Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073458 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073458
Unique NameTCONS_00073458
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2886

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073458 ID=TCONS_00073458|Name=TCONS_00073458|organism=Clytia hemisphaerica|type=transcript|length=2886bp
AAACGGTTTTGTGACCCTTTAGGCCTACTTAACCATccctgaaagtttca
aaaagtcCCGAgtgttatttgatttttttggcgCTCTGCTCCCTGACTAA
TTTTGGTACTTGAAACTTGAAGAAGTGGGATTCTTGGTAGTGATAATCAT
GTTTTTTGAGAGTGTGTTATGATTTTCAATTAAGATGTGTGGTATATTGA
AGTATCTGGAAGGAAAACTATGAGCAGTACAATGTTTCTTTCTTTCAATG
CACCCATTGTAAAACGATTACTTCAATACAAAGTTGGAAACGGAGAAGAC
GTTTGGTCAGAAAAAGCTATCAAAAGTTTGGTCAAGAAACTGAAGAAAAA
TGGTGGACTTCAGGAGCTGGAAAAAGCAGTAATTAATCAAgGAAACAACG
GCTCAACAGAATGCGTAACCATCCCACGAAGTTTGGACGGACGCCTTCAA
GTCTCACATCGGAAGGGACTGCCACACGTCATCTACTGCCGCCTGTGGAG
GTGGGCGGACCTTCAAAGTCATCATGAGTTACGCGCCATCGATAGTTGTA
CGTACGCCTTCAACCTGAAGAGAGATTACGTTTGCGTCAACCCGTACCAT
TATTTACGCGTCGAAACTCCCGTGATGCCACCTATCCTGGTGCCACGACA
ACCGCGAGCGGGTGCGGATTCCACCGCCACCAAGGCTGAAGTGAAAGAAG
AAACGAAATCAACGGAAACTTTTCACACGCCAGATAACAAAACTATCGAA
GATGAAAGCTtATTGTCACCAGTCAGCCAGACGCTTTCAATACCATCGCT
ACCTTCCAACCCACAAAGTCCAGTTGCATCGCCTTCCATGAATACCAATC
AGAACAATTTTCAAGCGCCACAAAGTGTTGCACAACAAAGTCCGTCCGAC
GATCAACAATCTTtcccacaacaacaacaacaacaacagtttCAACAACC
GATGCAATGGTCCTCCAATAACACCACCGAGCATTCTCCCGCACAGCAGA
ACAACACGACACAACCACAAGACGCTCTGCAGCGACAACTTTCCTCTCAA
TCACAATCGCAAGCCCAATCACCTCTTAGTGATCTCAGTGACTgTCTTTC
AACACCAGGATCGTTGTTCTCACCGGCATCCATATCAGGTGCAAGTTGTA
TGACGGATATCGAACCAATGAACTTCAATAATATTTTGACGCCGCCAAAC
CAAGAAATCGTACCTGACGATTTCGACGCCGTTCTTTACGAAGAGCCGGA
TGAATGGTGTTCTATCAACTACAATGAATTACGTCAGCGGACGGGTGATA
CGTTTAGCGGTACGCGTCCTGTCCTTACGGTAGATGGGTACACGGACCCA
TCGAACACCGACAGATTTTGTCTAGGGCTGCTCTCCAATCCGAATCGAAC
GGATGATATAGAAGAATCGCGGCGTCACATCGGTAAAGGTGTTCGCTTGT
ATTATTTTGGCGGTGAGGTGTTCGCCGAATGCGTGAGCGATAGCAGTATC
TTCGTTCAAAGTTCCAATTGTAATCGACGCTACGGATGGCATCCAGCCAC
TGTCTGTAAAGTACCCTCCGGTTGTAATCTCAAGATCTTCAACAATCAAG
AATTTGCAAAGTTGTTAGCAGACTCTGTTCACTTGGGCTTTCACAATGTG
TACCAACTTAAGTCCATGTGTATGATTCGTTTGAGTTTCGTCAAAGGTTG
GGGAGCAGACTACCGTAGACAAACCGTCACCAGTACACCTTGCTGGATTG
AGATTCGCCTCAATGGTCCTCTCAAATGGTTGGACAAAGTATTGGTGCAG
ATGGGCGCCCCCGGAGATCGAGTCAGCTCAAACTCTTAAGAAAAAACAAT
AGCACATTGACAGATAGGAAAGGTAGacttaaaaaaaggaaaatatagCC
CAATATCATTTTTGAATGCTCGcgacttaaaaatgaaaaaaagtcctAAA
AGAAAACTctttataattttgtttttaaaatgtaatatttttatttttcg
ttcttCTTGTGAAATTAATTGCTTTTTGTTTCGTCGAATGAAGTATTGAA
ATACTTGTTGGCGAGGTGACGAAAATTTGCGAGTTATGGAATCAAAAGAT
GACGTAGTCGATGTTCTGAACTTTTTTTATTGGTATTTTGTAATTCAAAA
CACAGGCTGGTGTGGTGTGGCATTTTGTCATCGTTATTATCCTGTGGTAT
ACCACGATAAGTAAATACTCATCATGTAACTCTGTAACTCCGTAACTCGG
TTCTGTAACTCGGAAATTTTCCCTCTACCTCTCATTGTTATTGTTGTCAT
CTTTTTATGTTGTGCCAAAAACGTATTTTACATTTCTATACACCATGTAT
ATAAGTtttacctttttagaattttttttgtttttttggattgAATAATG
ACACAGCTTTAAGGCGACATATTATGTACATGAAAACCCCTCGGAAGGTC
AAGCATGTTCAATATATCAGTTTGATAGGGTGCAATTATCTTCAACTAAG
GTCAGTAAGGTGTCTAGTATTCAAGGTGGTCTTGTGCTATCGAAAAATAG
TATGCGCCTTCTCATGCCCCGTCACTCTTGGAAAAATATTCCCCCATGAG
AGATGAACTTTTCCATGGAGACAGCTTGCATGCCTGTCATTGTAGTCTAA
TGTCCAATGCATTTTGATGGCCTTGAGGTGTCAAAAATCCATTCTAGAAA
GAAGTGTGTAGATTTTATAGGATTTTttagtttgttgttttttagaaata
ttttattttttttgtgccCGCCATCGGATGATTCTGTTTTATTTTAAAGA
GAAGAAGAATTGGAGATTtgcttttttattatttttcaggttttttggTT
TTCATACTCTGTCTTATTCTAAGAATAAAAACCGAA
Run BLAST on NCBI

protein sequence of TCONS_00073458-protein

>TCONS_00073458-protein ID=TCONS_00073458-protein|Name=TCONS_00073458-protein|organism=Clytia hemisphaerica|type=polypeptide|length=539bp
MSSTMFLSFNAPIVKRLLQYKVGNGEDVWSEKAIKSLVKKLKKNGGLQEL
EKAVINQGNNGSTECVTIPRSLDGRLQVSHRKGLPHVIYCRLWRWADLQS
HHELRAIDSCTYAFNLKRDYVCVNPYHYLRVETPVMPPILVPRQPRAGAD
STATKAEVKEETKSTETFHTPDNKTIEDESLLSPVSQTLSIPSLPSNPQS
PVASPSMNTNQNNFQAPQSVAQQSPSDDQQSFPQQQQQQQFQQPMQWSSN
NTTEHSPAQQNNTTQPQDALQRQLSSQSQSQAQSPLSDLSDCLSTPGSLF
SPASISGASCMTDIEPMNFNNILTPPNQEIVPDDFDAVLYEEPDEWCSIN
YNELRQRTGDTFSGTRPVLTVDGYTDPSNTDRFCLGLLSNPNRTDDIEES
RRHIGKGVRLYYFGGEVFAECVSDSSIFVQSSNCNRRYGWHPATVCKVPS
GCNLKIFNNQEFAKLLADSVHLGFHNVYQLKSMCMIRLSFVKGWGADYRR
QTVTSTPCWIEIRLNGPLKWLDKVLVQMGAPGDRVSSNS
Run BLAST on NCBI

transcript from alignment at scaffold_92:89818..126321-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073458 ID=TCONS_00073458|Name=TCONS_00073458|organism=Clytia hemisphaerica|type=transcript|length=36504bp|location=Sequence derived from alignment at scaffold_92:89818..126321- (Clytia hemisphaerica)
