Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073462 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073462
Unique NameTCONS_00073462
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2003

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073462 ID=TCONS_00073462|Name=TCONS_00073462|organism=Clytia hemisphaerica|type=transcript|length=2003bp
GTTGAATGAGACAGATCTTAATCAGTTATGGTCTAAATAGCTCATTGACC
AAATGTTTACCGAGCTCATCACTCATTCGGAAGAAGAGTTACAGTGCTTT
CCCTATCACGGGAATATTTCAGTTTAATAGTCGGACCAAGGCTAGAATCT
TGCTTCTTCCGAACCTTGGTGCGTTTAGCAATGGAATCAATTTCAAATTG
GCGGACAATTCTGatattttgtctttattgttgaATGTTTTGGAAAATCT
AAAGTAAATTCCAATTTTGGATCATTTGCAATCTCGTTCAGAATGCATca
atgaaatcaaagaaagatGAATAGGTATCATCAAGCCAGGACTCTGGAAA
AAAGAGTCAAATTATACAAGGCACAAGAGCAAGAATCTGGAGGAGAGCCA
GCTTGGAAAGATCTTGGAGTTGGTGATATCAATATAGTACCAAATTCTGA
TTCTGATTATTTTAGAAGCAACTATTATGGGGGAATGATTATGCTGATGA
ATTCAGAAGAAGATGgttcAGTCATCTTTAGAAATCCTGTCTCAACTAGA
GTTCAATATCAGGAACAAGGGgaTGTCATAATTCTCTGGACAGAAGTCGA
TGGCCCGAAAGAAACATTTGCGCTTAGTTTTATGGACCAAGAAAATAGGG
ATGATTTTTTAACTCATATTGAGGAGACTAAATTGAAATTGGAACGTAGT
GATAAAAATGGGGATGCTTACAAAGGTCTGGATGACCAAGATTTTGATAT
GCACGGCCAAGGTCTTGGTATGGATTTGAGCTCAGAAGAAAGTCTTGCCA
TTCCTCCTTGCGAATTCAGCAAACTTAATGCCTTGAATGAAACATTACAA
CGTTATTTACAAAGCAAAAATCTCCATGATGATCTAGTAACACTTTTAGA
AGCCCAAGGATATATTCCAAAGTTGATAGAGATTTTTCATATGTGCGAAG
ACCTGGAAAATACTGACGCACTTCATACACTTTATAGTATTTTCAAGACT
TTATTCATGTTGgaaaaaaatgcaatatttgaaACGATGTTTTCTCAAGA
GTACATTTTGGATATTGTTGGTATACTTGAGTACGATCCTTCAAAGACGA
CGCGGACACCTCATAGAGAGCATATCAATGATCGTGTCCAATTTAAAGAA
GTGATTCCAATTGCAAACAAAGAACTACTTGCTAAGATCCATCAGACTTT
TCGAGTTCAGTATATAAAAGACATTTTAATTCCTGTGCCATTGATTTTTG
ATGAGACTGGTACAACGCTGAGTTCCtttattttcttcaataaaGTCCAA
ATTATTGACCTAATAAAGGAGGATCAACATTTTCTTGATGAGTTGTTCGA
ACAATTGACGAATGATGAAGTATCTGATGACAAAAGGAAAGACATTatTC
TTCTATTGAAAGAACTTTGTGTTTATTCGCAATCGCTGCAACCAGCAAGA
CGAGAAGAATTCATCAAAATGTTGGCAAATATTGGAATGTTGCAGTCTAT
CGAACAACTCTTGAACATAGATGACAAAGACATCCAGCAAGCATTAATAG
ACATTGTTTGCACCATCACTGAGTGTACTCCATCCATCATTCGAATCTAT
GTTTGCCGTGAAGCATCTTACACCATTGACGAGGATACAATGATGTTGAA
CGTCATGATCAGTCATCTCGTCAACTGTGAAACTGAAGGTATGAGTGTCA
TCCTACTGCAGACCCTACAAACGTTGCTGGACCCTGAAAACATGTGTCAA
ACGGCTAATagcACGATTGAACGTTCGGAATTCTTGAGTTTCTTTTATCG
TCACAACATGCACGTTCTGACGTCTCCCGTACTTGCTGTTACTGCCACGG
ATGAACTGGTCGGAAAAGACGACTTCCAGCGTGCGACAGTGTTTGACAAC
ATTGTGAACTTGTTGACTTTTTGCGTGGAACATCATCAATCTTCTATCAA
GAATTACATCGTCAGTAAAGATATGTTACGCCGTGTTCTCGTTCTTTTAC
ANN
Run BLAST on NCBI

protein sequence of TCONS_00073462-protein

>TCONS_00073462-protein ID=TCONS_00073462-protein|Name=TCONS_00073462-protein|organism=Clytia hemisphaerica|type=polypeptide|length=562bp
MNRYHQARTLEKRVKLYKAQEQESGGEPAWKDLGVGDINIVPNSDSDYFR
SNYYGGMIMLMNSEEDGSVIFRNPVSTRVQYQEQGDVIILWTEVDGPKET
FALSFMDQENRDDFLTHIEETKLKLERSDKNGDAYKGLDDQDFDMHGQGL
GMDLSSEESLAIPPCEFSKLNALNETLQRYLQSKNLHDDLVTLLEAQGYI
PKLIEIFHMCEDLENTDALHTLYSIFKTLFMLEKNAIFETMFSQEYILDI
VGILEYDPSKTTRTPHREHINDRVQFKEVIPIANKELLAKIHQTFRVQYI
KDILIPVPLIFDETGTTLSSFIFFNKVQIIDLIKEDQHFLDELFEQLTND
EVSDDKRKDIILLLKELCVYSQSLQPARREEFIKMLANIGMLQSIEQLLN
IDDKDIQQALIDIVCTITECTPSIIRIYVCREASYTIDEDTMMLNVMISH
LVNCETEGMSVILLQTLQTLLDPENMCQTANSTIERSEFLSFFYRHNMHV
LTSPVLAVTATDELVGKDDFQRATVFDNIVNLLTFCVEHHQSSIKNYIVS
KDMLRRVLVLLX
Run BLAST on NCBI

transcript from alignment at scaffold_92:136919..157075-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073462 ID=TCONS_00073462|Name=TCONS_00073462|organism=Clytia hemisphaerica|type=transcript|length=20157bp|location=Sequence derived from alignment at scaffold_92:136919..157075- (Clytia hemisphaerica)
GTTGAATGAGACAGATCTTAATCAGTTATGGTCTAAATAGCTCATTGACC AAATGTTTACCGAGCTCATCACTCATTCGGAAGAAGAGTTACAGTGCTTT CCCTATCACGGGAATATTTCAGTTTAATAGTCGGACCAAGGCTAGAATCT TGCTTCTTCCGAACCTTGGTGCGTTTAGCAATGGAATCAATTTCAAATTG GCGGACAATTCTGATATTTTGTCTTTATTGTTGAATGTTTTGGAAAATCT AAAGTAAATTCCAATTTTGGATCATTTGCAATCTCGTTCAGAATGCATCA ATGAAATCAAAGAAAGATGAATAGGTATCATCAAGCCAGGACTCTGGAAA AAAGAGTCAAATTATACAAGGCACAAGAGCAAGAATCTGGAGGAGAGCCA GCTTGGAAAGATCTTGGAGTTGGTGATATCAATATAGTACCAAATTCTGA TTCTGATTATTTTAGAAGCAACTATTATGGGGGAATGATTATGCTGATGA ATTCAGAAGAAGATGGTTAGTTTTATTTTCCACATTCTGTCGTTTTTAGC ATTTTTAGGCCATATTTTTCAACTGGCTCCAGTTGTTTCAGAAGTTTGAG TAGTTTTCTTTCAGATAATATATACAGGAGAAGCAGAAAGACCAAGAAAG GTGGTGGCTATAATCTAAAATTTTGTCAGTTAATGTTCTGTCTGTTTATG AGTTGAACATTAAAATTTCTTCTAGAAGTTATATTGATTTGATTGATTGC AACTGCATTGGGTGCAGTGTGTATTTTCAACTACTTTTCCTTACGTAAAT GTATATAAATGTTCTCTTTAAGATGTGCATTTCAAGTTTGTGTCCAATAT CCCATTTAATAATACCGCGAGTGGTCCTACATCCGACAGCACTGCCTAAA CCCCTATGGGGTCTTTCAAAGATATACAAACTAAAATAAAAACAAACCTC TCGCTGTGACGCAATGAAGATACCAAAGTCAGTCAGTACCTTTAGCCAAA TTAGGAACATTTTTCTTACTTTTACTAGTATTCCTAATTAGGAATCTTAT TCCTAATTAGGAAGAAAAAAATTCCTAATTAGGAAGAAATATTTAAAATT TTAATATCTCTGAAACAAGCTACATTCGCAAATTCCAAGTATGACCAATA GATTCGGTATACCAAATATGATAACTGTGAAAAAAATTTAAAAATTTCAT TCGCGGATGGTGGAATTATTAACGCCCCAAAAAAATAATTCCAAATTAGG AATTAAACGAACTGCTGTTTTTATTATCACGAAGAAAAACAGAAAGTGAG TTTCCCGCGTTTTATAAATAAGATGTCAATTTAGGAATTTACTACTGGGA GAAGTGAAGCTTTTTCTAGGGATTATAGCTCGGTCCCCCGAGCAAGTCAA GAGCTCAATCTTTCTTTCCCACCTAAATGGAATGGAATGGAATCTTATGA AGTACTTTTTAACGTGCGATTTTTTCTATTTTTGGAGAAAATCTAGGTAT TTGCTTCATATTCCTAATTAGGAATTTTTTTCTTCCTAATTAGGANTCCC ACCTAAATGGAATGGTAAGAATCTTATGAAGTACTTTTTAACGTGCGATT TTTTCTATTTTTGGAGAAAATCTAGGTATTTACTTCATATTCTTAATTAG GAATTTTTTTCTTCCTAATTAGGAATTAAGATTCCTAATTAGGAATACTA GTAAAAGTAAGAAAATGTTCCTAATTTGGCTAAAGGTACTGACTGAAAGT GTCAACTAAACTGAGAGATTTGATTCATTGAACCAATTGAACCAAATATA ACAATAATTGCTTTCTTATACAAAACATATAATCTTTTACTACAAAATTG TTAACGTTTTAATTTTAAACACACAAGCAACGGATTCAGAATAATAGATG TAATTATTTTTACAACTCACACTTTTTTTATCACATTAATTGACATCTTG AAATTATAGCCATCTTGTTAGATATTTTGTTTTGAGAGTTATTGGAATAT TTTAGTTTATTGTTCAACTTGGAGAGGGAATGTTTGTAAACATAGAATTT TTTTCATAGCAGTTATTTAGAGGGGGGGTGGAACTTAGGCATGGCTGTCA AATTTAGGCATGGCTGTCGGATTTAGGACCACTCACGCTATCCATGAAAC ATAACCAGACGGTATCAATCGAACAACTTCAAACAAAAAGTGCAATCGAA CGAATCGAACGTAATCGAATGCGATTCAATTGTTGAATGTAATCGAATCT CAGTCGAACTGCCGATTCCTGGGTAATATTCGATTGTGTTCGATCGCGTT CGAGTGAGGTTAGATTGGTTTGATAGTTGACTATGTTCGATTGTTTTGAT TGATTGTCGATTACATTCAATTACAGGCTTCGGCATATGAGGCGTGCGAT CGCACGTGCACGCCTCCACANTTTAATTTACTACTGGGAGAAGTGAAGCT TTTTCTAGGGATTATAGCTCGATCCCCCGAGCAAGTCAAGAGCTCAATCT TTCTTTCCCACCTAAATGGAATGGTAAGAATCTTATGAAGTACTTTTTAA CGTGCGATTTTTTCTATTTTTGGAGAAAATCTAGGTATTTACTTCATATT CTTAATTAGGAATTTTTTTCTTCCTAATTAGGAATTAAGATTCCTAATTA GGAATACTAGTAAAAGTAAGAAAATGTTCCTAATTTGGCTAAAGGTACTG ACTGAAAGTGTCAACTAAACTGAGAGATTTGATTCATTGAACCAATTGAA CCAAATATAACAATAATTGCTTTCTTATACAAAACATATAATCTTTTACT ACAAAATTGTTAACGTTTTAATTTTAAACACACAAGCAACGGATTCAGAA TAATAGATGTAATTATTTTTACAACTCACACTTTTTTTATCACATTAATT GACATCTTGAAATTATAGCCATCTTGTTAGATATTTTGTTTTGAGAGTTA TTGGAATATTTTAGTTTATTGTTCAACTTGGAGAGGGAATGTTTGTAAAC