Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073462-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00073462-protein
Unique NameTCONS_00073462-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length562

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00073462-protein ID=TCONS_00073462-protein|Name=TCONS_00073462-protein|organism=Clytia hemisphaerica|type=polypeptide|length=562bp
MNRYHQARTLEKRVKLYKAQEQESGGEPAWKDLGVGDINIVPNSDSDYFR
SNYYGGMIMLMNSEEDGSVIFRNPVSTRVQYQEQGDVIILWTEVDGPKET
FALSFMDQENRDDFLTHIEETKLKLERSDKNGDAYKGLDDQDFDMHGQGL
GMDLSSEESLAIPPCEFSKLNALNETLQRYLQSKNLHDDLVTLLEAQGYI
PKLIEIFHMCEDLENTDALHTLYSIFKTLFMLEKNAIFETMFSQEYILDI
VGILEYDPSKTTRTPHREHINDRVQFKEVIPIANKELLAKIHQTFRVQYI
KDILIPVPLIFDETGTTLSSFIFFNKVQIIDLIKEDQHFLDELFEQLTND
EVSDDKRKDIILLLKELCVYSQSLQPARREEFIKMLANIGMLQSIEQLLN
IDDKDIQQALIDIVCTITECTPSIIRIYVCREASYTIDEDTMMLNVMISH
LVNCETEGMSVILLQTLQTLLDPENMCQTANSTIERSEFLSFFYRHNMHV
LTSPVLAVTATDELVGKDDFQRATVFDNIVNLLTFCVEHHQSSIKNYIVS
KDMLRRVLVLLX
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_045595XLOC_045595Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00073462TCONS_00073462Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR006887DUF625
IPR011993PH_dom-like
IPR000156Ran_bind_dom
IPR016024ARM-type_fold
Vocabulary: Biological Process
TermDefinition
GO:0046907intracellular transport
Vocabulary: Molecular Function
TermDefinition
GO:0005488binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0046907 intracellular transport
molecular_function GO:0005488 binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3D1.25.10.10coord: 332..561
e-value: 5.9E-4
score: 18.7
IPR006887Domain of unknown function DUF625PFAMPF04802SMK-1coord: 197..386
e-value: 1.1E-67
score: 227.6
IPR011993PH domain-likeGENE3D2.30.29.30coord: 6..133
e-value: 3.8E-14
score: 52.3
IPR011993PH domain-likeSUPERFAMILY50729PH domain-likecoord: 10..121
IPR000156Ran binding domainPROSITEPS50196RANBD1coord: 1..127
score: 9.689
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 317..429

Blast
BLAST of TCONS_00073462-protein vs. Swiss-Prot (Human)
Match: P4R3A (Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens GN=PPP4R3A PE=1 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 1.422e-140
Identity = 236/566 (41.70%), Postives = 353/566 (62.37%), Query Frame = 0
Query:   12 KRVKLYKAQEQESGGEPAWKDLGVGDINIVPNSDSDYFRSNYYGGMIMLMNSEEDGSVIFRNPVSTRVQYQEQGDVIILWTEVDGPKETFALSFMDQENRDDFLTHIEETKLKLERSDKNGDAYKGLDDQDFDMHGQGLGMDLSSEESLAIPPCEFSKLNALNETLQRYLQSKNLHDDLVTLLEAQGYIPKLIEIFHMCEDLENTDALHTLYSIFKTLFMLEKNAIFETMFSQEYILDIVGILEYDPSKTTRTPHREHINDRVQFKEVIPIANKELLAKIHQTFRVQYIKDILIPVPLIFDETG-TTLSSFIFFNKVQIIDLIKEDQHFLDELFEQLTNDEVSDDKRKDIILLLKELCVYSQSLQPARREEFIKMLANIGMLQSIEQLLNIDDKDIQQALIDIVCTITECTPSIIRIYVCREASYTID------------EDTMMLNVMISHLVNCETE---GMSVILLQTLQTLLDPENMCQTANSTIERSEFLSFFYRHNMHVLTSPVLAVTATDELVGKDDFQRATVFDNIVNLLTFCVEHHQSSIKNYIVSKDMLRRVLVLL 561
            +RVK+Y   E        W D G G ++      S Y       GM +L+ +E DGS++  + ++    YQ+Q D +I+W+E +      ALSF ++   D+    I + + K    D   D     +++ FD        D+SS   L +P CE S+L  + E +   L S    + L   LE +GYI KL+E+FH+CEDLEN + LH LY I K +F+L + A+FE MFS+E I+D++G LEYDP+ +    HRE +    +FKEVIPI++ EL  KIHQT+RVQYI+D+++P P +F+E   +TL SFIFFNKV+I+ +++ED+ FL +LF QLT++   ++KR++++  LKE C +SQ+LQP  R+ F K L+N+G+L ++E +L +DD  ++ A  DI   + E  PS++R +V +EA    D            +D +++N++I H++ C+T+   G +V L+  L+TL+DPENM  TAN T E++EFL FFY+H MHVLT+P+LA T  D+   KDDFQ A +   ++ LLTFCVEHH   IKNYI++KD+LRRVLVL+
Sbjct:    6 RRVKVYTLNEDRQ-----WDDRGTGHVS------SGYVER--LKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAEN--YDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFD--------DMSSP-GLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKITSKDILLINLIIEHMI-CDTDPELGGAVQLMGLLRTLVDPENMLATANKT-EKTEFLGFFYKHCMHVLTAPLLANTTEDK-PSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLM 544          
The following BLAST results are available for this feature:
BLAST of TCONS_00073462-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
P4R3A1.422e-14041.70Serine/threonine-protein phosphatase 4 regulatory ... [more]
back to top