AAACGGTTTTGTGACCCTTTAGGCCTACTTAACCATCCCTGAAAGTTTCA AAAAGTCCCGAGTGTTATTTGATTTTTTTGGCGCTCTGCTCCCTGACTAA TTTTGGTACTTGAAACTTGAAGAAGTGGGATTCTTGGTAGTGATAATCAT GTTTTTTGAGAGTGTGTTATGATTTTCAATTAAGATGTGTGGTATATTGA AGTATCTGGAAGGAAAACTATGAGCAGTACAATGTTTCTTTCTTTCAATG CACCCATTGTAAAACGATTACTTCAATACAAAGTTGGAAACGGAGAAGAC GTTTGGTCAGAAAAAGCTATCAAAAGTTTGGTCAAGAAACTGAAGAAAAA TGGTGGACTTCAGGAGCTGGAAAAAGCAGTAATTAATCAAGGTATATATA ATATTTTAGCTTTAGAAGTCTCAACAGTAAGTTTTAATGTGAATATCCCA AAATTAACTGTAAAAAGTTCTAATTTTATATTCAACATGACATGACAGTC CCCCATCAAATTCCAACAGCCACACTTCTTTCTATCTTTAAAAGATGGGA ATACAAAAAGGAGGCTGTGGTGAGTACTTTTAAGCTCAATATTTTGTTTA AAGAAAGGCGGCTGTCTCAAATATTATAAACTTATTTTGCTTTGCGTTGT TTTTTAGGCAGTAGGTTAAAAAAAAAGAGTCGGTCAATCAGTCTAAGCTT AAACTCCTATATCAGGATTGGAGACTAGGCTAGCGACTGCGACCTCTTTT ATCTTTCCCTTTACTAGCGACTCCAGAAGTCAGGCAACTTCAGTCAGGCA CATCCTGGCAAATGAACGGGGTATTTTTCACTTGCGACCATTGGCAAATG AACGGGGTCGAAAACGAAAGTGATGTAATAGTGCCNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTTTTAGCCTGAGACG TCCTATCTCATTTACACTGGGTGACGAATATCCCATGCAAATGCTCACCC TGTTCATTTGGCAGGATGTGCCTGACTGAACTTTTGTTGACGTCAAACCA AATGTTTCATTTTTCCGTGAACTTTAAACCCTTCAAACTTTTTTTCTGTG TACCAGTATGGATTTTGTGTAACTAACGCCGAAGACCTTCGGCGTACAAC TGAAAGCTTTTTTGGCGCATTGGCGTAAGGGTACTTACAAAGATTGTTTG ATTTTCAGTTGGCGTAAAGTAATAATTCCAGCTCGGCGTGAATGACTCCA TAATCCATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNATGAAGCACTTTGTTTGGATGATTGGAGATTTGTTGTCTGT AAGATGTGATGAGCTTCCACCACCTCCTGGTGATGTTTGTCTACCACTTC CTGAAGTCTTTCCATTTCCTGGTGTTTGTTTACCAGGGTTGATTGTTGTT GGTGATGAACAGTGTAGCATCTTGAGTTGTTGGATTGATATTTCTTTCTC TAGGAATTTGATGAATTCCTCCCAGATAGTTGATTGATGAAGTGTTTTCC CTTCAAGAAAGGAAAACCATTTGGTTTGGCGGGTGTCATCCATAAGTTGA TAAACATCCTCAAGTGTTTTTCCATAAAGAAGAAAGTTCTCAATTTGGTG TTTCTGAGCTAAGTTCATTGTATCTCTCATGAAGTTTAGCATTTTACTAA GCGACTCAATTTGTTTCTCCGGGTCACTTCTGACACGCCATAAACGAGTA GTGTTTTGAATATCAGACAGTTTCTTTGATAAAAGCAGTTTTGGGTCTCC GTACGATAACTTAAGTCTACGCCNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNACAAAAAACAGAAAGACACTGAAAAACAAGGAAAACT TAAATTTGTATATTTTTGTAAATTTTGAATATAATAAAATAAAACCAAGA AGAACACAAACATGAAATTTTGTATTTCACAAGTTTCTCAGTTTACAAGG ATGTGCCTGACTGAACTTTTGTTGACGTCAAACCAAATGTTTCATTTTTC CGTGAACTTTAAACCCTTCAAACTTTTTTTCTGTGTACCAGTATGGATTT TGTGTAACTAACGCCGAAGACCTTCGGCGTACAACTGAAAGCTTTTTTGG CGCATTGGCGTAAGGGTACTTACAAAGATTGTTTGATTTTCAGTTGGCGT AAAGTAATAATTCCAGCTCGGCGTGAATGACTCCATAATCCATTGATTTT TAGCTTTCATTTGGCTAAATTTGCTTTCACTCGCTTAAGCTTGCGTTAAT TTATTAATTATGTTGGCGCACGCGCCTCTTTTCCCATCATGCATGCATGC ACCCTTATTGAAAAAATTGAATGTTGGTACAAAAGAAATTTTGCTTGGCG CGAGGCTTGCTGTACGGAAAAATATCTTTGGCGCAAGATTTCGTAGAATC CATACTGGTCTATTTATGCTAAAGCGTTCCAGTTTTTACTAAAAGAAAGC CCGTGATCTTAGCTTTCCAGCGGGCTAGACGGCAAATTGGTAAAGTTGCA ACTATCGATGAACAAATGTTTCAGGAAATAGAGGAAAATGTAGTTGAAGG CTGAAACTTTGTATGTTTATCAGAAAAAGGGTGAGGAATTCAAAAATCAC AATCGCTAATTTTAGTTCTTTGATTTTCATGTAGTTTTATCACTTTTTTT CTTCTTTAGCATGGGAATGTCCCAAAAAAAAGTTTATATTTCTGCCGAAA TGGATTTTCTTTTCATTTGGGGTTTCTCCTTTCTGAAAAACTTATTCTTT ACTTATAACTTTTTGTTCCTTCATTTCCAGAGGCTCCTTGAAAATGGGTC CTATCAACTTTTTTGACTCATTTTCAACCATTTCCAAGCTAATTTTCTTC AAAAACAAAAATAAAACAATGCAATGTCTTCTTTTTTCAAGAAAATATAT ATCTTTCGTTATTTTCATAAATATACATATTTTACAAATATTTTTATATA ATAATATTCTAACACCATCAAAGAATTCTCCCTCTAAATTTCAGGTCTCT AGCTACACTAGAAAAAGAGATATGTAAAATTAAAGAAGCCTGACTGGGAA ATATCTTTTTTTTCTTTTTTGATACATTTTTCGAATTTTTCCAAGCTGTT TTCCTAACCTTTTTTTTGACATTTTTAGTCAAATTTTTGACACTAAAATT TCAATATCTTTACAACCACTTATCCTCTAGAGGCCTATGACCCCTCATTT TCTTTCTTTTTCAAAGCTCTACAAGAAAGGATAGGTTTTGAAGAAAAAAA TTAAAATTTGAAAAATCTTCTGGAGTTGCTTTTATTATTATTATTATTAA TTTATTTGGTAAAGAAGGTCTAAGTTTTGTTTTCTAAGTTTTGTAAAATA TACAATGCAGTAAAATACTAATGTGGACCTACTAAAATTGTAAAATAAAA TATAAGATAGTTATAAAAATATAAATAAATGGATGATATTTATTGCATGA TTATAATAAAATAAGTAAATTGTATAAATATGTAAAATCAATTAGTATTA AAGTCTTTATAAAAAAGTATATAAACCTGGATTTATTAGTTTAAGATTGT CCTGACTAGACCAGACACAGGAACGAGGGGATTGATTAATAAGTTGGTAT TAGGATAGAATTAATTAGCAAAACTTGAGACACAACCTACACCTACCTTT ACAATAATACAATGCTGACAAGTTGACACAACATAATGACAAGTAATCCC TGTGAGAGAAGTTTATATCGAAATCTGCAATAAAAACGAAAGTGGTCAGT TAGGAACATTTGGCAAGTTCCTGTACGCGGCCGCAATCAAAAAAATCATA GCATCACTCATTAAAAAATGGCGTTCGTGTCTTTTGGCACCCGTAGCCTC TCAGTGCAGTGAAGTCAAGTTTGAAGTTATTCTCTATTAGAAAAATGGTT AAAAGCAGTCAAAAGGCAATTTACCTTACCTCATGAATTTGTCTTTGTTA TGCTAAAATAAAACAAACCTTTTATCATGCTGTCTAATTACAAAAACCTC CAATCACTACTTCTCCGCCATCTTGTTTCACTTTAAATGCCGTATTTTAA AATGTCTCCCTTTCGACGTTGAGCCCCAGGGATACTTAATAATAAAAGAG ATTTTAAGATTAATGTTGAAATGCGTATTTTTCGATAAATTTAGGCGATA TTCAACAAAAAATAAGGTGGTTTTAAACAAATCTTTGACAAATTGGCATT TTTTTCTGTTCTAATATATATATATGTAAATCACGTCAAAAAAAGAAAAT TATTCCGCCTTTACTTTCACTTTCGCTTTCATGTTATGCGAATCTGATTG GATGAATACCGCTCGCTACTGCTCACTAACATATTCTGATTGGCTGTAAG TCTTTAGTTTTGGGATTCTGACTGGATCATTTCCCGCGCCACGGTTGAAT TTTGATTGGTTGAAAGTTTCTGATTGGATGAATACCTGAAAAGTAAACAT AGTATGTAAGTATTTTGGTTATCAAAACCTAAAGATTTCCAGGGGGTTTT ATTCATTTTTAACGACAATAATTAAGCCTACAAAACACCGAGAAAAAAAA ACAACATAGAACAGGTGTATTTTGTAATGCAGAATATGATAGTGTGAATC TTTTTGAAATTCTATGCTAGGATTTTTTCTCAATGCCACGTAACTATGCC TGGGGTGCCCGTCGCTAAGACCTTATGTTAAAAATGAAAGCGATTACAGC