ATAGAATTTTTTTCATAGCAGTTATTTAGAGGGGGGGTGGAACTTAGGCA TGGCTGTCAAATTTAGGCATGGCTGTCGGATTTAGGACCACTCACGGTAT CCATGAAACATAACCAGACGGTGTCAATCGAACAACTTCAAACAAAAAGT GCAATCGAACGAATCAAACGTAATCGAATGCGATTCGATTGTTGAATGTA ATCGAATCTCAGTCGAACGACCGATTCCTGGGTAATATTCGATTGTGTTC GATCGCGTTCGAGTAAGGTTAGATTGGTTTGATAGTTGACTATGTTCGAT TGTTTTGATTGATTGTCGATTACATTCAATTACAGGCTTCGGCATATGAG GCGTGCGATCGCACGTGCACGCCTCCACACAAGCCCCAAAGGCACTGAGG CGTGCGATCAGGACATGGCTCCGCCCCCCACTTATTTGGGGGGGGTGTAA ATCTCAAATTGGCTTAAAAGTGGGTGGGAGCTGTCTCATTTTATAAATTC AGGGGGGGACCTAAAAAAGTGGGGGGAGCTGAAGGGCTACACTAAAGTTC TGGGGGGCTAATTAGGAAACTGTAAAATACCCCCTCACTATTGTTTTGGT TAATAAGTTATAGATTTTTCTATTGAATTTATTATCTCTTACATTCTATC AAAAAGTAGGCTAAAATGGCAGATTTCTACCCTTAAAATTCCAGAATTTT GTTGTTGCCCAACCATGGTGGGCAACATTTATTTAAATTTTCAATTTGGA ACCCAATTTTTTTTAACCCGTATTTTTATGATGTACATGAATTCTTTCTT CTCTTCCTCAGTTGGTTGACGTCCCATGTCGATACGTAAAAAAACTAGTA ATAATACTACCAGAAATGACAGTAGCTTTTTTTGCTGGGACCCGAACCTT GAAAGCAATTTTTGCAGGGACCTGAACCTTTATATTTCAACTGGGACCTG AAGCTTACTGAAAAGTGGGGGGACCTAAATCGTAGGGGGGACCTAAATTT GTTGGGGGGACCTAGAACCCCATTCGGAGCCATGGAGGAAAATATATAAA ATCAATTCAGGCGTGCGATGCATCGCACGTGCAGAAAAACTTCTTTAAAA AAGAAAGTTTCTTTCTTAATCTTTCCACGCTTTTCTCTCTGGCATCATAA AAGAAGAAACTCCCTTATTTGCTTGCCTTTTTGCTGAAGAGAAAATCTCT TCGTTAATTGTTGCTGAGTAATTTTTCTTTCTCTCTGGTTATTACGTCAT AACAAATGTTCGGTTCATTGCACATTTTTATTATCTTTAGTAACACCCTT CTCACAGGCCCGGTGGGATTTTTTCAGCCAGTGGGGGTAAAAATAACGGA CTAAAAGTCAACGGGGATTAATAATCCCATACTCTTTATTGCTGGGTATT TCAATTCTTTTGTCAAAAATTTCTCTTTGTTGAGGATTAAGAGATCTTAT ACGAGTATTTATTTCATTATCAGGAAGCAAAATAGATTCCATTCTCAACT TCAGTTGAGCTACAATCTGACAATGTCTGTCTGTCTGTGTGTGTGTGTGT GTGTCTGTCTGTCTGTCACAAAAACTTTAGGGCAGCCTGGAGACTTCAAA AATGCTTGGATTTGGCTGAAATTTGGCACACTTGTTCCTTGGGTGAATAT CTGGGGGTGCTTTTTTCGTTTTTTTTAAATTTTGATTTTTGGGGCCTGGG GACAAGTTTTCGTCAAAACAAGGCTAAAACTTTGGGGCAGCCTGGAGACT TCAAAAATGGTCGGATTTGGCTGGAATTTGGCACACTTGTTCCTTGGGTG AATATCTGGGGGTGTTTTTTTCGTTTTTCAAAAATTTTAATTTTTGGGAC CTGGGGACGAGTTTTTCTCCAAAACGAGGCTAAAACTTTTGGGCAGCCTG GAGACTTCAAAAATTGTTCGATTTGGCTGAAATTTGGCACACTTGTTTTT TGGGTGAATATCTGGGAGTTTTTTTTTCATTTTTCAAAAATTTTGATTTT TGGGGCCTGGGGACGAGTTCTTCTCCAAAACGAGGCTAAAACTTTGGGGC AGCCTGGAGACTTCAAAAATTGTTCGATTTGGCTGAAATTTTGCACACTT GTTCCTTAGGTGATTATCTGAGGACGTATTTCTTTTATTTTTCAAAATTT TTTAATTTTTGGGTCCTGGGGACGAGTTTTCGCCAAAACGAGGCTAAAAC TTTGGGGCAGCCTGGAGGCTTCAAAAATTGTTCAATTTGGCTGAAATTTT GCACACTTGTTCCTTGGGTGAATATCTGGGGTTCTACAATTGGGCCTATG ATTAGTTTGAAGGCACTGAAGTTGANNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACGAGTATTTATTT CATTATCAGGAAGCAAAATAGATTCCATTGGTATTGCTGCCCTAAATGGT ACTGTGTCTTCATTAGCTTCATCATCTGATTCATTATTATTATTTGCAGT ATTACTTTCAAGCTCAGCATTTGTTTCATCATTTTCCTGCTGTCATTCAT ATTGAGTGTGATGGGGATTTTACTTTATATCGCAAAGAGAAACACATTTT TAATCTGATTTTTTATGAAAACGCTTTTTCCTCTCGAATAAAAATTCGTT TTTCTGTTTGATTCAATCTTTGATATAAGAAAGCTTCTATGTAAACTCTT AAAATTATATAAAATGTATCTTTTATACCCTGTCTCACCTTCTAATGAGA GATAAAATAACTAATTTTACTTTAAAACTTCGCACGTTATCGCACGTCTA AAAGGATTGGGGCGTGCGACTCATCGCACAAAATTTTAATCTAGGCATGC GACGATCGCACGTCATCTTTTTTCTTATGCCGAAGCCTGTGATTAATCTT CGATTTAATTTGATTACGATTATGTTCGTTGAGTTTGAAATTGCGATTAG ATTAAATTGGATCACTCCATTGGAGCTGTGGGTGTGTGGTGTCTGTGGGT GGCCGAGTGGTAAGTACCGTACAAAAGCAAATAAAATCTAATACAATTGA ATTGAATCAATCGAACGTAATTGAAGCAATCGAACAGCAAATCCTGGGTA ATATTCGATTGCAATTCGATTGTGTTCAATTGCGTTCAATTGATTCGGCG TTTGATTTGTTCGATTGACACCGTCTGAACATAATCAACATATTGCTCAA CACGCGTTTGTAAGTTACACACTCGTTATTTGTTAATCCCATTGGGCGAT AGGCAGTTAGGTGGCAGGTGTTCTCTAATTCTCCAATCAGCGTCCGGTTA TTTTGAATGAAAGAAAAAAAGTGCGCTATCAGTGAAAGTTATCGTGACAT GTTATGGCAGAAAGTATGATTGATAAACTTGGTGGATTTACCAAAACAAA TTTGATGTCAAAGAGAACAGTAAGAGAAAATACAGGCCAGATATCAACAG CTCCATGTTTCGACCAATCGTCCCAAGTTAGAGCAGTTGATAGTACCACT GAATCTCCTTTGAGCGTGTTGTCAAATTTACAGAGCCTATTGCTAGATTG TAGGTTTGTTTGTAAGGTCTGTCATATGTGACCTTTACTTTATTCTATCA TATATGAAAGTATTGCATTTAAAAGCAACAGTGGTCAAAATAAGGTTTTT ACTTCTGGTCAGTTATTCTAGAGAATCAATTAGTCATGTTCAGTGTCACC CAAAAGCTGACCGGTTCACCCTGAGTGGCATGGATTTTAAAAGTTTGTCC TTTTGTTGGCTTTAAAACCCTTACTTTCATATCAATAAGTTTTTAAATGA GCTTGAAACAAGCAAGTAAATTTGCTTTTCAAAGCTTTAATACTCAAAAC ATGTATGTTACCACAGACAGAGACAGGACTTGAAGATTTACTGAGTGTTG ATATTCGCTAAAATATAAGGGAAAATTCTACTAATTCACAAAGGTAATTT TACTAAGTTCCACAAAGTTAAAAAGGACAAAAATATAGAAAAATAGCTTG GTTGAAAACTCTCAAAAACTATGGGGAAAACTCAATCAAAAATTATGGTG AAAACCCTCTAGCTCAACAAAAAGTCAGTTGAAACTCTCAAAAGTTATGG TGAAAACTCTCTTACTGAAAAAAATCAAGATAAGCGTACAGAGGCGTTAT GATTGGGGGGAGACTAGGGGGAGGCTAGCCATACCTACCTCCCTTTCCAA TTGCCGGCCATCCTGCATGACAAGACAAATTTTGCATATCATCTCAGACA GTACCAAATTTCGAGAAAGGATTCTAGGCAAATTCTACCACTAAGCATCT CTGGGTCTGTTTTTGTTTTTTTATATGCTTATAAAAAAAACATGTGCCCT TCATTTGCTTAGAATCCTTCCTCAAAATTTGGTACTGTCTGAGATGACAT GCAAAACTTCAAATCTCGCTCTTGTCGTGCGTTTTCGTACGTCTGTCACG TTTGAAATGCTCATAACAATCATCCAGGACTTTGCAATTGCAAAGGGAGG TAGGTGTATGGCTAGCCTCCCCCGCAATCATAATGCCTCTGTATTGAGGC TTTTTGTTGAGTTAGAGGGTTTTCACCATAACTTTTGAGAGATTTCACCA TAATTTTTGAGAGTTTTCAACTGATTTTTTTTAAGTTAAAGGGTTTTCAA CCAAGCCATTTTCTAGGTGAAAGCATGACCTTTCAGGTCTATCGTAGTAG AGTTTTTGAAATATGAATCAGTTTTTTAAGTCATTAATGAATATATCGAT GTCAGTTTCTGAATCATAGTCTTTAAACTTTTGCAATTTGATGATGAGTT GCAGCCTTTTGAAAAAATTCAATTTTAGTTTTCCCTAAGTTTATCATAAA CACCTGTCTTATAGGTTTGTGCAAGTGTGTAAAAATTTTCACCTTCATGA TGTTCTAAAAAGTAGGAGGAACTCCTGGTTTTGTTCACTAAATAATCCCT ACTTTTTTAAGGTCAAGTAAAATTTCCTGAAAACTTAATATATATTAACT TAATAAACTTAATAATATATAGTCATAATAGTTTTACTTTTTTGGTTCTA CTTTAAGGAGACAAAGTTTTTAATGGGGACTGATTCTAAGAACCTGTTTC TTAATTTCTGCTTGTAGAGGGCGTACTGGGAACCCAACTTGAGTCTTCCC AAAAATTCGCAAAATTGGATGCTTGCTTAGAAATTTTTTAAAAATCTTTG GATTCACAAAACTCTTGAAATATAATCCTCACGTAAAATTTGAAAAATAA ACAAAAATGGGTCAAAACCTTTATGAAAATTTCATTTTCTGTGCTCACAA AAATAAGTCCTGAAAAAATTGAATTATTTTTTAAATAAATTCCCTTGTCG AAATATCTGCTTGCAAAAATAAATACATGTAATGTATATCACTGGCTTTC AGATCAATCAGTTCCTTGAGTTGTTCAGAAAGGGCATCGACATCTGACAT CAGGGACTGCAGCTGCTTCTTAAAGAGTGATATTATACATTGGTGATAGT TGCGATGGTACAGGTGAAAATTTCTGTAAGATACTGGATTTCATGTCCCT GCTCCTCCAGCAACAAAGGTTGTGTTGATGGATAGCACCTAACCAATGAG AGAAAATAGCTGTGCCTTAATGTCAGATTTTCCTTCCATTTGAATGATGT TGGTTGATTGATGACGTATGGAGTGAGTCAAGCGAAAGATAGATGTACAG TCAACGGTCCTTTTCAAATTCAAGATTTCAATAGTCATTCATTCAAGATC TCAAAATCTGTGACTTCATTGGGTCCCTTTTCACTCTAATGTTGTCAATA TTCAATGTTGGACCCAAAACAAACAAAAAGCTTAAATTATTTATGGTCTC CCAGTATTTTTGCAAAAGGTGGAAAATGCCAATTAACAACTTGTTTTCCA AAACACTAATTTTCACACTTTTCCCCCTTCTACTTTAACTTTCGTTTTCA ACTACAAACAAACAAACACATCACCTCTAATTTCATGTCTGAAAAATCTT ATATGACCACCTCACAGCACACTCACACAAGTTTTTAGTAAAAAGTCTAG CTGTTATGGAGCATTGTACCCACAGAGTAGAGTATTGCTTAAGCATGAAA AAACCCTTTGGTTAATGAGGAGGGATTAAGGGAATAACTTAAGCTAAGGC TACACTGAGCAATTTTTTCAGGCGCTTGGAACGCAATCTAGATTGCATTG CAAGTGCTCGAAAAAAATGAGTGTAGCCAGGTCGAATTCTCTCGATCTTT TCTGCAACGCAATAAAAACGCAAAAAAATATTGCAAAAAAAATTGCAAAA GGCTGCAACAAAATAGATCAGATCTATTTTGTTGCAGCCTTCTGCCATTC TTTCTGCCAAATAAGAGGAGAAATTTTCTTAATGTTTACTTTTCTTCTTT