-exon-scaffold_94-1491911889:13364..14718Clytia hemisphaericaexon
TCONS_00073520-exon-scaffold_94-1510915933:13364..14718TCONS_00073520-exon-scaffold_94-1510915933:13364..14718Clytia hemisphaericaexon
TCONS_00073520-exon-scaffold_94-1575043694:13364..14718TCONS_00073520-exon-scaffold_94-1575043694:13364..14718Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_94supercontigscaffold_94:11756..14718 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.482351 0.502807 0.30132 0.27637 0.89721 0.762161 0.919515 1.12109 0.490565 0.590282 0.606645 0.620331 0.553097 0.72374 1.32225 1.32776 1.01138 1.04943 0.17681 0.629065 0.916647 0.517704 0.629337 0.641512 0.142863 0.127502 0.570171 0.267741 0.793827 0.338561
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
Blast
BLAST of TCONS_00073520 vs. Swiss-Prot (Human)
Match: WRN (Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 6.598e-27
Identity = 87/257 (33.85%), Postives = 135/257 (52.53%), Query Frame = 2
Query:  863 YSIVFTSPETILEKNRNILKQNQFTKRIVGIAVDESHCVKK*GEGDKDSNAFRKWYGRLSEIRSFLSAETPMIAMTATATSSVRQDIIDSLELYQPYISVAVPFKPNVKYFLHCNSTRNVEQIFLPY-VKDIQNNGFEAERVIVFCRTSHLLRKLFALFDGKFSSNYPDLLVRPYARYHAHTDDEVKAMINDSLAQPYGKVRFLMASIAFGMGVDCKGLYTVIHFGAPSDIDDYFQESGRVGRDGAQSQAILLTSLA 1630
            Y IV+ +PE     N  +L+Q +    I  IAVDE+HC+ + G   +DS  FRK    L  +++ L    P++A+TATA+SS+R+DI+  L L  P I+     +PN+ Y      T N+ Q   P+ VK   +  FE    I++C +    RK+     G+        L      YHA      +  I+    +   +++ ++A+IAFGMG++   +  VIH+GAP D++ Y+QE GR GRDG QS   +L + A
Sbjct:  636 YRIVYVTPE-YCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDS--FRK----LGSLKTALPM-VPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNL-YLEVRRKTGNILQDLQPFLVKTSSHWEFEGP-TIIYCPS----RKMTQQVTGELRK-----LNLSCGTYHAGMSFSTRKDIHHRFVR--DEIQCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDGLQSSCHVLWAPA 871          
The following BLAST results are available for this feature:
BLAST of TCONS_00073520 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
WRN6.598e-2733.85Werner syndrome ATP-dependent helicase OS=Homo sap... [more]
back to top