AAAAATTCATCAAAAATAGCAATTTTACTAATACCTCAAATATTGATACT TGACTGTACTGCATTGCCTTGCACAACGAGCGACGTGGCTGTAAAATCCC ACTCTTCATATATTTGTCTCAATCCGTGATCCTAAGGCTTAGGTTTTTTC TCAACTTCAATTTACTAAAGAAAGCGGGAATTCGATGCAAAAATTAGATT GTCAACAAAGCGCCGTAAAAAATCATTGAATAAAAGAAGAACTTTAAATC TTAAATATTTTCATTTTGAAGAATTGGTGCAAAAAAGTTTGAAACATGGA AAAGTTTCATTTTTTATTGGTTTGATCGCAATAGGGGACTTGGAAAACTT TCTCGTAGTAACTAAAAGGTGAAACGTCAGAGAAACGGGTAGAAACGACA CGGAAACAATATGGAAACGGGTGGAAACCAGTGGAAACGAAACGGAAATC TATGTAATAACGCTAGCCCAGCATTAAAGATACATCTCCGTCTATCACAG GCTTTGCATAACCGTAAGAGTATACGGATATAGGTAATCTATGAAAAAGT CGTTGCAGTGCAAATCTTTTGCAAATTTAAAAACCCACTTTCCCGTGGAA ATAATTGACGTTTTTTGTTTTTTTGGGACCCTTGGGGCATAAGCTACCCG TTGACCACAAAAATTCCAAAATTCTTGAATTGACCGTTGATAACATTAGA ACGGGACCCAATGACGTCACAAGTTTGGGAAAAACTTCAAAATGCGATAT CTCGAGTTTGAAAAGGAGTTGGGAGGCCGTTGACCCCTCATTGGATCGAG AATTTTAATGGAAAATAAGTTAGGAGGGGTAAGAGTGGGTATATAGAGAC TTTCAAAATTAAATATATTCAAATTGAGGCATCTTAGGTCCGATGACGTC ATCAAAAACTGAAAAATACAATATCTAGAGTTTGAGAAGGATTTAAGCAA TGATTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNGATTGACCCCTCATTGGATCGGAAATCATCATGAGCATA TATTTGGTCAATGAAGAAATAGTTACAGTAGAGTGAAAAGTTTATTACAC ATTCGATGACATTATTTAGAGCCCAAATGACGTAACAAAACATAAAATTT GTCATATCTTTACTTTTAAACCATTTTAAGTGGTAATTTTTCGTTCTTTG GGATTAATCCAGTCTATAGTTTCCCCTTTACTATCAAAAGGGCTTATAAT GCGTTCAGCTTATCTACTCCTCAGCGAGTTTATGAAAAATTTCTCAAATT TTGCCAAGGGGTTGATTCAAGTATGAAAGAGGGATTTCGTGCAGTTTTAA AACAAGAAATCTTATTGTTTTTCGAAAATGTAGTTATTATTTGGTCTTCT AAGGCGCGTCATGTTGACCTCAAATTCGTAAATACAGCAAGCAACATTTT TTTTATATATTTTCCATTCTTACACACTGATGATATATTGACGCTCTCAA TTTGACGTTTTACTGCTCAAGTCAATAAGTTTCCGTTTTCGATTAAATTG AAATCGCTTTCAAACTTACTGAAGAAACTCTCACAATTGAAGATTTATTA TTTAGTAAGCTTTTATTTACTATTTATTTACTATTTCTTATTAAGAAGTC CCATTCTATCTCTTATTCCATTTGAAGCATAAAAAGATATTTACGATATG ATATGTACTCCCGTGGTTGATGAAAACTTATTTTAATTCCCCTTAAAAAT AAACAATACCATCTTTATCATCCTAAGGGCTTTGCTAAACTGGCGTTTGC GACGACGGGAACCGACTAATGATACAACAGAAGCTTTGTTCACTGTTGGT CGTTTACCTGTTTTCAATCGTTTCTCCCCGTTTCCAATCGTTTCTCCCCG TTTCCATGTCATTTCCACCAGTTTCCCTGACGTTTCTCCCCGTTTCCAGG GCGATTCCCCCCGTTTCCATATCGTTTCCAGGGCCAAATTGAAAAGTGGT CAACCAAAACACGAAATCAAAAATCTTACAAACAAAATAAGTAACTGTGA TTTTTTTTAAAAATAACCCTTAAATTTTCCAATTTCAACTTTTAAATCAA CTGAGCCGCCTTTTTAGTCTCTGTAATCAGGTGATTATATCGAAACACAA CTAGTGAGGTTTGTCACGGAAGGACAAGTGTTAAAATATAATGGACCTTC TTTTTAAAAATAAATGATTAATCAAAAATGAAATGTTGTTTTAAAACAAG TACATACCCTAGTTAGTTTAATAGGTTTGTTCATTTTGAAATAAGTCAAA CAACAAAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNCTCCAGTACAGCGCTGTAAGCTTACAGCGTAAGCCCAGGCA GCTCTGGAGGCCTAAAAACCGGTTTTCTGGCAAAACTACTGTTCCCAGCG GGTTCTAAAGGATCAAAATCGCTTCAGCACCATGGAAATTTGCTAATTAG AGTCTTTGGAAGTAGCTCAATTGCTTGCAAGGTTGCGTTTTTACGTTTTT TGCTTAAAAAAGCCTTAAAAACGCTTATATAGTGCTTTTTAAGCGTTTTA AAGCTATTTTAGTGAAAATTTGTCGGTTCTGCCCCCTTCACTGGACTTCA ATGGGTCTAGTCCCAGGGCCGGCGAATCGGTTTTAAAAGTGAGGGGGCTA AATGATATTAGTGACTAAGGAGGCCCCACCATGGTTGGGGCCGACGGGCC GGAAAATTTTTGAAATTATGGCACTCTACATTGGCCTAGAAGTGGTCTAA ATTTTAATTTTTGTGAAGTTATTGGGATGAAAAAATCAAAAAAGTTAGGC GTTTTTTTATACTGATAATCACCAAAGAGTATACTACTATATAATAACAA CATGAAACCCTTTAAGTAAATAAAGCGAACTTTTACATGTTCAAAATTCA TAAGTAAAAGTAGATTGGGAGCTTTAACAGTAAGTATACAGTAATAAAAA TTAAAATTTTCCAAAGTAATTAAAGCAATGCTCTCGAGTCGACACAAACT CTCTACCAACTTCATCTAAATCAAGTTTATCCGTTAGATTTTTATATGGA TATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNTTTCTTCTAGTGGTATTTTGGTTTTAA AATTCTCTTTAAATTCACAGGAATCTGAATCAGCATACTTTTGTCTTTTT TAATGTCTTTGCTGCGTTCCTTCCGTAACAGAACCTTCAAAGCTCAATTA TTCAACGCGGAAAAACTTTTATGAAATTTATTTTGGATTTGGAAGTAGTA GTACTATGAAGGCTTTAATTCAGGACCAATACTATTTTCATTAAGTTTAC CATTTTTCAAAAATAGACCAAAAAAGGCTCTGATTTCCTTCCGTGACAGA AACGGGACTTTTCAATTTGGCCCTTAACCTGTTTCTCTGACGTTTCACGT TTTAGTTATTACGAAACTTTCTATGTTTGGTTTTTTGCACAAACCCCTGT AACTATGGGCTAGCATTCCTTGCAAAAATGTTGGCTTGAAATTGAAAGTG AAACCACTGAAAATGAAAGTAAAATCGGCCCGCACTCCAAATCTCGTAAT CTTGATATAGCTATAGGAGTTTAAGCATAGACTGTCAGTCAATAGTTCTT TTGGAGAACGCGACAGCCTATTGAATAACTAATTACTCCACAACCAGTAA GTGGAAGTACCTCGATCTTAAGCATGTTTAAAGTTCACAATAACGACTTT GTTGTCAAAGAGATTTAACAGGCCAGATATCAACAGTCCCATGTTACGAC CAATCATCCCAAGTTGGAGCAGTTTCGGTAGAGTTTGAGTTTGAAGTGTT TATTTTTTACAAGAAAACTTGATTTTATAGTTTAANNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACCTATTT GCCACGGGAAAAAAAGAAGGTTCGATTTCTTTGCCCATGTCGGCATTTGC CGACATGGTCAAAAGGTAGCGATTTTGACTTCATTTTCTGAATAATATAT GAAGTATCAGCCAAGGACTATAATTTTGAGTTGAACATTGTTGNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAATGGAAATCATAA CTAGACACTTTAAGTCTTTCAAAACCTGCAAAGGTTTGTATCTAAATATA CTTCAGTTGGTCCAGATTGCTTTATACAAATATTACTGATTAAAGTGTCC CGTTATTACCCCCAAATGGGAAAAAAGCTGGTGTAAAAATGGGACACTAT CACTAATTTTGTCGAAAGTCCTTTAAATGATAGCACTTGGATTTGAAGTC ATCATGTGGGTGTAAAACCTCAAATATCCTTTTAGAAAGATTTCTGTATT TTTCAATAACATTTTATACCTGTCCCATATTTTCCCCGAGGGTGTCCCAT AATTACCCCCAAAATGCGGGATAACTTTTAAAATAAATTCAATAATAAAA