TTTCCTATTGTTTAAAACACTCGAAGAGTACCTAGTGATGTATGGAATAG AATTTTTAATAAAAGATTATTTTTTTGGCTGGATGAAATATGAAATTTCT CACAGCTGAGAAGGAAATTGTATATGGTGTTTGAAAGAAGATAACATGAT GGCGGAGAAAAACAAGAGACTTTCGGATGAAGAAAAGAAAACGCTATTAA TTATTTACAAGGAGAACCCTCCACTCTGGGATGGTACAAACCCATACAAC AAATCAAAACCGATGAAGGAGTCGCTGAAAGCTTATGGAACAATTTGATG ATAATTTTTCTACTGAACAACTCGACAAAACTTTCCACTCTCTGCGCACC TCTTTTGTCCGAGAACTCAAGAAAACCACTGAACATGCTGCATCAGAATC ATCAGATATACCCCTCAAAAAGTGGAAATTCTACGATGAAATGCAATTTC TGATTCAGGAGATTAATCGAGAAAAGAAGAAAACAAGTTTTAGCGAAACT GAAATGGAGGAGCTTATCGAGTTTTACAGAGACCATCCTGCGTTGTGGAA CCACCCTATCTAAGGATTATAGAGATATAACTTTGAGGGAGGCGTTGATG AACAAAGTTAGGGTACATTACGAAGATAAATTTACTATGGACGAGATTAA ACAAGCATGGCATAACACCATATCCCGAGTCAGGGTCAAGACTTGTTCCT TGATGCTTCTTCTCTTTGCCTTTCCTTTTTGACTTGATGAAGTTTATATT TCACAGTGGAATTACTTTGCCATCATGGAATTTGTTGATGTAACCTGTGG AATCGACGAATCTGTCAACACAATGAGGAGTCAGATGACCCAGCACCGCC TAAAAAGAAATCTAAAGCAAGGACAAGAAACAATGAATCAATATGAGAGC AAGAAAAAGCAGAAGAGCAAGCGGCAAAAACACAGCTTTGGAAGGCTTTA GCTGACTCGTTATCGGCTCCGCCCAGAATCCAACAGTCCCAATTTGCACA GTAACAACCTAAACCAACGCCTTCAAGTCAACTCGAAGCTAGAGCCAACT TGTTTGGGAAGCCAACTTGTTGCTGATCATCTTTTACAATGCGAGTCTTG TGATTGGACAAATCATGGATTTTTTTTTGGTATGAGCTCAACCTACTACC TCCTTGGCGACAACAAAAACAGTGTTTGAAATTCAACCCGGACAAGGTGA CCAAGGTGGAAATTTCACCCCTATGTTACAAGGTGACCAAGATGAAAATT TCACCTCTATGTTACAAGGTACAAGCCCAGTTCACACAGAAAGAAATTCG TTCTCCCCCAGCTCTACATACTCAAATGACTCATTCGTAAACTACTAACA CTTGAAAACATACAACAACATTTTTTGAGTTTGATATAGATACATTTTTA TTCTGATTAAAGATAAACTTTCCCAGTTCATGGTAATATAAATCTGTGGC ATTTCCATTCTTGAATAATTCAAAATATTAGGAAAAAGATAATACTATAT CTTATTGAAATATTATTCTAGCTTCTAAACAGGTTTTTGACTTGTATACA GTCAAATGATAAAGATTTCTGTGAATTTTGATCAGTGTCAAATGCCAACT CTTGCAGATTGCCATTGCCAGTTACTGCCCCTTTCAAGTTGAAATAATCT GTAAATTCTTCTCTGATCGATTTTGCTATGTCTGGTGAAGGATTCCCATG TAGGTCGTTAATGATTGGAAACCAGATCCCGCTTCCAGATTCTTCAATTA ATTCACCTTTAGCAGATTCCTGGTCAACTAAGCCCACGGGCAAGTAGATC TTTCCGATTGAAGATGAGCTTCTTTGCCAATTATGTAAAGCAATGGTAGC CAAAGTTATGGTTCTTACTTTTTCAGGGCCTAAAGCTATAGGTTTACAAA AGAAACGCCACCTATTAGCCAAGATTCCGAATCCGTTTTCTGAAATCCTC TTTTTCCGAAAAGACGGTAGTTAAAGATTCGTTTTTGTACAGAAAGACCT TTTTGGGGGAAAGGTTTCATCAGATAGCTCTTTAAAGGAAATGCGTCATC ATCGGTTACAACAAAAGGGATTTTTATTCTACGTCCAGGCAAACTTTGTG ATGAGGGTAAATTAAGGGCTCCATTTTTCAGTGATTGTTTTAATTTGCAT TGGTCCCATATCCCTCCATCAGAATCACACCCATCTGCACCAACTTCAAT ATAAAGAAACTCGTACTCTGGGCCAACCAACGCTAATAGCACTATACTGT CTGTCCCCTTATAGTTCCTGTAGTGAGAGCCCGATTTGTCGGGTTGCTGC ATCACTATATGCTTCCCATCGATAGCCCCAATGCTGTTTGGAAAATTCTA TCTTTGACCAAACTTACGCAAAATTTCATTCAAGCCATTCTGCTTAAGAT CTTTGTGTCTTTTAGCACGTAAAATTCTAAATTAAAATTCCAACGAGCGA AATGTCTCTCCAGTCGCAATCTTTGAAAATCTCTTTTCTACTGCCTACAA TATCAAATCAAAGAGGGTAACTTATTTGTGGCACACCCGGTATCATTTCT GTCTTGCCAGTAAGAGGGTTTTTGGTTCAAATGACCATCTAATCCTAAGG TTTCTGTCCACATTCACAAAACCTAGTTGCAACACTGTCTCCAATCTTGA GATAATGCATATCTCCTGTTTTGATAACGTCACAGGACCCAACAAACCAG ACAAAGTTAATTTATAAAATCTTTTTCTACAACTTATTCAAATATATTCT CCTAACAATTTTCCAACAAACTCAACTTCTTTTCAAACTTGAGGTACGGT ATTTTTCCTGTTGATCAAAATTTCTGCTAACTTTTAAAGTCAACCTCAAG GCCTAATGTTACCAATACCTTAAGGGAACTAATTTTCGTGATGCGACTAA TTTTCACAGTTGGCGCCTAGTTTTTGTTCAAATTCTTTCATTTTTCTAGG GGTTTTTACTGATTTTCAACGAAAATTGTATTTCACAGAACTAATTTTCA CAGTTGGCGCCTAGTTTTTGTTCAAATTCTTTCATTTTTCTAGGGGTTTT TACTGATTTTCAACGAAAATTGTATTTCACAGAACTAATTTTCACAGTTG GCGCCTAGTTTTTGTTCAAATTCTTTCATTTTTCTAGGGGTTTTTACTGA TTTTCAACGAAAATTGTATTTCACAGAACTAATTTTCACAGTAAGGGCAA AATTATTTTAAAGGGAACCAAAAAGTGCATCTGGGAGCTGAAATTTTTTT TTCAGTTAACATTTTCAAATTTATATGTATCATTTCTCATAGTATCTGAA ACTTGTTTGCAGTTGTTTTAGAGCTACAGCACTTCCGAAACATGAATTTG CCATTTTTTAGGCTAAAAAACCTTGAAATTAAAGCTTTTTAGCCTAAAAA ACAGCCACAGCCATATCTCAAAAAATACAATGAATGCTTCAGTTTTAGTT GTTTAAAATCCAACATAGGCCAACAATTGATCAAGAAAACTCATTTACAG CATGTTTGGCCTTCCCTGGATTGAACGGTTGAGGATTTTATTTTCCAAAA ATCTTGCTTACGGAATGACGGAAACATTAAAAATGCTGTAAAGTTTTAAG GAAACATTTTTAGAGTAAAATATTTGGCAAGTTTCTACGTCTTACTGAGT ACTTTCAAACCAGACATAAACTAATTGCCATTGGGGGAAGACTGGTTTTT AATTGAGAAATCATTTTTGGTTACGGAATGACGGAAAAATTAAAAATGCT GTAAAGTTTTAAGGAAACATTTTTAGAGTAAAATATTTGGCAAGTTTCTA CGTCTTACTGAGTACTTTCAAACCAGACATAAACTAATTGCCATTGGGGG AAGACTGGTTTTTAATTGAGAAATCATTTTTGGTTACGGAATGACGGAAA ATTATCTTACTTTTATACTGAAATAAAAATTATGAAATTTTCACTTAACC ATATCACCTCAAACATTTTTTAAGCTGATACAGTAACTTTGTATCAAAAT CTAAGCATTTGATCTATCTTGAAAACCTTTCCATTAACCCTATATAGGGT TCTAAAGTTAAATTAAATTTTTACAACCGATTCTGTTTCATATCATGTGT ACCGCATTCATGATAAATTTAAAAAATTGGTTGAGTGTTACCAAAAATCT TTTTGATTTTCTCAAAGTGTTATAGTTGCTNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNGTAAGCATGAAACTCGGAGTAGTGT ACTTTTTTATTTTGTGATGAAAGATAACTTTTAAAATTTAAATTGGCTCT GATTTCATTGAGCACTCTGCAACATCAATCACAAACAAATCTAGTTGCTA TTGCTAAAAATCATGACTTTGATAGCATGAACATCAGTCAGTGTCAATTT ATTAACCACTTTAAAAATGCAAATTTTTGGGTGACACTCTGTTTCATGGA AAAAATGGGCAGTTTTTTAGCTTTAAAATGCCATAACTTTAGTTTCGCTT GTGCTACAGACTCGTATGAGCTCTCATTTTTCAGCATTTTTTATTGTGCA TCCTCTGAAATTAAAATCATTCAATGACAACCTCCACTTTATGCACAGCA TCCTTTTGAAATCAAGGTGGTCTCTGGCTCCCTTTAAAATAATTTTGCCC AAAATTTGTTCCCGCAAAAATTAGTTCCACAAAAATTAGCTACCACAAAA GTTAGTTATAGTAAAAGTTAGTTCCCTTAAGAACTGGATTATTTGCAGCA TCCACAGGGTAATGTTCAAAATGGCAAACCTGCAGCTCACTCACACACTA CTTTAAGTATATAGAATTGAACCTATTTTTTGTTTTTTTTAGGTTCAGTC ATCTTTAGAAATCCTGTCTCAACTAGAGTTCAATATCAGGAACAAGGGGT AAGGCATATTTTATGAAAATTTTACTTTTATGAACACACAATGACAAACT ATATTTTTGCTTTCCATCCTCAATTAATTTAACTAACATATGTTTGCATT TTAATCTTATTACTTTTTGGACTACCTTCCTTTTCAGGCAGATAAAATTT ATAAAGATTGTATTTAAAACCCGTACAGACCACAACCTGTCAAAAAAACT AAACAATCTGATTGTTTATCAATGATCATTAGTCAAAAATATTTATCTTT TATTTCTTTTGTAGGATGTCATAATTCTCTGGACAGAAGTCGATGGCCCG AAAGAAACATTTGCGCTTAGTTTTATGGACCAAGAAAATAGGGATGATTT TTTAACTCATATTGAGGAGGTATTTTTTTAGCAGGCATAATTTTCTTACT CATAAATAGCAAAATACGTTTTTTCCAGACAGCCCTTTTGATAAGAATGA TCGAATGAGAATCTCTCGAAACTGTAAAACTTCAAGCCACCAAACTTCCC ATATAGATATCACTTGGAAATATGACATTCATACTTATTTAGATGAGCCT TTTCAAGGAATGATCTTATTATAAAACTTGTTGATTCTAATTATTGTGTT CTGTTTTTCTCAGACTAAATTGAAATTGGAACGTAGTGATAAAAATGGGG ATGCTTACAAAGGTCTGGATGACCAAGATTTTGATATGCACGGCCAAGGT CTTGGTATGGATTTGAGCTCAGAAGAAAGTCTTGCCATTCCTCCTTGCGA ATTCAGCAAACTTAATGCCTTGAATGAAACATTACAACGTTATTTACAAA GCAAAAATCTCCATGATGATCTAGTAACACTTTTAGAAGCCCAAGGATAT ATTCCAAAGTTGATAGAGATTTTTCATATGTGCGAAGACCTGGAAAATAC TGACGCACTTCATACACTTTATAGTATTTTCAAGACTTTATTCATGTTGG AAAAAAATGCAATATTTGAAACGATGTTTTCTCAAGAGTACATTTTGGAT ATTGTTGGTATACTTGAGTACGATCCTTCAAAGACGACGCGGACACCTCA TAGAGAGCATATCAATGATCGTGTCCAATTTAAAGAAGTGATTCCAATTG CAAACAAAGAACTACTTGCTAAGATCCATCAGACTTTTCGAGTTCAGTAT ATAAAAGACATTTTAATTCCTGTGCCATTGATTTTTGATGAGACTGGTAC AACGCTGAGTTCCTTTATTTTCTTCAATAAAGTCCAAATTATTGACCTAA TAAAGGTAAGCCAAACTTGAATTTCTGTATCATTGTTTTTAAGCAAAAGT TGAAAATGTCTCACTTCTGAGGAAAATGTGTTTAAAACTTTCTAATTTTC ATATAATCACTCTTCGATCATACTTTTTCTTAACTTCTTGATGAACAGGA GGATCAACATTTTCTTGATGAGTTGTTCGAACAATTGACGAATGATGAAG TATCTGATGACAAAAGGAAAGACATTGTAAGATAATACACTACAACAATC CCAATAAGTTTTGTGGTGCTTGCCACTACCACAAATCCCTTGTTAATACT GCTTTATTAGGTGGTTATAATGCAATTATAATCCATCCATTCGGGTTTTT TTCGAATTCTTACCCTGAAAAAATGAAACTTGGTATCCTTTGACATTTTA GCAATTTTTTATATTTAGATTCTTCTATTGAAAGAACTTTGTGTTTATTC GCAATCGCTGCAACCAGCAAGACGAGAAGAATTCATCAAAATGTTGGCAA ATATTGGAATGTTGCAGTCTATCGAACAACTCTTGGTAAATTATAGTTAG CTTGTGCTTTTACCTTAAACGCAAACCTTTCATACTCTCCATGCATTTCA ACTTATCCTTTGCCACAAGTTAGATTACTTCCCCCTCCATGTATCCCAGT AGGTCCTAGTAGTTTAGCAGTAACCCTACTTGTCCCCTACATGGTACTTT TTATTTAGTTTTAATAACAACAAGTTTTTTCAACTTCTTTTGATGTGTAG AACATAGATGACAAAGACATCCAGCAAGCATTAATAGACATTGTTTGCAC CATCACTGAGTGTACTCCATCCATCATTCGAATCTATGTTTGCCGTGAAG CATCTTACACCATTGACGAGGTGATTAATCTTAACCATGTTCCTCCTGTC GACTTGGATATTTCCGATCGCTTTAGTCTAATCAGTACCAACACCCTTTC TAAATTATTCACAATAAATAATTTGTATAATAATAATTTTGAGTATTATA CATACTGCTCTTACTGGTGGTGGGTCACAGGGAACTATAAGATCTGCAGC TAGAGTTAAAAGGCCTCCTTTTTAAATTCGTTTTCCTCTGTTTGGTCCTT TAAAAGAAATGTATTTATTAAGCCAGCCAAGGATTGTGGTGATTGATTGT ATTTGACTGATTGATGTTTTTGTTTGTTTACAGGATACAATGATGTTGAA CGTCATGATCAGTCATCTCGTCAACTGTGAAACTGAAGGTGAGACTTGTC CGCATAGTTCCTGCGCAAATTGTTCTAACTAACTACTTTAGGTGACAAAC TTTCGTGAGCAAAAACTTTTGCGAGGAAGAAAAGTCGCAAAATTTACGAC ATTAACTTTCGCGAATCTGACGGAAAAATTTTTTTCACGGGTTTAAAAAT TTGTGAATCAAGACATGAAAACGAAAATTTTACATGAAAAAAGTGGCTCA GAAGGCTGAATGTTTCTTGAATTAGATTGAAGCTTTTTTCTTTTGACATA TGAGGCTTTAACAGGCTAAAAAGTGCCATCTATTTTTTCAAAAGCTTTAA AGTTTTCGATAATGGCCATTACAAGACTTTTCAGAGACATTTAATTTCGC ATAAAAGGGTAAAATTCGCGAAAATCGGGAAAGTTTCTACTTGGGAAAGT TTGTACGCCTAAAGATATCATCTTTAGTATGATCTTAGTATCAACGTCTG GTTTGCGGAATTACATCCGTCTCTTACATCCTTTGCCATGATTTCCAGGT CATGATTTTTCATGTCATGTCAATGTCTAATTTCTTGCAATTTCGCAATG AAGAGTTATTCTTAAGTTGAACTTTACTTGAATTGATATTTTAGGTATGA GTGTCATCCTACTGCAGACCCTACAAACGTTGCTGGACCCTGAAAACATG TGTCAAACGGCTAATGTAAGTTCACTGTGTTTATTTTCTGATCTGGCGAA GTCAATATAATTATCTTGAAGTTAGCGGAATTTGAGGTTTCGAACCATTC TTTTTTCTCTTTTGAGAAGCTTGGAGGGGCTCATTAAACAGCAAGTTGAT CTGATGTAAATAGCCTTATCTGTTCAGCTTTTCTTTGCTTGGTACACCCG AAGGGATTTCAAAAAGATTTCAAAAAAGGAAAGTTATTTTAGTCTTTTTA AATCTTGTTTTCATTTTCAGAGCACGATTGAACGTTCGGAATTCTTGAGT TTCTTTTATCGTCACAACATGCACGTTCTGACGTCTCCCGTACTTGCTGT TACTGCCACGGATGAACTGGTCGGAAAAGGTATCTTGTCTCTCACTGATT GAGGAGGAAATTTTGATGCCTACTTCGTAATTTTTGATAGGGTATCCAGA CTGAACAAACACCTCAACATACATAGTTCTAAAATAGGCCATTTCGCAGT CGAAATGGATCATCGGTGATCAGGACTGATTGAGCCTCCATAACGGCTTT CTGTTGGCTAGACGCAAAAATATTCAAAAATTTTCAAAAAGTTGAACAAA TAGTAAGTCATCATTCGTGCGCAGTTGTCCTGGTTAATCAATTTGCTTCA CGACTATGAAATGGCCTATTTTAAAGTGGTGAAAAGTCTGATACAGTTTG TTTGATACTGTGTGCGAGTAAACCCTTGTTGACAAAACCTTAAAACTTTG GAAATCCAGGTGGATGAGCAAAATATTTACATAAAAAAATTGAAAAATTC TCATAGACTGTCAAACCTGCCTAAAACAACAATACAAAACCAGCCACATG CAAACAACCNAGACATTTAATTTCGCATAAAAGGGTAAAATTCGCGAAAA TCGGGAAAGTTTCTACTTGGGAAAGTTTGTACGCCTAAAGATATCATCTT TAGTATGATCTTAGTATCAACGTCTGGTTTGCGGAATTACATCCGTCTCT TACATCCTTTGCCATGATTTCCAGGTCATGATTTTTCATGTCATGTCAAT GTCTAATTTCTTGCAATTTCGCAATGAAGAGTTATTCTTAAGTTGAACTT TACTTGAATTGATATTTTAGGTATGAGTGTCATCCTACTGCAGACCCTAC AAACGTTGCTGGACCCTGAAAACATGTGTCAAACGGCTAATGTAAGTTCA CTGTGTTTATTTTCTGATCTGGCGAAGTCAATATAATTATCTTGAAGTTA GCGGAATTTGAGGTTTCGAACCATTCTTTTTTCTCTTTTGAGAAGCTTGG AGGGGCTCATTAAACAGCAAGTTGATCTGATGTAAATAGCCTTATCTGTT CAGCTTTTCTTTGCTTGGTACACCCGAAGGGATTTCAAAAAGATTTCAAA AAAGGAAAGTTATTTTAGTCTTTTTAAATCTTGTTTTCATTTTCAGAGCA CGATTGAACGTTCGGAATTCTTGAGTTTCTTTTATCGTCACAACATGCAC GTTCTGACGTCTCCCGTACTTGCTGTTACTGCCACGGATGAACTGGTCGG AAAAGGTATCTTGTCTCTCACTGATTGAGGAGGAAATTTTGATGCCTACT TCGTAATTTTTGATAGGGTATCCAGACTGAACAAACACCTCAACATACAT AGTTCTAAAATAGGCCATTTCACAGTCGAAATGGATCATCGGTGATCAGG ACTGATTGAGCCTCCATAACGGCTTTCTGTTGGCTAGACGCAAAAATATT CAAAAAATTTCAAAACTTTGAACAAATAGTAAGTCATCATTCGCGCGCAG TTGTCCTGATTACTCATTTTGCTTCACGACTATGAAATGGCCTATTTTAA AGTGGTGAAAAGTCTGATACAGTTTGTTTGATACTGTGTGTGAGTAAACC CTTGTTGACAAAACCTTAAAACTTTGGAAATCCAGGTGGATGAGCAAAAT ATTTACATAAAAAAATTGAAAAATTCTCACAGACTGTCAAACCTGCCTAA AACAACAATACAAAACCAGCCACATGCAAACAACCTTTTCTTCATTCTTC ACAAAAAGTTGTTTGGATGACTCGCCAATTTGCATAAATTATTTGGGCGC TATAAGGTGGCGGGTGGGCGTATGGAAAACCCTCGAAAAAGCTATTGAGC ACTTGCATCAACCAATCGCCACATGCACCCTTAGATTCGAATGCAGACGA TCTATGTAAATCGGACCGTATACGATAGACGAAAATTAAAAAAAACTAGG CTGTGAAAAAGTTTATGGTCTGGATACCCAGGCTAAATTCATGAGTAAAT ATTACAAACACCGCCAATTGTTCGCATGGGGATATGCATTTAAGGTTATT TTTTTAGCCTCATTTGGTTCGTGTTTTGCTAATTTGGCTGTTAACCTCAA TTTCTGACACTTTTCCTCTTAGACGACTTCCAGCGTGCGACAGTGTTTGA CAACATTGTGAACTTGTTGACTTTTTGCGTGGAACATCATCAATCTTCTA TCAAGAATTACATCGTCAGTAAAGATATGTTACGCCGTGTTCTCGTTCTT TTACANN

Coding sequence (CDS) from alignment at scaffold_92:136919..157075-

>TCONS_00073462 ID=TCONS_00073462|Name=TCONS_00073462|organism=Clytia hemisphaerica|type=CDS|length=20232bp|location=Sequence derived from alignment at scaffold_92:136919..157075- (Clytia hemisphaerica)
ACGACTTCCAGCGTGCGACAGTGTTTGACAACATTGTGAACTTGTTGACT
TTTTGCGTGGAACATCATCAATCTTCTATCAAGAATTACATCGTCAGTAA
AGATATGTTACGCCGTGTTCTCGTTCTTTTACANATGCACGTTCTGACGT
CTCCCGTACTTGCTGTTACTGCCACGGATGAACTGGTCGGAAAAGAGCAC
GATTGAACGTTCGGAATTCTTGAGTTTCTTTTATCGTCACAACGTATGAG
TGTCATCCTACTGCAGACCCTACAAACGTTGCTGGACCCTGAAAACATGT
GTCAAACGGCTAATGATACAATGATGTTGAACGTCATGATCAGTCATCTC
GTCAACTGTGAAACTGAAGAACATAGATGACAAAGACATCCAGCAAGCAT
TAATAGACATTGTTTGCACCATCACTGAGTGTACTCCATCCATCATTCGA
ATCTATGTTTGCCGTGAAGCATCTTACACCATTGACGAGATTCTTCTATT
GAAAGAACTTTGTGTTTATTCGCAATCGCTGCAACCAGCAAGACGAGAAG
AATTCATCAAAATGTTGGCAAATATTGGAATGTTGCAGTCTATCGAACAA
CTCTTGGAGGATCAACATTTTCTTGATGAGTTGTTCGAACAATTGACGAA
TGATGAAGTATCTGATGACAAAAGGAAAGACATTACTAAATTGAAATTGG
AACGTAGTGATAAAAATGGGGATGCTTACAAAGGTCTGGATGACCAAGAT
TTTGATATGCACGGCCAAGGTCTTGGTATGGATTTGAGCTCAGAAGAAAG
TCTTGCCATTCCTCCTTGCGAATTCAGCAAACTTAATGCCTTGAATGAAA
CATTACAACGTTATTTACAAAGCAAAAATCTCCATGATGATCTAGTAACA
CTTTTAGAAGCCCAAGGATATATTCCAAAGTTGATAGAGATTTTTCATAT
GTGCGAAGACCTGGAAAATACTGACGCACTTCATACACTTTATAGTATTT
TCAAGACTTTATTCATGTTGGAAAAAAATGCAATATTTGAAACGATGTTT
TCTCAAGAGTACATTTTGGATATTGTTGGTATACTTGAGTACGATCCTTC
AAAGACGACGCGGACACCTCATAGAGAGCATATCAATGATCGTGTCCAAT
TTAAAGAAGTGATTCCAATTGCAAACAAAGAACTACTTGCTAAGATCCAT
CAGACTTTTCGAGTTCAGTATATAAAAGACATTTTAATTCCTGTGCCATT
GATTTTTGATGAGACTGGTACAACGCTGAGTTCCTTTATTTTCTTCAATA
AAGTCCAAATTATTGACCTAATAAAGGATGTCATAATTCTCTGGACAGAA
GTCGATGGCCCGAAAGAAACATTTGCGCTTAGTTTTATGGACCAAGAAAA
TAGGGATGATTTTTTAACTCATATTGAGGAGGTTCAGTCATCTTTAGAAA
TCCTGTCTCAACTAGAGTTCAATATCAGGAACAAGGGATGAATAGGTATC
ATCAAGCCAGGACTCTGGAAAAAAGAGTCAAATTATACAAGGCACAAGAG
CAAGAATCTGGAGGAGAGCCAGCTTGGAAAGATCTTGGAGTTGGTGATAT
CAATATAGTACCAAATTCTGATTCTGATTATTTTAGAAGCAACTATTATG
GGGGAATGATTATGCTGATGAATTCAGAAGAAGATGACGACTTCCAGCGT
GCGACAGTGTTTGACAACATTGTGAACTTGTTGACTTTTTGCGTGGAACA
TCATCAATCTTCTATCAAGAATTACATCGTCAGTAAAGATATGTTACGCC
GTGTTCTCGTTCTTTTACANATGCACGTTCTGACGTCTCCCGTACTTGCT
GTTACTGCCACGGATGAACTGGTCGGAAAAGAGCACGATTGAACGTTCGG
AATTCTTGAGTTTCTTTTATCGTCACAACGTATGAGTGTCATCCTACTGC