ATCACCATCAATAAAGATCTTTTCCAGCCCGCCAAAGTGCTTTATAAATG AAGAAAACACGCCAAAAGATACTCTACAATACAGAAAGTGCCATCGTTTA GTCAATTACCTTTGCAAAGAGCTGCCGCACTTTATCAAATCCAGATATGC TTGTCTAAAAAGAAGTTTCCAGTGTTAAAACTGTACCAAGATCGCACCAC AGGTAATGGAAAGGTATAATTCAAATCAAAAATCAAAAATTGAAGGATGC AAAAACGAAATCAAAGCCTGTGAGAATAAAATGAAACGACAGGCCGAAGA AATAAACCATTTGAAATCACAAGACGTCAATGTTATAGTCAACGAAATGA AAGACAACACAACCTGAACCTAAAGATGGAATTTGATAAAAATCTAACAA TTTTGCAACAGATGTGTCTTTACACTCTAGAATCCTGCTGAAATGCGTAT AAAAGATTAATGCTGCAAAAGCACTATATCGTTTACTAGACTTGCAAGCA GAAATGCACTGCAAAATTTCTAAAGGAATTCATGAAAAAATAAACTGGCG CTTTTTGATGAAATTAACATTTTCAAAAACTATGAGAGTTTACCTAAATT TTCAACCAAAGATAAAAAAATTTGAACCGAGCCAACTTGAAAACTAATTT GAAGAATAACTTCCCAAGAAAAAGATCTATGGGGGAGAAGACAACCACCT AGATCTGCGCACAATCAGGATATTTCCCAGAAATTTTGTCAGACCTCAAA CACTGACCTATTAAATAACAAAATTTGGTTGGTTGATTAGCTGGATGCTT TCATTTCAAGTTTTTCAAATTTTAATTAATTGTCTTGGGATCATGAACTT GATTCAGGTAACTCTCATCCTTGTTGTTGCAAATACATCCTGTAGATGAC CGATGTTGTTTTTCTATATGAGGATTAGAAACTAGATTACATCCACTTCT GCTGACAGTAGTTAACACAATACATTGGCAAAAGAATCTCCCATGTCAGT TAGTCACACCTAACGTCCCGCCAAAATGAGTATCAAAGATTAATGCTGCA AAATCGCAAGTCAAAGAATCTGTGCAAAACTTCTAAAGGAAATTATTAGA GAAATACACTGGTGTTTTTTGATGAAACGAACATTATAAAACCCCCTAGG TGCAAAATTTCAAACATAAAGATAAATATAAATCTAGTAGATGGCATAGG ACCAGCAGAAATTTCTGGGCTGGACAGAGATGGCCGTCTGGCTGAACTCA AGTCTCCAGAGTTGCAGTATGTTGAAGGTGGAGTTTGCAGGGGTTAGTCT AGAAAAATAGCATCCCTCATTGGTGTTTTGACAAAGGGTGTCGTTGAGTT GTTGCTTGTAGTGGATCCGGCCATCCAATTTAGTTGGTTAGATGTACTTG AAATCTTAAAAATTGGGCGACGATGTGCAGTCTTTCATTAGGGCCAGTGT TTTCTGTGATCAGTCGTTTGTCTTGACACACACCAATTTTGGCAATTGGA ATGTGGGAACGCTAGAGAAGATCGTTGATGGACTCCCCAGTTCTTCAAAA AGATTATTATACATATTTACAAGCTAGGCTCACAGTGGGCCTCTAACCGA TCTTATTTTACACTATTCTTGAATCGTATTTTGAGGGATGGTTTTCCCAT GCATCGTTGAGGTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNTATTGTTGTTTTATCGTAGTAGTGGAGGTGTTTG TAAACCTGTACCATATCACAAAATCGTCTTCGAAATTCGAGTGTTGGTAA GCCGAGAATTTTGAGCCTACCACTATATGAAAGGCTGCGGTACGTTGGGA CCAATCTTGTTGCACGTCTTTGCACTTCCTCGAGTAAGTTGACGTGTTTA CGTAATGTTGGTGACCAAACTGATTGTGCGTACTCAAGGTGTGGTCAGAC AAATGATGAGTATAGTGTACGGAGGATCTCTGGAGTTAAGTTGGTGAAAC CTCGTTTGATGACACCAAGCATTGAGTTGGCTTTTTTTACTTGATTGGCT ATATGGTCTTCAAATGTCAATTCAGCATCAACCAATATNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCTCAAGCTGAATA TCACCAAGACGATACGGATGAGCGTGTTTTATATTTACGAATTTGCCGAT TGTAAGAACGTGACATTTATCCGGATGGAACTGTAATAACCAATCAATGG ACCATTTTTCGAGTGTGTCTATATCACTTTGTATGGCAAGCGAGTCATGG ACTGAAACTACCTCTTTGAAGATCTTTGTATCATCTGCGAAAAGTAGCAG ATCCGAAATCACCTTGTCGGGCAGATCATTTATGTACAGTACAAAGAGTA GAGGGCCCAAGACACTTCCTTGTGGTATTCCACTTAAAACACTATCTATG TTGGATTTTGCTTGGTTTACTTTTACCAACTGCTTCCTTCTACTCAGAAA CGATGAAATCCAGTTCTTTATTGATCCAACTATGCCATACCCTTCTAGCT TTTTGCAAAGCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNTTTCAATAGTTGAGTAACAGTGGAACGTCTACTGATGAAGC CATACTGCTTATCTGATAAAAGGTTTAAGTTTGTCAGGTGGTTTGTGATA TGTTCTCGTAATATCGACTCCATCAGCTTGCAAACCACGGATGTTAAACT CACTGGTCTGTAATTGATGGCCAAGTTATGCGCGCCTTTGTTCTTGAAGA TGGGCGTGACGTGTGCAACCTTCCAATCATCAGGTAGTACTCCTTCAACC AGTGTCTTATTCATAAGCCTTGAAAGGGGCTCGGAAATTTCATCGACAAG TTCTTTCAACATTCTTGGATGTATTTCATCATGACCAAAAGATTTGTTTG TATCCAGATCTTTGATTTTCTTACTTATCATATCTTTAGTTATGATGATG TCTGCAATATCTTGTTCTGTTCTTCGTGGAAATTCCGGAAGTTCTCCCTC AGGCTCGATGGTAAAGACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACTTCTTACA TGCGACCAAAAGACCTTTGGTTTCGTTTTGGCTTTAGTGCATATGTTTCG TTCGTATGTTCTATGTGCTTGCGACATCATCCGATTTACCCTGTGGTAAG ATGGTGGTGGTATGTAATAGGAATTCTTGTCCTTCGTCTGGCTAGTTCCT CGGTGATACTAAAGGGGAAAACTGTTGGCAAAGATAATCAATCAGACCTT TCAATCCTTCTTGAGTGGGTCAATTATGGGAAAATTTGAGTATCAGGTTA TGTTTCACAGATAAGTTGAAATGGATTTACTGGAGATACGAAGGTGGACT TGGTTGAGATGGAGCTGACATTACAATCATGGCATTGTTGTTGAATATCC TCGGTGATGCCTGTCAAGAATACTGATTTTTAATGAATACTGATGTCCAG CCGACAACGGCAAGTGAGTAGGGGCCCATTAGGCAGCAGTTATCTTTAGA TATCTTAAGTTGGACTGGACTTTAAATGTTGGTTTGCGGTCACCCACTTT TAAAATCTTGAGGGAATTCCCCTTTTGTGCCAAATATTACAGTGGTGATT CTAGAAGGGAATTCACAATTGTTAAGATGGAAGGAACGAGACAGGCACAA CGGAGGTTCTGATTTGAAGAAAATCAATCTTCTTCAAAATGGCAATAAAA CTTTTTAGGTCAGCAGATTTTGAGGTAGGTATAGTCGGATGACCAGGGAT GACGGCAAACCAACATTTTCCAGCCTTAGTTCTATTAAAATCAAGTAACA AAAAACTTTCCATAGAAAAGGTTATTTTTCATGCAAAATATGATGATTAT ATATTAAACAAAGTCTATTTCAAATTATCTGGCAGTGTTATTTCAAACCT CAATAACTTTTTTTTGATTTTGTGCTTGTTGAAAAGGCAAACAGGAGTGG GATACTGTCATAAAGAAAAAACTCAAAAAAGATCGGAAAATGAAGAAGAA GAAAATCAACTTCTTCAACAATTGTGCTATAATTGTCATTTTCACACAAG TAATTCTTTGATCTTAGGACATCATTAATGTGAAAAAACTTTTCACAAAA ATTTATTTTATCGAAAGATATAGTCCAAAGTTCAACAATCAAAAATCAAC AAAAAAGAGTCCTTTTTTAAGTCAACCAAAGCAAAGTTTTGAGCTTTATT TTTTGATTGAATGAATATTTTTTGCATCTTTTTTCGCATTTATGACTTTT TAAGATTGAAGAGTTTCTGATACAAAAATGAAGATCGTTGCATTATTCTA CAAGAAGTTGATTTTCTTCTTCTTCATTTGTCATCTTCGTTTTTCCATCT TTTGATTTTTTTTCTTTTTTGATAATATTCCACTCCGGATTATGTTTTTA ACGAGTAAAAAACCGCTAACGAATTCAAATTCTATCAACATTTATTGAGG