AGACCCTACAAACGTTGCTGGACCCTGAAAACATGTGTCAAACGGCTAAT
GATACAATGATGTTGAACGTCATGATCAGTCATCTCGTCAACTGTGAAAC
TGAAGAACATAGATGACAAAGACATCCAGCAAGCATTAATAGACATTGTT
TGCACCATCACTGAGTGTACTCCATCCATCATTCGAATCTATGTTTGCCG
TGAAGCATCTTACACCATTGACGAGATTCTTCTATTGAAAGAACTTTGTG
TTTATTCGCAATCGCTGCAACCAGCAAGACGAGAAGAATTCATCAAAATG
TTGGCAAATATTGGAATGTTGCAGTCTATCGAACAACTCTTGGAGGATCA
ACATTTTCTTGATGAGTTGTTCGAACAATTGACGAATGATGAAGTATCTG
ATGACAAAAGGAAAGACATTACTAAATTGAAATTGGAACGTAGTGATAAA
AATGGGGATGCTTACAAAGGTCTGGATGACCAAGATTTTGATATGCACGG
CCAAGGTCTTGGTATGGATTTGAGCTCAGAAGAAAGTCTTGCCATTCCTC
CTTGCGAATTCAGCAAACTTAATGCCTTGAATGAAACATTACAACGTTAT
TTACAAAGCAAAAATCTCCATGATGATCTAGTAACACTTTTAGAAGCCCA
AGGATATATTCCAAAGTTGATAGAGATTTTTCATATGTGCGAAGACCTGG
AAAATACTGACGCACTTCATACACTTTATAGTATTTTCAAGACTTTATTC
ATGTTGGAAAAAAATGCAATATTTGAAACGATGTTTTCTCAAGAGTACAT
TTTGGATATTGTTGGTATACTTGAGTACGATCCTTCAAAGACGACGCGGA
CACCTCATAGAGAGCATATCAATGATCGTGTCCAATTTAAAGAAGTGATT
CCAATTGCAAACAAAGAACTACTTGCTAAGATCCATCAGACTTTTCGAGT
TCAGTATATAAAAGACATTTTAATTCCTGTGCCATTGATTTTTGATGAGA
CTGGTACAACGCTGAGTTCCTTTATTTTCTTCAATAAAGTCCAAATTATT
GACCTAATAAAGGATGTCATAATTCTCTGGACAGAAGTCGATGGCCCGAA
AGAAACATTTGCGCTTAGTTTTATGGACCAAGAAAATAGGGATGATTTTT
TAACTCATATTGAGGAGGTTCAGTCATCTTTAGAAATCCTGTCTCAACTA
GAGTTCAATATCAGGAACAAGGGATGAATAGGTATCATCAAGCCAGGACT
CTGGAAAAAAGAGTCAAATTATACAAGGCACAAGAGCAAGAATCTGGAGG
AGAGCCAGCTTGGAAAGATCTTGGAGTTGGTGATATCAATATAGTACCAA
ATTCTGATTCTGATTATTTTAGAAGCAACTATTATGGGGGAATGATTATG
CTGATGAATTCAGAAGAAGATGACGACTTCCAGCGTGCGACAGTGTTTGA
CAACATTGTGAACTTGTTGACTTTTTGCGTGGAACATCATCAATCTTCTA
TCAAGAATTACATCGTCAGTAAAGATATGTTACGCCGTGTTCTCGTTCTT
TTACANATGCACGTTCTGACGTCTCCCGTACTTGCTGTTACTGCCACGGA
TGAACTGGTCGGAAAAGAGCACGATTGAACGTTCGGAATTCTTGAGTTTC
TTTTATCGTCACAACGTATGAGTGTCATCCTACTGCAGACCCTACAAACG
TTGCTGGACCCTGAAAACATGTGTCAAACGGCTAATGATACAATGATGTT
GAACGTCATGATCAGTCATCTCGTCAACTGTGAAACTGAAGAACATAGAT
GACAAAGACATCCAGCAAGCATTAATAGACATTGTTTGCACCATCACTGA
GTGTACTCCATCCATCATTCGAATCTATGTTTGCCGTGAAGCATCTTACA
CCATTGACGAGATTCTTCTATTGAAAGAACTTTGTGTTTATTCGCAATCG
CTGCAACCAGCAAGACGAGAAGAATTCATCAAAATGTTGGCAAATATTGG
AATGTTGCAGTCTATCGAACAACTCTTGGAGGATCAACATTTTCTTGATG
AGTTGTTCGAACAATTGACGAATGATGAAGTATCTGATGACAAAAGGAAA
GACATTACTAAATTGAAATTGGAACGTAGTGATAAAAATGGGGATGCTTA
CAAAGGTCTGGATGACCAAGATTTTGATATGCACGGCCAAGGTCTTGGTA
TGGATTTGAGCTCAGAAGAAAGTCTTGCCATTCCTCCTTGCGAATTCAGC
AAACTTAATGCCTTGAATGAAACATTACAACGTTATTTACAAAGCAAAAA
TCTCCATGATGATCTAGTAACACTTTTAGAAGCCCAAGGATATATTCCAA
AGTTGATAGAGATTTTTCATATGTGCGAAGACCTGGAAAATACTGACGCA
CTTCATACACTTTATAGTATTTTCAAGACTTTATTCATGTTGGAAAAAAA
TGCAATATTTGAAACGATGTTTTCTCAAGAGTACATTTTGGATATTGTTG
GTATACTTGAGTACGATCCTTCAAAGACGACGCGGACACCTCATAGAGAG
CATATCAATGATCGTGTCCAATTTAAAGAAGTGATTCCAATTGCAAACAA
AGAACTACTTGCTAAGATCCATCAGACTTTTCGAGTTCAGTATATAAAAG
ACATTTTAATTCCTGTGCCATTGATTTTTGATGAGACTGGTACAACGCTG
AGTTCCTTTATTTTCTTCAATAAAGTCCAAATTATTGACCTAATAAAGGA
TGTCATAATTCTCTGGACAGAAGTCGATGGCCCGAAAGAAACATTTGCGC
TTAGTTTTATGGACCAAGAAAATAGGGATGATTTTTTAACTCATATTGAG
GAGGTTCAGTCATCTTTAGAAATCCTGTCTCAACTAGAGTTCAATATCAG
GAACAAGGGATGAATAGGTATCATCAAGCCAGGACTCTGGAAAAAAGAGT
CAAATTATACAAGGCACAAGAGCAAGAATCTGGAGGAGAGCCAGCTTGGA
AAGATCTTGGAGTTGGTGATATCAATATAGTACCAAATTCTGATTCTGAT
TATTTTAGAAGCAACTATTATGGGGGAATGATTATGCTGATGAATTCAGA
AGAAGATGACGACTTCCAGCGTGCGACAGTGTTTGACAACATTGTGAACT
TGTTGACTTTTTGCGTGGAACATCATCAATCTTCTATCAAGAATTACATC
GTCAGTAAAGATATGTTACGCCGTGTTCTCGTTCTTTTACANATGCACGT
TCTGACGTCTCCCGTACTTGCTGTTACTGCCACGGATGAACTGGTCGGAA
AAGAGCACGATTGAACGTTCGGAATTCTTGAGTTTCTTTTATCGTCACAA
CGTATGAGTGTCATCCTACTGCAGACCCTACAAACGTTGCTGGACCCTGA
AAACATGTGTCAAACGGCTAATGATACAATGATGTTGAACGTCATGATCA
GTCATCTCGTCAACTGTGAAACTGAAGAACATAGATGACAAAGACATCCA
GCAAGCATTAATAGACATTGTTTGCACCATCACTGAGTGTACTCCATCCA
TCATTCGAATCTATGTTTGCCGTGAAGCATCTTACACCATTGACGAGATT
CTTCTATTGAAAGAACTTTGTGTTTATTCGCAATCGCTGCAACCAGCAAG
ACGAGAAGAATTCATCAAAATGTTGGCAAATATTGGAATGTTGCAGTCTA
TCGAACAACTCTTGGAGGATCAACATTTTCTTGATGAGTTGTTCGAACAA
TTGACGAATGATGAAGTATCTGATGACAAAAGGAAAGACATTACTAAATT
GAAATTGGAACGTAGTGATAAAAATGGGGATGCTTACAAAGGTCTGGATG
ACCAAGATTTTGATATGCACGGCCAAGGTCTTGGTATGGATTTGAGCTCA
GAAGAAAGTCTTGCCATTCCTCCTTGCGAATTCAGCAAACTTAATGCCTT
GAATGAAACATTACAACGTTATTTACAAAGCAAAAATCTCCATGATGATC
TAGTAACACTTTTAGAAGCCCAAGGATATATTCCAAAGTTGATAGAGATT
TTTCATATGTGCGAAGACCTGGAAAATACTGACGCACTTCATACACTTTA
TAGTATTTTCAAGACTTTATTCATGTTGGAAAAAAATGCAATATTTGAAA
CGATGTTTTCTCAAGAGTACATTTTGGATATTGTTGGTATACTTGAGTAC
GATCCTTCAAAGACGACGCGGACACCTCATAGAGAGCATATCAATGATCG
TGTCCAATTTAAAGAAGTGATTCCAATTGCAAACAAAGAACTACTTGCTA
AGATCCATCAGACTTTTCGAGTTCAGTATATAAAAGACATTTTAATTCCT
GTGCCATTGATTTTTGATGAGACTGGTACAACGCTGAGTTCCTTTATTTT
CTTCAATAAAGTCCAAATTATTGACCTAATAAAGGATGTCATAATTCTCT
GGACAGAAGTCGATGGCCCGAAAGAAACATTTGCGCTTAGTTTTATGGAC
CAAGAAAATAGGGATGATTTTTTAACTCATATTGAGGAGGTTCAGTCATC
TTTAGAAATCCTGTCTCAACTAGAGTTCAATATCAGGAACAAGGGATGAA
TAGGTATCATCAAGCCAGGACTCTGGAAAAAAGAGTCAAATTATACAAGG
CACAAGAGCAAGAATCTGGAGGAGAGCCAGCTTGGAAAGATCTTGGAGTT
GGTGATATCAATATAGTACCAAATTCTGATTCTGATTATTTTAGAAGCAA
CTATTATGGGGGAATGATTATGCTGATGAATTCAGAAGAAGATGACGACT
TCCAGCGTGCGACAGTGTTTGACAACATTGTGAACTTGTTGACTTTTTGC
GTGGAACATCATCAATCTTCTATCAAGAATTACATCGTCAGTAAAGATAT
GTTACGCCGTGTTCTCGTTCTTTTACANATGCACGTTCTGACGTCTCCCG
TACTTGCTGTTACTGCCACGGATGAACTGGTCGGAAAAGAGCACGATTGA
ACGTTCGGAATTCTTGAGTTTCTTTTATCGTCACAACGTATGAGTGTCAT
CCTACTGCAGACCCTACAAACGTTGCTGGACCCTGAAAACATGTGTCAAA
CGGCTAATGATACAATGATGTTGAACGTCATGATCAGTCATCTCGTCAAC
TGTGAAACTGAAGAACATAGATGACAAAGACATCCAGCAAGCATTAATAG
ACATTGTTTGCACCATCACTGAGTGTACTCCATCCATCATTCGAATCTAT
GTTTGCCGTGAAGCATCTTACACCATTGACGAGATTCTTCTATTGAAAGA
ACTTTGTGTTTATTCGCAATCGCTGCAACCAGCAAGACGAGAAGAATTCA
TCAAAATGTTGGCAAATATTGGAATGTTGCAGTCTATCGAACAACTCTTG
GAGGATCAACATTTTCTTGATGAGTTGTTCGAACAATTGACGAATGATGA
AGTATCTGATGACAAAAGGAAAGACATTACTAAATTGAAATTGGAACGTA
GTGATAAAAATGGGGATGCTTACAAAGGTCTGGATGACCAAGATTTTGAT
ATGCACGGCCAAGGTCTTGGTATGGATTTGAGCTCAGAAGAAAGTCTTGC
CATTCCTCCTTGCGAATTCAGCAAACTTAATGCCTTGAATGAAACATTAC
AACGTTATTTACAAAGCAAAAATCTCCATGATGATCTAGTAACACTTTTA
GAAGCCCAAGGATATATTCCAAAGTTGATAGAGATTTTTCATATGTGCGA
AGACCTGGAAAATACTGACGCACTTCATACACTTTATAGTATTTTCAAGA
CTTTATTCATGTTGGAAAAAAATGCAATATTTGAAACGATGTTTTCTCAA
GAGTACATTTTGGATATTGTTGGTATACTTGAGTACGATCCTTCAAAGAC
GACGCGGACACCTCATAGAGAGCATATCAATGATCGTGTCCAATTTAAAG
AAGTGATTCCAATTGCAAACAAAGAACTACTTGCTAAGATCCATCAGACT
TTTCGAGTTCAGTATATAAAAGACATTTTAATTCCTGTGCCATTGATTTT
TGATGAGACTGGTACAACGCTGAGTTCCTTTATTTTCTTCAATAAAGTCC
AAATTATTGACCTAATAAAGGATGTCATAATTCTCTGGACAGAAGTCGAT
GGCCCGAAAGAAACATTTGCGCTTAGTTTTATGGACCAAGAAAATAGGGA
TGATTTTTTAACTCATATTGAGGAGGTTCAGTCATCTTTAGAAATCCTGT
CTCAACTAGAGTTCAATATCAGGAACAAGGGATGAATAGGTATCATCAAG
CCAGGACTCTGGAAAAAAGAGTCAAATTATACAAGGCACAAGAGCAAGAA
TCTGGAGGAGAGCCAGCTTGGAAAGATCTTGGAGTTGGTGATATCAATAT