TTTGAAAAAACACTGCCAGCAAATTTGAAATAGACTTTAGTTTTTAATAC TTTTGGCGTACAAACTTTTGTGAGCAGAAACTTTTTCAATTTTCGCAAAT TTTATCCTTTTTTGCGAAAGTCTTTGAAAAATTTTGAAAGTTTTTTCTCG TGAAAGATTCTTGACAAAATAGAAAATGTGTAAAACTTCAAACTTAAAAT GAAATGAAAGACTTAAAGGCACTTTCTAGCTTATCAAAGCCTTCAAACCA ATTTCCGTGCTTTTTTAGCGCCTGGTTGTTGGAAGGTTGCACGCATCCCC TCTGATATATTTTGATATAGGCAATGTGTATCGTGTATAGAATCCCCGCC TGAGATTTACCCCCCCGTCTTTTTGTTTTTTAAGCTTTAGAAGCTTGATT TAGGCTGTTTGTTTTTCCCACAATTACCTATGATGAGCAAATCAAAAGTG AAGCCAAAATCCCACAATATTGGTTATTGTGAACTCTAGCATCAATACAA TAAAAAAGTGCGCAATAGATATTTTGATTATTCACCATGAAATTGTACGA CATTGTGATATAGAAATTGTCTGTTATAAAAGGTCAAAAGTCTCAATATC AATATTAATTTTTCAGTCTTCAGCCTATTGATCCTGACGACGATTTGGAA TTTGAAAATTATTCCATTTAGGCCTTTTGCAATATGGCGGATCTTTCTTT CAAAAACAATTTCTCCACTGCCGCCTGCCTCCTTTTCTAATGATATCATG CTGACGTCAACATTTTGCAACTCGCCCAGTTTAGAAGCGCTTTTTTTAAG AAAAAAAAGATAGTTATTTAAAGACTAAAATCAATTACGCTGCAGACTTC AGGTAGCTGGTGCAAAGATTGATACACACTATTATTAAGGTCGCCAAAGG TTTTGCTTTCACTCACAACTCGACTTTCCAAGTGTATCGGCTTCTTGGGA TCGCAATAGTGCACCGCGCTGAATCTAAAAATAGATTTTATTTTTGACAT AATCATTACTCTCGATGTGTTTTTACGAGTTCCAATCCCATCAACCTTTG CGTTAATCTCTTTGGAACGTTAATTGCATCATTTGAAAAAGATATGTAAC AGCTTGCACGTATCTTTAATTGAGCCGCATTGAATTGTGGGATTGCAACT CGTACAAATGTCAAAAAGACGATGGTACGGATGGACCACGTGAAGGTTGT CGTCAATCTCCATCGGCGAACCAAAAAGTCAATCGAATATTAAAATAAAC CTAAAAGGCCTTTCTTAGGAAAAGGAACCTTGTCGTAAAATTATTTTTTC CGTTTCAGGAAACAACGGCTCAACAGAATGCGTAACCATCCCACGAAGTT TGGACGGACGCCTTCAAGTCTCACATCGGAAGGGACTGCCACACGTCATC TACTGCCGCCTGTGGAGGTGGGCGGACCTTCAAAGTCATCATGAGTTACG CGCCATCGATAGTTGTACGTACGCCTTCAACCTGAAGAGAGATTACGTTT GCGTCAACCCGTACCATTATTTACGCGTCGAAACTCCCGGTAAGAAGTTG TTGAGTTGTTGTAGTTACGTCGTTGCTTTACCAATTTTGTGCCTGTTATA AGCAATGATATCAAATACGACTGCGTACTGATATTACATTTCTGCTTTGT ATTTGTAACATATTGAACATCTGACCAAAATCTGAACTTATACAGTGAAG TTTTAATACATTGTTAACTGAAGGGGCCAGAAAACTAAAATTAAAATCAT AGTGGTTCGAGTTGTGAACACTTGGCTGTATCACAGTTGTCTGTACGTTG ATAACTCGAGTATTTATATCGTATTTTTAATCCTTTTCCCAGTGATGCCA CCTATCCTGGTGCCACGACAACCGCGAGCGGGTGCGGATTCCACCGCCAC CAAGGCTGAAGTGAAAGAAGAAACGAAATCAACGGAAACTTTTCACACGC CAGATAACAAAACTATCGAAGATGAAAGCTGTAAGTTTTCTCTCCTATAT CTTTCTTGTTTGTTCGGATTAGTTAGAAATTAAAGGCTCCTCCCGAATGT GTGGTAAATATTGTGACGAGTTTATCATAATTCAAGATTATTATTCCGGC ATGGTTTGTTGTCATGGTTTCTCCTGAACTTGCCAATAGCTCCTTCTTCG GATTGAATGGAGAACTTATACGCTTGCTGTGTATAAATCAATGGAAGTCT TTGTTGTCTTTTTAGTATTGTCACCAGTCAGCCAGACGCTTTCAATACCA TCGCTACCTTCCAACCCACAAAGTCCAGTTGCATCGCCTTCCAGTAAGCA TCAATGCTCCATTTCCTTATTATATCAACCTAACAATCTTAAATTCGTCG TTCAAGACATGGCTAATCTTATGCTTTTCCTTCAAACCCTTCAGGTAGAA CCCTCTGAAATGAGAAAAACATTGAATATCGATTTTCTTCGAATTTTGCT TGAAAAGCGCTCTGATCGTGAATTGTTTTCTGGCACACACTTAGTAGCAA TTAACTTAATAGAATTTACACATTATTTTGCTTTTGTAGTGAATACCAAT CAGAACAATTTTCAAGCGCCACAAAGTGTTGCACAACAAAGTCCGTCCGA CGATCAACAATCTTTCCCACAACAACAACAACAACAACAGTTTCAACAAC CGATGCAATGGTCCTCCAATAACACCACCGAGCATTCTCCCGCACAGCAG AACAACACGACACAACCACAAGACGCTCTGCAGCGACAACTTTCCTCTCA ATCACAATCGCAAGCCCAATCACCTCTTAGTGATCTCAGTGACTGTAAGA TAGATATCCTTTCTTCTTCTTGAAGAAATTTTTTCAAACAATACAACAGA TTTTGTGAAATCAAGTGCGTATTACTTATGGGTAATGAATCAACGGATCC TGCACTAATGTACTTCCCAGTTTTTCTCAAAGGTAACGAATCAGTTCTCT CAAAGTTAGCGGGTTGGTTGGAGATTGGACACTAGCTGTGTCTCGGTTCG TGGCAATTCCATTGATTCGAAGAATTCAGGTACCGGATGGTGAACATTGA GCACGTCGCTCCCCTCGTCTACTACGAACTAGTGTAATAGCAACGAACCG ATATCGCAGTTGGGAGAGCAATCGTCCGGCAAGCGAGAGGTCGTGGGTTC AATCCCCACTCGATTCGTTACCTTTGAGAAAACTGGGAAGTACATTAGTG CAGGATCCGTTGATTCATAACAGATTTTCATTGGCAAGTTTTCTGATGGT ACAACTCTATTATATATGTATAATACATCGGAGCCTCCATAAATCGAACA CGCACGGGGAACACAGGTTTGCTCGAGTTAAAGAAATTTCGAGTTATGGG ATAATGTTTATAAAGCATTGTTAACTAAACGGAACATGCAACTTGTTCGA GTTAAGGAGACATTCGAATTATAGATGTTCGAATCAAGGAGACTTCACTG TGCAGCAGACGTAATAACAGACCTGTAAATAACCTCGTATTTTGTAGAAT TTTATAATTCTCAGTTCTACTAAATCTACTTTTTCTTTTTCACCTAACGA TCTTTCATTTCTTTCAACAAAAACAGGTCTTTCAACACCAGGATCGTTGT TCTCACCGGCATCCATATCAGGTAACATTCATTCACCCAAAAAATACTTT CAATGGAATTGTCAATCATCACTGTTGTTTTGGTTTGGCTCCTATCTAGC ATTTACCTCTAGTGATCGGTAATTTTTCAATCAATCAATCGATAGATTTT CATCGGTGCTGGTCATCATCTTAAAATACTTTTACCTGTTGGTGAAGTTG ACTGTGTGAGCAAATAGCAGAGCGATTTTTTTTAATGAATGTTTCTTTAC CATGACAGGTGCAAGTTGTATGACGGATATCGAACCAATGAACTTCAATA GTATGTCAACATCTTACTTTTACTTTTACATCTACATCTGTTTTTTTCGT TTTTGCCACCCTTGCAGTCTACCATGCCATTCTTGTGAAGAGATTTCAGC TTAGTTATTGGCCGTTTGTAAAATTCTTTTGTTATTGACCAAAGACGGTA TGAAGATTTTAAATGAAAATCAAATAAATTAAGCATCAATTAGAGAAATG ACATTAAAGCCAGATTGAATAACGCAAATTAAAGAACTCATTTTTCATTT CTTTGCTTTACCTTGCTGATGCTTCTTCAGAACATTAAAGTAGACAATCT TTACCTTTTTCTTTGCAGATATTTTGACGCCGCCAAACCAAGAAATCGTA CCTGACGGTAAGTTTACGATAAATTCCTTAACCTCACTGCTTACAGTAAA CCAGTAAAGACTACGCTGACTGAATCTCTGATGACAACAATACTCTAATG GTTAAAGGTTCATCCATACGCGTACATTTTTAATACCGCGTAATCTATCC TACACGTTTAAATTGTCCAGTTAAAACATGTGTCAAAAAGTCTTGAATTT CACATTTTAAAAATTTGACTTAAATTGATCTTTCTGATACCAGCTGACTT GGCGATCTTTGAGATTTCAAAACAAAATATCTTTCTGATTGTTTGAATAA