AGTACCAAATTCTGATTCTGATTATTTTAGAAGCAACTATTATGGGGGAA
TGATTATGCTGATGAATTCAGAAGAAGATGACGACTTCCAGCGTGCGACA
GTGTTTGACAACATTGTGAACTTGTTGACTTTTTGCGTGGAACATCATCA
ATCTTCTATCAAGAATTACATCGTCAGTAAAGATATGTTACGCCGTGTTC
TCGTTCTTTTACANATGCACGTTCTGACGTCTCCCGTACTTGCTGTTACT
GCCACGGATGAACTGGTCGGAAAAGAGCACGATTGAACGTTCGGAATTCT
TGAGTTTCTTTTATCGTCACAACGTATGAGTGTCATCCTACTGCAGACCC
TACAAACGTTGCTGGACCCTGAAAACATGTGTCAAACGGCTAATGATACA
ATGATGTTGAACGTCATGATCAGTCATCTCGTCAACTGTGAAACTGAAGA
ACATAGATGACAAAGACATCCAGCAAGCATTAATAGACATTGTTTGCACC
ATCACTGAGTGTACTCCATCCATCATTCGAATCTATGTTTGCCGTGAAGC
ATCTTACACCATTGACGAGATTCTTCTATTGAAAGAACTTTGTGTTTATT
CGCAATCGCTGCAACCAGCAAGACGAGAAGAATTCATCAAAATGTTGGCA
AATATTGGAATGTTGCAGTCTATCGAACAACTCTTGGAGGATCAACATTT
TCTTGATGAGTTGTTCGAACAATTGACGAATGATGAAGTATCTGATGACA
AAAGGAAAGACATTACTAAATTGAAATTGGAACGTAGTGATAAAAATGGG
GATGCTTACAAAGGTCTGGATGACCAAGATTTTGATATGCACGGCCAAGG
TCTTGGTATGGATTTGAGCTCAGAAGAAAGTCTTGCCATTCCTCCTTGCG
AATTCAGCAAACTTAATGCCTTGAATGAAACATTACAACGTTATTTACAA
AGCAAAAATCTCCATGATGATCTAGTAACACTTTTAGAAGCCCAAGGATA
TATTCCAAAGTTGATAGAGATTTTTCATATGTGCGAAGACCTGGAAAATA
CTGACGCACTTCATACACTTTATAGTATTTTCAAGACTTTATTCATGTTG
GAAAAAAATGCAATATTTGAAACGATGTTTTCTCAAGAGTACATTTTGGA
TATTGTTGGTATACTTGAGTACGATCCTTCAAAGACGACGCGGACACCTC
ATAGAGAGCATATCAATGATCGTGTCCAATTTAAAGAAGTGATTCCAATT
GCAAACAAAGAACTACTTGCTAAGATCCATCAGACTTTTCGAGTTCAGTA
TATAAAAGACATTTTAATTCCTGTGCCATTGATTTTTGATGAGACTGGTA
CAACGCTGAGTTCCTTTATTTTCTTCAATAAAGTCCAAATTATTGACCTA
ATAAAGGATGTCATAATTCTCTGGACAGAAGTCGATGGCCCGAAAGAAAC
ATTTGCGCTTAGTTTTATGGACCAAGAAAATAGGGATGATTTTTTAACTC
ATATTGAGGAGGTTCAGTCATCTTTAGAAATCCTGTCTCAACTAGAGTTC
AATATCAGGAACAAGGGATGAATAGGTATCATCAAGCCAGGACTCTGGAA
AAAAGAGTCAAATTATACAAGGCACAAGAGCAAGAATCTGGAGGAGAGCC
AGCTTGGAAAGATCTTGGAGTTGGTGATATCAATATAGTACCAAATTCTG
ATTCTGATTATTTTAGAAGCAACTATTATGGGGGAATGATTATGCTGATG
AATTCAGAAGAAGATGACGACTTCCAGCGTGCGACAGTGTTTGACAACAT
TGTGAACTTGTTGACTTTTTGCGTGGAACATCATCAATCTTCTATCAAGA
ATTACATCGTCAGTAAAGATATGTTACGCCGTGTTCTCGTTCTTTTACAN
ATGCACGTTCTGACGTCTCCCGTACTTGCTGTTACTGCCACGGATGAACT
GGTCGGAAAAGAGCACGATTGAACGTTCGGAATTCTTGAGTTTCTTTTAT
CGTCACAACGTATGAGTGTCATCCTACTGCAGACCCTACAAACGTTGCTG
GACCCTGAAAACATGTGTCAAACGGCTAATGATACAATGATGTTGAACGT
CATGATCAGTCATCTCGTCAACTGTGAAACTGAAGAACATAGATGACAAA
GACATCCAGCAAGCATTAATAGACATTGTTTGCACCATCACTGAGTGTAC
TCCATCCATCATTCGAATCTATGTTTGCCGTGAAGCATCTTACACCATTG
ACGAGATTCTTCTATTGAAAGAACTTTGTGTTTATTCGCAATCGCTGCAA
CCAGCAAGACGAGAAGAATTCATCAAAATGTTGGCAAATATTGGAATGTT
GCAGTCTATCGAACAACTCTTGGAGGATCAACATTTTCTTGATGAGTTGT
TCGAACAATTGACGAATGATGAAGTATCTGATGACAAAAGGAAAGACATT
ACTAAATTGAAATTGGAACGTAGTGATAAAAATGGGGATGCTTACAAAGG
TCTGGATGACCAAGATTTTGATATGCACGGCCAAGGTCTTGGTATGGATT
TGAGCTCAGAAGAAAGTCTTGCCATTCCTCCTTGCGAATTCAGCAAACTT
AATGCCTTGAATGAAACATTACAACGTTATTTACAAAGCAAAAATCTCCA
TGATGATCTAGTAACACTTTTAGAAGCCCAAGGATATATTCCAAAGTTGA
TAGAGATTTTTCATATGTGCGAAGACCTGGAAAATACTGACGCACTTCAT
ACACTTTATAGTATTTTCAAGACTTTATTCATGTTGGAAAAAAATGCAAT
ATTTGAAACGATGTTTTCTCAAGAGTACATTTTGGATATTGTTGGTATAC
TTGAGTACGATCCTTCAAAGACGACGCGGACACCTCATAGAGAGCATATC
AATGATCGTGTCCAATTTAAAGAAGTGATTCCAATTGCAAACAAAGAACT
ACTTGCTAAGATCCATCAGACTTTTCGAGTTCAGTATATAAAAGACATTT
TAATTCCTGTGCCATTGATTTTTGATGAGACTGGTACAACGCTGAGTTCC
TTTATTTTCTTCAATAAAGTCCAAATTATTGACCTAATAAAGGATGTCAT
AATTCTCTGGACAGAAGTCGATGGCCCGAAAGAAACATTTGCGCTTAGTT
TTATGGACCAAGAAAATAGGGATGATTTTTTAACTCATATTGAGGAGGTT
CAGTCATCTTTAGAAATCCTGTCTCAACTAGAGTTCAATATCAGGAACAA
GGGATGAATAGGTATCATCAAGCCAGGACTCTGGAAAAAAGAGTCAAATT
ATACAAGGCACAAGAGCAAGAATCTGGAGGAGAGCCAGCTTGGAAAGATC
TTGGAGTTGGTGATATCAATATAGTACCAAATTCTGATTCTGATTATTTT
AGAAGCAACTATTATGGGGGAATGATTATGCTGATGAATTCAGAAGAAGA
TGACGACTTCCAGCGTGCGACAGTGTTTGACAACATTGTGAACTTGTTGA
CTTTTTGCGTGGAACATCATCAATCTTCTATCAAGAATTACATCGTCAGT
AAAGATATGTTACGCCGTGTTCTCGTTCTTTTACANATGCACGTTCTGAC
GTCTCCCGTACTTGCTGTTACTGCCACGGATGAACTGGTCGGAAAAGAGC
ACGATTGAACGTTCGGAATTCTTGAGTTTCTTTTATCGTCACAACGTATG
AGTGTCATCCTACTGCAGACCCTACAAACGTTGCTGGACCCTGAAAACAT
GTGTCAAACGGCTAATGATACAATGATGTTGAACGTCATGATCAGTCATC
TCGTCAACTGTGAAACTGAAGAACATAGATGACAAAGACATCCAGCAAGC
ATTAATAGACATTGTTTGCACCATCACTGAGTGTACTCCATCCATCATTC
GAATCTATGTTTGCCGTGAAGCATCTTACACCATTGACGAGATTCTTCTA
TTGAAAGAACTTTGTGTTTATTCGCAATCGCTGCAACCAGCAAGACGAGA
AGAATTCATCAAAATGTTGGCAAATATTGGAATGTTGCAGTCTATCGAAC
AACTCTTGGAGGATCAACATTTTCTTGATGAGTTGTTCGAACAATTGACG
AATGATGAAGTATCTGATGACAAAAGGAAAGACATTACTAAATTGAAATT
GGAACGTAGTGATAAAAATGGGGATGCTTACAAAGGTCTGGATGACCAAG
ATTTTGATATGCACGGCCAAGGTCTTGGTATGGATTTGAGCTCAGAAGAA
AGTCTTGCCATTCCTCCTTGCGAATTCAGCAAACTTAATGCCTTGAATGA
AACATTACAACGTTATTTACAAAGCAAAAATCTCCATGATGATCTAGTAA
CACTTTTAGAAGCCCAAGGATATATTCCAAAGTTGATAGAGATTTTTCAT
ATGTGCGAAGACCTGGAAAATACTGACGCACTTCATACACTTTATAGTAT
TTTCAAGACTTTATTCATGTTGGAAAAAAATGCAATATTTGAAACGATGT
TTTCTCAAGAGTACATTTTGGATATTGTTGGTATACTTGAGTACGATCCT
TCAAAGACGACGCGGACACCTCATAGAGAGCATATCAATGATCGTGTCCA
ATTTAAAGAAGTGATTCCAATTGCAAACAAAGAACTACTTGCTAAGATCC
ATCAGACTTTTCGAGTTCAGTATATAAAAGACATTTTAATTCCTGTGCCA
TTGATTTTTGATGAGACTGGTACAACGCTGAGTTCCTTTATTTTCTTCAA
TAAAGTCCAAATTATTGACCTAATAAAGGATGTCATAATTCTCTGGACAG
AAGTCGATGGCCCGAAAGAAACATTTGCGCTTAGTTTTATGGACCAAGAA
AATAGGGATGATTTTTTAACTCATATTGAGGAGGTTCAGTCATCTTTAGA
AATCCTGTCTCAACTAGAGTTCAATATCAGGAACAAGGGATGAATAGGTA
TCATCAAGCCAGGACTCTGGAAAAAAGAGTCAAATTATACAAGGCACAAG
AGCAAGAATCTGGAGGAGAGCCAGCTTGGAAAGATCTTGGAGTTGGTGAT
ATCAATATAGTACCAAATTCTGATTCTGATTATTTTAGAAGCAACTATTA
TGGGGGAATGATTATGCTGATGAATTCAGAAGAAGATGACGACTTCCAGC
GTGCGACAGTGTTTGACAACATTGTGAACTTGTTGACTTTTTGCGTGGAA
CATCATCAATCTTCTATCAAGAATTACATCGTCAGTAAAGATATGTTACG
CCGTGTTCTCGTTCTTTTACANATGCACGTTCTGACGTCTCCCGTACTTG
CTGTTACTGCCACGGATGAACTGGTCGGAAAAGAGCACGATTGAACGTTC
GGAATTCTTGAGTTTCTTTTATCGTCACAACGTATGAGTGTCATCCTACT
GCAGACCCTACAAACGTTGCTGGACCCTGAAAACATGTGTCAAACGGCTA
ATGATACAATGATGTTGAACGTCATGATCAGTCATCTCGTCAACTGTGAA
ACTGAAGAACATAGATGACAAAGACATCCAGCAAGCATTAATAGACATTG
TTTGCACCATCACTGAGTGTACTCCATCCATCATTCGAATCTATGTTTGC
CGTGAAGCATCTTACACCATTGACGAGATTCTTCTATTGAAAGAACTTTG
TGTTTATTCGCAATCGCTGCAACCAGCAAGACGAGAAGAATTCATCAAAA
TGTTGGCAAATATTGGAATGTTGCAGTCTATCGAACAACTCTTGGAGGAT
CAACATTTTCTTGATGAGTTGTTCGAACAATTGACGAATGATGAAGTATC
TGATGACAAAAGGAAAGACATTACTAAATTGAAATTGGAACGTAGTGATA
AAAATGGGGATGCTTACAAAGGTCTGGATGACCAAGATTTTGATATGCAC
GGCCAAGGTCTTGGTATGGATTTGAGCTCAGAAGAAAGTCTTGCCATTCC
TCCTTGCGAATTCAGCAAACTTAATGCCTTGAATGAAACATTACAACGTT
ATTTACAAAGCAAAAATCTCCATGATGATCTAGTAACACTTTTAGAAGCC
CAAGGATATATTCCAAAGTTGATAGAGATTTTTCATATGTGCGAAGACCT
GGAAAATACTGACGCACTTCATACACTTTATAGTATTTTCAAGACTTTAT
TCATGTTGGAAAAAAATGCAATATTTGAAACGATGTTTTCTCAAGAGTAC
ATTTTGGATATTGTTGGTATACTTGAGTACGATCCTTCAAAGACGACGCG
GACACCTCATAGAGAGCATATCAATGATCGTGTCCAATTTAAAGAAGTGA
TTCCAATTGCAAACAAAGAACTACTTGCTAAGATCCATCAGACTTTTCGA
GTTCAGTATATAAAAGACATTTTAATTCCTGTGCCATTGATTTTTGATGA
GACTGGTACAACGCTGAGTTCCTTTATTTTCTTCAATAAAGTCCAAATTA