AGCCGACTTTAAAACTTTATGCACTTGAGTTAGGTGATCTACAAAATTTT AGAAGAATGAACTTTCAACCTAAACTACTACACTGTTTTCTAGCATTTAA TCTTGTATTTTGTAAATATGTTGCTTGACTTGACTTGACAACATTGTATT CGGTTAATGAAGCATTTTTCACTAATTTCACTTAATTCATAAATCACATC TCGTCGATGGCTGTGACATCGCAATTTTTGTTTCTAAGGCTGAATCATCT CCAAGCCTTGAGAGTATTACTAATATTTATTAACCCATGTCTATCTCGAT TTTGCAGGGCCCTTTGTTTTCCCTAGACACTTCACCATTATTGATTTTCC CCACTTTTGTAGCAGGTTGAGGTCTGACTTTTGTTTTGTCTAGACAGAGT TTTAACCTGGAGAGTTTGTCTGTATGAGTCGATGATGTCTGGAAAATCAC TTTTTCGACGTTTGTGAGTAAAAACTTTTATTGGAGGATTTTGTACTGCA CTGGAAATTGTCTTTACAAGAAGAGCTCGGATGAGAATGACATTGTTTCG AGCACGTATATTTTTTTCACGTAAGGTCACATTCTTAAACGTCATTCCAA GAAGATAAACAGGCTGATCTTTATTTCATTCACTGCAAATTCTACAAATT GTCTCTTTTTGTTTTGTCTAGAGAGAAATTCCTGATAAAGCATATCTCGA CTGAAGAGAATTGTATGAGGTTTTTTTATCTGTTGGAGAGAAGTTTTCAG GCTAGACGTGGTGGATCAAAATTAATCTGATTTAATTAAGAGAAAATGCT CGTCTAATCTGGGAATTATAACTTTAGTACGTTTCATATTTTCGTCAGAA ATTTGAATGTTAGAATCTATAACCTAAAATTCTCCCTTCTTATTCAAAGC TTCATTAAAAGGTATTTCAAACAATTTATATAACAGAATTTGGAAAGTCT TTCGTTTCTTATAAAAGAAACTCCATGTGAAGAGGTTTTGAGTTCTCTCG TGTTGTTGTTTAGCAAAGCAGATGTTTTGTCTGTATTTTCTCTCGTCAGT TTTCTTCAGACTAAATATCGACTTTGGTTTTGTAACAATTATGCAATGAT AACAAGATGTCAATTTCCCTTTTTCTGAAAATGAAATCTGATGAACTTAT TGCATCTTTTCCCAAGAAAATTGTTTCCAGTCAAACACTTCCACCTTTCC AATACTTCTCATTATGCACCACCAAAGTTCAAGCTTTCATTCGTCAGACG ATTATCGCTAAAAACTTGGCTACTAACAAACTCGTATTTTGATGAATTAA TCCCTCGATTGTTAGCTATCACATTCCGCCTAAAAATAACTTTCAGTTGA CGAAAATAAAGCCTTCTTCGGCTGATCATTTGATGATCTTTTTTGTTTTT GTTGTGGAATCATAAGATTGAAAAATGTGGCTCAAATGATAGACTTATTT GCATTAGNGAAAATGCTCGTCTAATCTGGGAATTATAACTTTAGTACGTT TCATATTTTCGTCAGAAATTTGAATGTTAGAATCTATAACCTAAAATTCT CCCTTCTTATTCAAAACTTCATTCAAAGGTGTTGCAAACAACTGATATAA CAGAAGTTGGAAAGTCTTTCGTTTCTTATAAAAGAAACTCCATGTGAAGA GGTTTTGAGTTCTCTCGTGTTGTTGTTTAGCAAAGCAGATGTTTTGTCTG TATTTTCTCTCGTCAGTTTTCTTCAGACTAAATATCGACTTTGGTTTTGT AATAATTATGCAATGATAACAAGATGTCAATTTCCCTTTTTCTGAAAATG AAATCTGATGAACTTATTGCATCTTTTCCCAAGAAAATTGTTTCCAGTCA AACACTTCCACCTTTCCAATACTTCTCATTATGCACCACCAAAGTTCAAA CTTTCATTCGTCAGACGATTATCGCTAAAAACTTGGCTACTAACAAACTC GTATTTTGAAATAATCCCTCGATTGTTAGCTATCACATTCCGCCTAAAAA TAACTTTCAGTTGACGAAAATAAAGCCTGCTTCGGCTGATCATTTGATGA TCTTTTTTGTTTTTTTGTTTTTGTTGTGGAATCATAAGATTGAAAAATGT GGCTCAAGTGATAGACTTATTTGCATTAGCTGAAACCACTCGTTGATGAT CTGGATTAAAAGCTAGACATTCGGTTGGTTTAACAGAAAGAATGCGGAAT TATAAAAATCGTTTATAATTTTTGGAATTTTATTAAGAGCTTTAATGTTA CAAAATAGGGAGAGACCTAAAAGATTAGAAATCGATACATATTCAACCTT CGCATATGAAAAGTATGAAATGTTTTTTCTCGGAATGGAAACAAATTTAC GAATTGTATTTTGTAACTCCTTTTATTCTTTTCGTAGATTTCGACGCCGT TCTTTACGAAGAGCCGGATGAATGGTGTTCTATCAACTACAATGAATTAC GTCAGCGGACGGGTGATACGTTTAGCGGTACGCGTCCTGTCCTTACGGTA GATGGGTACACGGACCCATCGAACACCGACAGATTTTGTCTAGGGCTGCT CTCCAATCCGAATCGAACGGATGATATAGAAGAATCGCGGCGTCACATCG GTAAAGGTGTTCGCTTGTATTATTTTGGCGGTGAGGTGTTCGCCGAATGC GTGAGCGATAGCAGTATCTTCGTTCAAAGTTCCAATTGTAATCGACGCTA CGGATGGCATCCAGCCACTGTCTGTAAAGTACCCTCCGGTTGTAATCTCA AGATCTTCAACAATCAAGAATTTGCAAAGTTGTTAGCAGACTCTGTTCAC TTGGGCTTTCACAATGTGTACCAACTTAAGTCCATGTGTATGATTCGTTT GAGTTTCGTCAAAGGTTGGGGAGCAGACTACCGTAGACAAACCGTCACCA GTACACCTTGCTGGATTGAGATTCGCCTCAATGGTCCTCTCAAATGGTTG GACAAAGTATTGGTGCAGATGGGCGCCCCCGGAGATCGAGTCAGCTCAAA CTCTTAAGAAAAAACAATAGCACATTGACAGATAGGAAAGGTAGACTTAA AAAAAGGAAAATATAGCCCAATATCATTTTTGAATGCTCGCGACTTAAAA ATGAAAAAAAGTCCTAAAAGAAAACTCTTTATAATTTTGTTTTTAAAATG TAATATTTTTATTTTTCGTTCTTCTTGTGAAATTAATTGCTTTTTGTTTC GTCGAATGAAGTATTGAAATACTTGTTGGCGAGGTGACGAAAATTTGCGA GTTATGGAATCAAAAGATGACGTAGTCGATGTTCTGAACTTTTTTTATTG GTATTTTGTAATTCAAAACACAGGCTGGTGTGGTGTGGCATTTTGTCATC GTTATTATCCTGTGGTATACCACGATAAGTAAATACTCATCATGTAACTC TGTAACTCCGTAACTCGGTTCTGTAACTCGGAAATTTTCCCTCTACCTCT CATTGTTATTGTTGTCATCTTTTTATGTTGTGCCAAAAACGTATTTTACA TTTCTATACACCATGTATATAAGTTTTACCTTTTTAGAATTTTTTTTGTT TTTTTGGATTGAATAATGACACAGCTTTAAGGCGACATATTATGTACATG AAAACCCCTCGGAAGGTCAAGCATGTTCAATATATCAGTTTGATAGGGTG CAATTATCTTCAACTAAGGTCAGTAAGGTGTCTAGTATTCAAGGTGGTCT TGTGCTATCGAAAAATAGTATGCGCCTTCTCATGCCCCGTCACTCTTGGA AAAATATTCCCCCATGAGAGATGAACTTTTCCATGGAGACAGCTTGCATG CCTGTCATTGTAGTCTAATGTCCAATGCATTTTGATGGCCTTGAGGTGTC AAAAATCCATTCTAGAAAGAAGTGTGTAGATTTTATAGGATTTTTTAGTT TGTTGTTTTTTAGAAATATTTTATTTTTTTTGTGCCCGCCATCGGATGAT TCTGTTTTATTTTAAAGAGAAGAAGAATTGGAGATTTGCTTTTTTATTAT TTTTCAGGTTTTTTGGTTTTCATACTCTGTCTTATTCTAAGAATAAAAAC CGAA

Coding sequence (CDS) from alignment at scaffold_92:89818..126321-

>TCONS_00073458 ID=TCONS_00073458|Name=TCONS_00073458|organism=Clytia hemisphaerica|type=CDS|length=14580bp|location=Sequence derived from alignment at scaffold_92:89818..126321- (Clytia hemisphaerica)
ATTTCGACGCCGTTCTTTACGAAGAGCCGGATGAATGGTGTTCTATCAAC
TACAATGAATTACGTCAGCGGACGGGTGATACGTTTAGCGGTACGCGTCC
TGTCCTTACGGTAGATGGGTACACGGACCCATCGAACACCGACAGATTTT
GTCTAGGGCTGCTCTCCAATCCGAATCGAACGGATGATATAGAAGAATCG