TTGACCTAATAAAGGATGTCATAATTCTCTGGACAGAAGTCGATGGCCCG
AAAGAAACATTTGCGCTTAGTTTTATGGACCAAGAAAATAGGGATGATTT
TTTAACTCATATTGAGGAGGTTCAGTCATCTTTAGAAATCCTGTCTCAAC
TAGAGTTCAATATCAGGAACAAGGGATGAATAGGTATCATCAAGCCAGGA
CTCTGGAAAAAAGAGTCAAATTATACAAGGCACAAGAGCAAGAATCTGGA
GGAGAGCCAGCTTGGAAAGATCTTGGAGTTGGTGATATCAATATAGTACC
AAATTCTGATTCTGATTATTTTAGAAGCAACTATTATGGGGGAATGATTA
TGCTGATGAATTCAGAAGAAGATGACGACTTCCAGCGTGCGACAGTGTTT
GACAACATTGTGAACTTGTTGACTTTTTGCGTGGAACATCATCAATCTTC
TATCAAGAATTACATCGTCAGTAAAGATATGTTACGCCGTGTTCTCGTTC
TTTTACANATGCACGTTCTGACGTCTCCCGTACTTGCTGTTACTGCCACG
GATGAACTGGTCGGAAAAGAGCACGATTGAACGTTCGGAATTCTTGAGTT
TCTTTTATCGTCACAACGTATGAGTGTCATCCTACTGCAGACCCTACAAA
CGTTGCTGGACCCTGAAAACATGTGTCAAACGGCTAATGATACAATGATG
TTGAACGTCATGATCAGTCATCTCGTCAACTGTGAAACTGAAGAACATAG
ATGACAAAGACATCCAGCAAGCATTAATAGACATTGTTTGCACCATCACT
GAGTGTACTCCATCCATCATTCGAATCTATGTTTGCCGTGAAGCATCTTA
CACCATTGACGAGATTCTTCTATTGAAAGAACTTTGTGTTTATTCGCAAT
CGCTGCAACCAGCAAGACGAGAAGAATTCATCAAAATGTTGGCAAATATT
GGAATGTTGCAGTCTATCGAACAACTCTTGGAGGATCAACATTTTCTTGA
TGAGTTGTTCGAACAATTGACGAATGATGAAGTATCTGATGACAAAAGGA
AAGACATTACTAAATTGAAATTGGAACGTAGTGATAAAAATGGGGATGCT
TACAAAGGTCTGGATGACCAAGATTTTGATATGCACGGCCAAGGTCTTGG
TATGGATTTGAGCTCAGAAGAAAGTCTTGCCATTCCTCCTTGCGAATTCA
GCAAACTTAATGCCTTGAATGAAACATTACAACGTTATTTACAAAGCAAA
AATCTCCATGATGATCTAGTAACACTTTTAGAAGCCCAAGGATATATTCC
AAAGTTGATAGAGATTTTTCATATGTGCGAAGACCTGGAAAATACTGACG
CACTTCATACACTTTATAGTATTTTCAAGACTTTATTCATGTTGGAAAAA
AATGCAATATTTGAAACGATGTTTTCTCAAGAGTACATTTTGGATATTGT
TGGTATACTTGAGTACGATCCTTCAAAGACGACGCGGACACCTCATAGAG
AGCATATCAATGATCGTGTCCAATTTAAAGAAGTGATTCCAATTGCAAAC
AAAGAACTACTTGCTAAGATCCATCAGACTTTTCGAGTTCAGTATATAAA
AGACATTTTAATTCCTGTGCCATTGATTTTTGATGAGACTGGTACAACGC
TGAGTTCCTTTATTTTCTTCAATAAAGTCCAAATTATTGACCTAATAAAG
GATGTCATAATTCTCTGGACAGAAGTCGATGGCCCGAAAGAAACATTTGC
GCTTAGTTTTATGGACCAAGAAAATAGGGATGATTTTTTAACTCATATTG
AGGAGGTTCAGTCATCTTTAGAAATCCTGTCTCAACTAGAGTTCAATATC
AGGAACAAGGGATGAATAGGTATCATCAAGCCAGGACTCTGGAAAAAAGA
GTCAAATTATACAAGGCACAAGAGCAAGAATCTGGAGGAGAGCCAGCTTG
GAAAGATCTTGGAGTTGGTGATATCAATATAGTACCAAATTCTGATTCTG
ATTATTTTAGAAGCAACTATTATGGGGGAATGATTATGCTGATGAATTCA
GAAGAAGATGACGACTTCCAGCGTGCGACAGTGTTTGACAACATTGTGAA
CTTGTTGACTTTTTGCGTGGAACATCATCAATCTTCTATCAAGAATTACA
TCGTCAGTAAAGATATGTTACGCCGTGTTCTCGTTCTTTTACANATGCAC
GTTCTGACGTCTCCCGTACTTGCTGTTACTGCCACGGATGAACTGGTCGG
AAAAGAGCACGATTGAACGTTCGGAATTCTTGAGTTTCTTTTATCGTCAC
AACGTATGAGTGTCATCCTACTGCAGACCCTACAAACGTTGCTGGACCCT
GAAAACATGTGTCAAACGGCTAATGATACAATGATGTTGAACGTCATGAT
CAGTCATCTCGTCAACTGTGAAACTGAAGAACATAGATGACAAAGACATC
CAGCAAGCATTAATAGACATTGTTTGCACCATCACTGAGTGTACTCCATC
CATCATTCGAATCTATGTTTGCCGTGAAGCATCTTACACCATTGACGAGA
TTCTTCTATTGAAAGAACTTTGTGTTTATTCGCAATCGCTGCAACCAGCA
AGACGAGAAGAATTCATCAAAATGTTGGCAAATATTGGAATGTTGCAGTC
TATCGAACAACTCTTGGAGGATCAACATTTTCTTGATGAGTTGTTCGAAC
AATTGACGAATGATGAAGTATCTGATGACAAAAGGAAAGACATTACTAAA
TTGAAATTGGAACGTAGTGATAAAAATGGGGATGCTTACAAAGGTCTGGA
TGACCAAGATTTTGATATGCACGGCCAAGGTCTTGGTATGGATTTGAGCT
CAGAAGAAAGTCTTGCCATTCCTCCTTGCGAATTCAGCAAACTTAATGCC
TTGAATGAAACATTACAACGTTATTTACAAAGCAAAAATCTCCATGATGA
TCTAGTAACACTTTTAGAAGCCCAAGGATATATTCCAAAGTTGATAGAGA
TTTTTCATATGTGCGAAGACCTGGAAAATACTGACGCACTTCATACACTT
TATAGTATTTTCAAGACTTTATTCATGTTGGAAAAAAATGCAATATTTGA
AACGATGTTTTCTCAAGAGTACATTTTGGATATTGTTGGTATACTTGAGT
ACGATCCTTCAAAGACGACGCGGACACCTCATAGAGAGCATATCAATGAT
CGTGTCCAATTTAAAGAAGTGATTCCAATTGCAAACAAAGAACTACTTGC
TAAGATCCATCAGACTTTTCGAGTTCAGTATATAAAAGACATTTTAATTC
CTGTGCCATTGATTTTTGATGAGACTGGTACAACGCTGAGTTCCTTTATT
TTCTTCAATAAAGTCCAAATTATTGACCTAATAAAGGATGTCATAATTCT
CTGGACAGAAGTCGATGGCCCGAAAGAAACATTTGCGCTTAGTTTTATGG
ACCAAGAAAATAGGGATGATTTTTTAACTCATATTGAGGAGGTTCAGTCA
TCTTTAGAAATCCTGTCTCAACTAGAGTTCAATATCAGGAACAAGGGATG
AATAGGTATCATCAAGCCAGGACTCTGGAAAAAAGAGTCAAATTATACAA
GGCACAAGAGCAAGAATCTGGAGGAGAGCCAGCTTGGAAAGATCTTGGAG
TTGGTGATATCAATATAGTACCAAATTCTGATTCTGATTATTTTAGAAGC
AACTATTATGGGGGAATGATTATGCTGATGAATTCAGAAGAAGATGACGA
CTTCCAGCGTGCGACAGTGTTTGACAACATTGTGAACTTGTTGACTTTTT
GCGTGGAACATCATCAATCTTCTATCAAGAATTACATCGTCAGTAAAGAT
ATGTTACGCCGTGTTCTCGTTCTTTTACANATGCACGTTCTGACGTCTCC
CGTACTTGCTGTTACTGCCACGGATGAACTGGTCGGAAAAGAGCACGATT
GAACGTTCGGAATTCTTGAGTTTCTTTTATCGTCACAACGTATGAGTGTC
ATCCTACTGCAGACCCTACAAACGTTGCTGGACCCTGAAAACATGTGTCA
AACGGCTAATGATACAATGATGTTGAACGTCATGATCAGTCATCTCGTCA
ACTGTGAAACTGAAGAACATAGATGACAAAGACATCCAGCAAGCATTAAT
AGACATTGTTTGCACCATCACTGAGTGTACTCCATCCATCATTCGAATCT
ATGTTTGCCGTGAAGCATCTTACACCATTGACGAGATTCTTCTATTGAAA
GAACTTTGTGTTTATTCGCAATCGCTGCAACCAGCAAGACGAGAAGAATT
CATCAAAATGTTGGCAAATATTGGAATGTTGCAGTCTATCGAACAACTCT
TGGAGGATCAACATTTTCTTGATGAGTTGTTCGAACAATTGACGAATGAT
GAAGTATCTGATGACAAAAGGAAAGACATTACTAAATTGAAATTGGAACG
TAGTGATAAAAATGGGGATGCTTACAAAGGTCTGGATGACCAAGATTTTG
ATATGCACGGCCAAGGTCTTGGTATGGATTTGAGCTCAGAAGAAAGTCTT
GCCATTCCTCCTTGCGAATTCAGCAAACTTAATGCCTTGAATGAAACATT
ACAACGTTATTTACAAAGCAAAAATCTCCATGATGATCTAGTAACACTTT
TAGAAGCCCAAGGATATATTCCAAAGTTGATAGAGATTTTTCATATGTGC
GAAGACCTGGAAAATACTGACGCACTTCATACACTTTATAGTATTTTCAA
GACTTTATTCATGTTGGAAAAAAATGCAATATTTGAAACGATGTTTTCTC
AAGAGTACATTTTGGATATTGTTGGTATACTTGAGTACGATCCTTCAAAG
ACGACGCGGACACCTCATAGAGAGCATATCAATGATCGTGTCCAATTTAA
AGAAGTGATTCCAATTGCAAACAAAGAACTACTTGCTAAGATCCATCAGA
CTTTTCGAGTTCAGTATATAAAAGACATTTTAATTCCTGTGCCATTGATT
TTTGATGAGACTGGTACAACGCTGAGTTCCTTTATTTTCTTCAATAAAGT
CCAAATTATTGACCTAATAAAGGATGTCATAATTCTCTGGACAGAAGTCG
ATGGCCCGAAAGAAACATTTGCGCTTAGTTTTATGGACCAAGAAAATAGG
GATGATTTTTTAACTCATATTGAGGAGGTTCAGTCATCTTTAGAAATCCT
GTCTCAACTAGAGTTCAATATCAGGAACAAGGGATGAATAGGTATCATCA
AGCCAGGACTCTGGAAAAAAGAGTCAAATTATACAAGGCACAAGAGCAAG
AATCTGGAGGAGAGCCAGCTTGGAAAGATCTTGGAGTTGGTGATATCAAT
ATAGTACCAAATTCTGATTCTGATTATTTTAGAAGCAACTATTATGGGGG
AATGATTATGCTGATGAATTCAGAAGAAGATG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045595XLOC_045595Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073462-exon-scaffold_92-1575043694:156561..157075TCONS_00073462-exon-scaffold_92-1575043694:156561..157075Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:142628..142683TCONS_00073462-exon-scaffold_92-1575043694:142628..142683Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:142257..142361TCONS_00073462-exon-scaffold_92-1575043694:142257..142361Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:141371..142012TCONS_00073462-exon-scaffold_92-1575043694:141371..142012Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:141150..141227TCONS_00073462-exon-scaffold_92-1575043694:141150..141227Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:140841..140957TCONS_00073462-exon-scaffold_92-1575043694:140841..140957Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:140506..140625TCONS_00073462-exon-scaffold_92-1575043694:140506..140625Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:140138..140192TCONS_00073462-exon-scaffold_92-1575043694:140138..140192Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:139461..139531TCONS_00073462-exon-scaffold_92-1575043694:139461..139531Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:139158..139205TCONS_00073462-exon-scaffold_92-1575043694:139158..139205Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:137921..137981TCONS_00073462-exon-scaffold_92-1575043694:137921..137981Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1575043694:136919..137053TCONS_00073462-exon-scaffold_92-1575043694:136919..137053Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:156561..157075TCONS_00073462-exon-scaffold_92-1510915933:156561..157075Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:142628..142683TCONS_00073462-exon-scaffold_92-1510915933:142628..142683Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:142257..142361TCONS_00073462-exon-scaffold_92-1510915933:142257..142361Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:141371..142012TCONS_00073462-exon-scaffold_92-1510915933:141371..142012Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:141150..141227TCONS_00073462-exon-scaffold_92-1510915933:141150..141227Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:140841..140957TCONS_00073462-exon-scaffold_92-1510915933:140841..140957Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:140506..140625TCONS_00073462-exon-scaffold_92-1510915933:140506..140625Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:140138..140192TCONS_00073462-exon-scaffold_92-1510915933:140138..140192Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:139461..139531TCONS_00073462-exon-scaffold_92-1510915933:139461..139531Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:139158..139205TCONS_00073462-exon-scaffold_92-1510915933:139158..139205Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:137921..137981TCONS_00073462-exon-scaffold_92-1510915933:137921..137981Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1510915933:136919..137053TCONS_00073462-exon-scaffold_92-1510915933:136919..137053Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:156561..157075TCONS_00073462-exon-scaffold_92-1491911889:156561..157075Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:142628..142683TCONS_00073462-exon-scaffold_92-1491911889:142628..142683Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:142257..142361TCONS_00073462-exon-scaffold_92-1491911889:142257..142361Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:141371..142012TCONS_00073462-exon-scaffold_92-1491911889:141371..142012Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:141150..141227TCONS_00073462-exon-scaffold_92-1491911889:141150..141227Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:140841..140957TCONS_00073462-exon-scaffold_92-1491911889:140841..140957Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:140506..140625TCONS_00073462-exon-scaffold_92-1491911889:140506..140625Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:140138..140192TCONS_00073462-exon-scaffold_92-1491911889:140138..140192Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:139461..139531TCONS_00073462-exon-scaffold_92-1491911889:139461..139531Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:139158..139205TCONS_00073462-exon-scaffold_92-1491911889:139158..139205Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:137921..137981TCONS_00073462-exon-scaffold_92-1491911889:137921..137981Clytia hemisphaericaexon
TCONS_00073462-exon-scaffold_92-1491911889:136919..137053TCONS_00073462-exon-scaffold_92-1491911889:136919..137053Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073462-proteinTCONS_00073462-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:136919..157075 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.62788 3.63451 3.991 3.59146 33.3182 24.3957 16.1646 17.4451 8.94306 11.0563 8.68226 6.82699 5.60224 7.23964 7.52274 9.80392 10.386 10.104 5.92563 5.77615 9.66971 9.9863 9.89118 11.1191 8.08713 8.69614 6.67461 5.01691 8.07802 10.1242
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR006887DUF625
IPR011993PH_dom-like
IPR000156Ran_bind_dom
IPR016024ARM-type_fold
Vocabulary: Biological Process
TermDefinition
GO:0046907intracellular transport
Vocabulary: Molecular Function
TermDefinition
GO:0005488binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0046907 intracellular transport
molecular_function GO:0005488 binding
Blast
BLAST of TCONS_00073462 vs. Swiss-Prot (Human)
Match: P4R3A (Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens GN=PPP4R3A PE=1 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 1.653e-137
Identity = 236/566 (41.70%), Postives = 353/566 (62.37%), Query Frame = 2
Query:  350 KRVKLYKAQEQESGGEPAWKDLGVGDINIVPNSDSDYFRSNYYGGMIMLMNSEEDGSVIFRNPVSTRVQYQEQGDVIILWTEVDGPKETFALSFMDQENRDDFLTHIEETKLKLERSDKNGDAYKGLDDQDFDMHGQGLGMDLSSEESLAIPPCEFSKLNALNETLQRYLQSKNLHDDLVTLLEAQGYIPKLIEIFHMCEDLENTDALHTLYSIFKTLFMLEKNAIFETMFSQEYILDIVGILEYDPSKTTRTPHREHINDRVQFKEVIPIANKELLAKIHQTFRVQYIKDILIPVPLIFDETG-TTLSSFIFFNKVQIIDLIKEDQHFLDELFEQLTNDEVSDDKRKDIILLLKELCVYSQSLQPARREEFIKMLANIGMLQSIEQLLNIDDKDIQQALIDIVCTITECTPSIIRIYVCREASYTID------------EDTMMLNVMISHLVNCETE---GMSVILLQTLQTLLDPENMCQTANSTIERSEFLSFFYRHNMHVLTSPVLAVTATDELVGKDDFQRATVFDNIVNLLTFCVEHHQSSIKNYIVSKDMLRRVLVLL 1999
            +RVK+Y   E        W D G G ++      S Y       GM +L+ +E DGS++  + ++    YQ+Q D +I+W+E +      ALSF ++   D+    I + + K    D   D     +++ FD        D+SS   L +P CE S+L  + E +   L S    + L   LE +GYI KL+E+FH+CEDLEN + LH LY I K +F+L + A+FE MFS+E I+D++G LEYDP+ +    HRE +    +FKEVIPI++ EL  KIHQT+RVQYI+D+++P P +F+E   +TL SFIFFNKV+I+ +++ED+ FL +LF QLT++   ++KR++++  LKE C +SQ+LQP  R+ F K L+N+G+L ++E +L +DD  ++ A  DI   + E  PS++R +V +EA    D            +D +++N++I H++ C+T+   G +V L+  L+TL+DPENM  TAN T E++EFL FFY+H MHVLT+P+LA T  D+   KDDFQ A +   ++ LLTFCVEHH   IKNYI++KD+LRRVLVL+
Sbjct:    6 RRVKVYTLNEDRQ-----WDDRGTGHVS------SGYVER--LKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAEN--YDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFD--------DMSSP-GLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKITSKDILLINLIIEHMI-CDTDPELGGAVQLMGLLRTLVDPENMLATANKT-EKTEFLGFFYKHCMHVLTAPLLANTTEDK-PSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLM 544          
The following BLAST results are available for this feature:
BLAST of TCONS_00073462 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
P4R3A1.653e-13741.70Serine/threonine-protein phosphatase 4 regulatory ... [more]
back to top