CGGCGTCACATCGGTAAAGGTGTTCGCTTGTATTATTTTGGCGGTGAGGT
GTTCGCCGAATGCGTGAGCGATAGCAGTATCTTCGTTCAAAGTTCCAATT
GTAATCGACGCTACGGATGGCATCCAGCCACTGTCTGTAAAGTACCCTCC
GGTTGTAATCTCAAGATCTTCAACAATCAAGAATTTGCAAAGTTGTTAGC
AGACTCTGTTCACTTGGGCTTTCACAATGTGTACCAACTTAAGTCCATGT
GTATGATTCGTTTGAGTTTCGTCAAAGGTTGGGGAGCAGACTACCGTAGA
CAAACCGTCACCAGTACACCTTGCTGGATTGAGATTCGCCTCAATGGTCC
TCTCAAATGGTTGGACAAAGTATTGGTGCAGATGGGCGCCCCCGGAGATC
GAGTCAGCTCAAACTCTTAAATATTTTGACGCCGCCAAACCAAGAAATCG
TACCTGACGGTGCAAGTTGTATGACGGATATCGAACCAATGAACTTCAAT
AGTCTTTCAACACCAGGATCGTTGTTCTCACCGGCATCCATATCAGTGAA
TACCAATCAGAACAATTTTCAAGCGCCACAAAGTGTTGCACAACAAAGTC
CGTCCGACGATCAACAATCTTTCCCACAACAACAACAACAACAACAGTTT
CAACAACCGATGCAATGGTCCTCCAATAACACCACCGAGCATTCTCCCGC
ACAGCAGAACAACACGACACAACCACAAGACGCTCTGCAGCGACAACTTT
CCTCTCAATCACAATCGCAAGCCCAATCACCTCTTAGTGATCTCAGTGAC
TTATTGTCACCAGTCAGCCAGACGCTTTCAATACCATCGCTACCTTCCAA
CCCACAAAGTCCAGTTGCATCGCCTTCCATGATGCCACCTATCCTGGTGC
CACGACAACCGCGAGCGGGTGCGGATTCCACCGCCACCAAGGCTGAAGTG
AAAGAAGAAACGAAATCAACGGAAACTTTTCACACGCCAGATAACAAAAC
TATCGAAGATGAAAGCTGAAACAACGGCTCAACAGAATGCGTAACCATCC
CACGAAGTTTGGACGGACGCCTTCAAGTCTCACATCGGAAGGGACTGCCA
CACGTCATCTACTGCCGCCTGTGGAGGTGGGCGGACCTTCAAAGTCATCA
TGAGTTACGCGCCATCGATAGTTGTACGTACGCCTTCAACCTGAAGAGAG
ATTACGTTTGCGTCAACCCGTACCATTATTTACGCGTCGAAACTCCCGAT
GAGCAGTACAATGTTTCTTTCTTTCAATGCACCCATTGTAAAACGATTAC
TTCAATACAAAGTTGGAAACGGAGAAGACGTTTGGTCAGAAAAAGCTATC
AAAAGTTTGGTCAAGAAACTGAAGAAAAATGGTGGACTTCAGGAGCTGGA
AAAAGCAGTAATTAATCAAGATTTCGACGCCGTTCTTTACGAAGAGCCGG
ATGAATGGTGTTCTATCAACTACAATGAATTACGTCAGCGGACGGGTGAT
ACGTTTAGCGGTACGCGTCCTGTCCTTACGGTAGATGGGTACACGGACCC
ATCGAACACCGACAGATTTTGTCTAGGGCTGCTCTCCAATCCGAATCGAA
CGGATGATATAGAAGAATCGCGGCGTCACATCGGTAAAGGTGTTCGCTTG
TATTATTTTGGCGGTGAGGTGTTCGCCGAATGCGTGAGCGATAGCAGTAT
CTTCGTTCAAAGTTCCAATTGTAATCGACGCTACGGATGGCATCCAGCCA
CTGTCTGTAAAGTACCCTCCGGTTGTAATCTCAAGATCTTCAACAATCAA
GAATTTGCAAAGTTGTTAGCAGACTCTGTTCACTTGGGCTTTCACAATGT
GTACCAACTTAAGTCCATGTGTATGATTCGTTTGAGTTTCGTCAAAGGTT
GGGGAGCAGACTACCGTAGACAAACCGTCACCAGTACACCTTGCTGGATT
GAGATTCGCCTCAATGGTCCTCTCAAATGGTTGGACAAAGTATTGGTGCA
GATGGGCGCCCCCGGAGATCGAGTCAGCTCAAACTCTTAAATATTTTGAC
GCCGCCAAACCAAGAAATCGTACCTGACGGTGCAAGTTGTATGACGGATA
TCGAACCAATGAACTTCAATAGTCTTTCAACACCAGGATCGTTGTTCTCA
CCGGCATCCATATCAGTGAATACCAATCAGAACAATTTTCAAGCGCCACA
AAGTGTTGCACAACAAAGTCCGTCCGACGATCAACAATCTTTCCCACAAC
AACAACAACAACAACAGTTTCAACAACCGATGCAATGGTCCTCCAATAAC
ACCACCGAGCATTCTCCCGCACAGCAGAACAACACGACACAACCACAAGA
CGCTCTGCAGCGACAACTTTCCTCTCAATCACAATCGCAAGCCCAATCAC
CTCTTAGTGATCTCAGTGACTTATTGTCACCAGTCAGCCAGACGCTTTCA
ATACCATCGCTACCTTCCAACCCACAAAGTCCAGTTGCATCGCCTTCCAT
GATGCCACCTATCCTGGTGCCACGACAACCGCGAGCGGGTGCGGATTCCA
CCGCCACCAAGGCTGAAGTGAAAGAAGAAACGAAATCAACGGAAACTTTT
CACACGCCAGATAACAAAACTATCGAAGATGAAAGCTGAAACAACGGCTC
AACAGAATGCGTAACCATCCCACGAAGTTTGGACGGACGCCTTCAAGTCT
CACATCGGAAGGGACTGCCACACGTCATCTACTGCCGCCTGTGGAGGTGG
GCGGACCTTCAAAGTCATCATGAGTTACGCGCCATCGATAGTTGTACGTA
CGCCTTCAACCTGAAGAGAGATTACGTTTGCGTCAACCCGTACCATTATT
TACGCGTCGAAACTCCCGATGAGCAGTACAATGTTTCTTTCTTTCAATGC
ACCCATTGTAAAACGATTACTTCAATACAAAGTTGGAAACGGAGAAGACG
TTTGGTCAGAAAAAGCTATCAAAAGTTTGGTCAAGAAACTGAAGAAAAAT
GGTGGACTTCAGGAGCTGGAAAAAGCAGTAATTAATCAAGATTTCGACGC
CGTTCTTTACGAAGAGCCGGATGAATGGTGTTCTATCAACTACAATGAAT
TACGTCAGCGGACGGGTGATACGTTTAGCGGTACGCGTCCTGTCCTTACG
GTAGATGGGTACACGGACCCATCGAACACCGACAGATTTTGTCTAGGGCT
GCTCTCCAATCCGAATCGAACGGATGATATAGAAGAATCGCGGCGTCACA
TCGGTAAAGGTGTTCGCTTGTATTATTTTGGCGGTGAGGTGTTCGCCGAA
TGCGTGAGCGATAGCAGTATCTTCGTTCAAAGTTCCAATTGTAATCGACG
CTACGGATGGCATCCAGCCACTGTCTGTAAAGTACCCTCCGGTTGTAATC
TCAAGATCTTCAACAATCAAGAATTTGCAAAGTTGTTAGCAGACTCTGTT
CACTTGGGCTTTCACAATGTGTACCAACTTAAGTCCATGTGTATGATTCG
TTTGAGTTTCGTCAAAGGTTGGGGAGCAGACTACCGTAGACAAACCGTCA
CCAGTACACCTTGCTGGATTGAGATTCGCCTCAATGGTCCTCTCAAATGG
TTGGACAAAGTATTGGTGCAGATGGGCGCCCCCGGAGATCGAGTCAGCTC
AAACTCTTAAATATTTTGACGCCGCCAAACCAAGAAATCGTACCTGACGG
TGCAAGTTGTATGACGGATATCGAACCAATGAACTTCAATAGTCTTTCAA
CACCAGGATCGTTGTTCTCACCGGCATCCATATCAGTGAATACCAATCAG
AACAATTTTCAAGCGCCACAAAGTGTTGCACAACAAAGTCCGTCCGACGA
TCAACAATCTTTCCCACAACAACAACAACAACAACAGTTTCAACAACCGA
TGCAATGGTCCTCCAATAACACCACCGAGCATTCTCCCGCACAGCAGAAC
AACACGACACAACCACAAGACGCTCTGCAGCGACAACTTTCCTCTCAATC
ACAATCGCAAGCCCAATCACCTCTTAGTGATCTCAGTGACTTATTGTCAC
CAGTCAGCCAGACGCTTTCAATACCATCGCTACCTTCCAACCCACAAAGT
CCAGTTGCATCGCCTTCCATGATGCCACCTATCCTGGTGCCACGACAACC
GCGAGCGGGTGCGGATTCCACCGCCACCAAGGCTGAAGTGAAAGAAGAAA
CGAAATCAACGGAAACTTTTCACACGCCAGATAACAAAACTATCGAAGAT
GAAAGCTGAAACAACGGCTCAACAGAATGCGTAACCATCCCACGAAGTTT
GGACGGACGCCTTCAAGTCTCACATCGGAAGGGACTGCCACACGTCATCT
ACTGCCGCCTGTGGAGGTGGGCGGACCTTCAAAGTCATCATGAGTTACGC
GCCATCGATAGTTGTACGTACGCCTTCAACCTGAAGAGAGATTACGTTTG
CGTCAACCCGTACCATTATTTACGCGTCGAAACTCCCGATGAGCAGTACA
ATGTTTCTTTCTTTCAATGCACCCATTGTAAAACGATTACTTCAATACAA
AGTTGGAAACGGAGAAGACGTTTGGTCAGAAAAAGCTATCAAAAGTTTGG
TCAAGAAACTGAAGAAAAATGGTGGACTTCAGGAGCTGGAAAAAGCAGTA
ATTAATCAAGATTTCGACGCCGTTCTTTACGAAGAGCCGGATGAATGGTG
TTCTATCAACTACAATGAATTACGTCAGCGGACGGGTGATACGTTTAGCG
GTACGCGTCCTGTCCTTACGGTAGATGGGTACACGGACCCATCGAACACC
GACAGATTTTGTCTAGGGCTGCTCTCCAATCCGAATCGAACGGATGATAT
AGAAGAATCGCGGCGTCACATCGGTAAAGGTGTTCGCTTGTATTATTTTG
GCGGTGAGGTGTTCGCCGAATGCGTGAGCGATAGCAGTATCTTCGTTCAA
AGTTCCAATTGTAATCGACGCTACGGATGGCATCCAGCCACTGTCTGTAA
AGTACCCTCCGGTTGTAATCTCAAGATCTTCAACAATCAAGAATTTGCAA
AGTTGTTAGCAGACTCTGTTCACTTGGGCTTTCACAATGTGTACCAACTT
AAGTCCATGTGTATGATTCGTTTGAGTTTCGTCAAAGGTTGGGGAGCAGA
CTACCGTAGACAAACCGTCACCAGTACACCTTGCTGGATTGAGATTCGCC
TCAATGGTCCTCTCAAATGGTTGGACAAAGTATTGGTGCAGATGGGCGCC
CCCGGAGATCGAGTCAGCTCAAACTCTTAAATATTTTGACGCCGCCAAAC
CAAGAAATCGTACCTGACGGTGCAAGTTGTATGACGGATATCGAACCAAT
GAACTTCAATAGTCTTTCAACACCAGGATCGTTGTTCTCACCGGCATCCA
TATCAGTGAATACCAATCAGAACAATTTTCAAGCGCCACAAAGTGTTGCA
CAACAAAGTCCGTCCGACGATCAACAATCTTTCCCACAACAACAACAACA
ACAACAGTTTCAACAACCGATGCAATGGTCCTCCAATAACACCACCGAGC
ATTCTCCCGCACAGCAGAACAACACGACACAACCACAAGACGCTCTGCAG
CGACAACTTTCCTCTCAATCACAATCGCAAGCCCAATCACCTCTTAGTGA
TCTCAGTGACTTATTGTCACCAGTCAGCCAGACGCTTTCAATACCATCGC
TACCTTCCAACCCACAAAGTCCAGTTGCATCGCCTTCCATGATGCCACCT
ATCCTGGTGCCACGACAACCGCGAGCGGGTGCGGATTCCACCGCCACCAA
GGCTGAAGTGAAAGAAGAAACGAAATCAACGGAAACTTTTCACACGCCAG
ATAACAAAACTATCGAAGATGAAAGCTGAAACAACGGCTCAACAGAATGC
GTAACCATCCCACGAAGTTTGGACGGACGCCTTCAAGTCTCACATCGGAA
GGGACTGCCACACGTCATCTACTGCCGCCTGTGGAGGTGGGCGGACCTTC
AAAGTCATCATGAGTTACGCGCCATCGATAGTTGTACGTACGCCTTCAAC
CTGAAGAGAGATTACGTTTGCGTCAACCCGTACCATTATTTACGCGTCGA
AACTCCCGATGAGCAGTACAATGTTTCTTTCTTTCAATGCACCCATTGTA
AAACGATTACTTCAATACAAAGTTGGAAACGGAGAAGACGTTTGGTCAGA
AAAAGCTATCAAAAGTTTGGTCAAGAAACTGAAGAAAAATGGTGGACTTC
AGGAGCTGGAAAAAGCAGTAATTAATCAAGATTTCGACGCCGTTCTTTAC
GAAGAGCCGGATGAATGGTGTTCTATCAACTACAATGAATTACGTCAGCG
GACGGGTGATACGTTTAGCGGTACGCGTCCTGTCCTTACGGTAGATGGGT
ACACGGACCCATCGAACACCGACAGATTTTGTCTAGGGCTGCTCTCCAAT
CCGAATCGAACGGATGATATAGAAGAATCGCGGCGTCACATCGGTAAAGG
TGTTCGCTTGTATTATTTTGGCGGTGAGGTGTTCGCCGAATGCGTGAGCG
ATAGCAGTATCTTCGTTCAAAGTTCCAATTGTAATCGACGCTACGGATGG
CATCCAGCCACTGTCTGTAAAGTACCCTCCGGTTGTAATCTCAAGATCTT
CAACAATCAAGAATTTGCAAAGTTGTTAGCAGACTCTGTTCACTTGGGCT
TTCACAATGTGTACCAACTTAAGTCCATGTGTATGATTCGTTTGAGTTTC
GTCAAAGGTTGGGGAGCAGACTACCGTAGACAAACCGTCACCAGTACACC
TTGCTGGATTGAGATTCGCCTCAATGGTCCTCTCAAATGGTTGGACAAAG
TATTGGTGCAGATGGGCGCCCCCGGAGATCGAGTCAGCTCAAACTCTTAA
ATATTTTGACGCCGCCAAACCAAGAAATCGTACCTGACGGTGCAAGTTGT
ATGACGGATATCGAACCAATGAACTTCAATAGTCTTTCAACACCAGGATC
GTTGTTCTCACCGGCATCCATATCAGTGAATACCAATCAGAACAATTTTC
AAGCGCCACAAAGTGTTGCACAACAAAGTCCGTCCGACGATCAACAATCT
TTCCCACAACAACAACAACAACAACAGTTTCAACAACCGATGCAATGGTC
CTCCAATAACACCACCGAGCATTCTCCCGCACAGCAGAACAACACGACAC
AACCACAAGACGCTCTGCAGCGACAACTTTCCTCTCAATCACAATCGCAA
GCCCAATCACCTCTTAGTGATCTCAGTGACTTATTGTCACCAGTCAGCCA
GACGCTTTCAATACCATCGCTACCTTCCAACCCACAAAGTCCAGTTGCAT
CGCCTTCCATGATGCCACCTATCCTGGTGCCACGACAACCGCGAGCGGGT
GCGGATTCCACCGCCACCAAGGCTGAAGTGAAAGAAGAAACGAAATCAAC
GGAAACTTTTCACACGCCAGATAACAAAACTATCGAAGATGAAAGCTGAA
ACAACGGCTCAACAGAATGCGTAACCATCCCACGAAGTTTGGACGGACGC
CTTCAAGTCTCACATCGGAAGGGACTGCCACACGTCATCTACTGCCGCCT
GTGGAGGTGGGCGGACCTTCAAAGTCATCATGAGTTACGCGCCATCGATA
GTTGTACGTACGCCTTCAACCTGAAGAGAGATTACGTTTGCGTCAACCCG
TACCATTATTTACGCGTCGAAACTCCCGATGAGCAGTACAATGTTTCTTT
CTTTCAATGCACCCATTGTAAAACGATTACTTCAATACAAAGTTGGAAAC
GGAGAAGACGTTTGGTCAGAAAAAGCTATCAAAAGTTTGGTCAAGAAACT
GAAGAAAAATGGTGGACTTCAGGAGCTGGAAAAAGCAGTAATTAATCAAG
ATTTCGACGCCGTTCTTTACGAAGAGCCGGATGAATGGTGTTCTATCAAC
TACAATGAATTACGTCAGCGGACGGGTGATACGTTTAGCGGTACGCGTCC
TGTCCTTACGGTAGATGGGTACACGGACCCATCGAACACCGACAGATTTT
GTCTAGGGCTGCTCTCCAATCCGAATCGAACGGATGATATAGAAGAATCG
CGGCGTCACATCGGTAAAGGTGTTCGCTTGTATTATTTTGGCGGTGAGGT
GTTCGCCGAATGCGTGAGCGATAGCAGTATCTTCGTTCAAAGTTCCAATT
GTAATCGACGCTACGGATGGCATCCAGCCACTGTCTGTAAAGTACCCTCC
GGTTGTAATCTCAAGATCTTCAACAATCAAGAATTTGCAAAGTTGTTAGC
AGACTCTGTTCACTTGGGCTTTCACAATGTGTACCAACTTAAGTCCATGT
GTATGATTCGTTTGAGTTTCGTCAAAGGTTGGGGAGCAGACTACCGTAGA
CAAACCGTCACCAGTACACCTTGCTGGATTGAGATTCGCCTCAATGGTCC
TCTCAAATGGTTGGACAAAGTATTGGTGCAGATGGGCGCCCCCGGAGATC
GAGTCAGCTCAAACTCTTAAATATTTTGACGCCGCCAAACCAAGAAATCG
TACCTGACGGTGCAAGTTGTATGACGGATATCGAACCAATGAACTTCAAT
AGTCTTTCAACACCAGGATCGTTGTTCTCACCGGCATCCATATCAGTGAA
TACCAATCAGAACAATTTTCAAGCGCCACAAAGTGTTGCACAACAAAGTC
CGTCCGACGATCAACAATCTTTCCCACAACAACAACAACAACAACAGTTT
CAACAACCGATGCAATGGTCCTCCAATAACACCACCGAGCATTCTCCCGC
ACAGCAGAACAACACGACACAACCACAAGACGCTCTGCAGCGACAACTTT
CCTCTCAATCACAATCGCAAGCCCAATCACCTCTTAGTGATCTCAGTGAC
TTATTGTCACCAGTCAGCCAGACGCTTTCAATACCATCGCTACCTTCCAA
CCCACAAAGTCCAGTTGCATCGCCTTCCATGATGCCACCTATCCTGGTGC
CACGACAACCGCGAGCGGGTGCGGATTCCACCGCCACCAAGGCTGAAGTG
AAAGAAGAAACGAAATCAACGGAAACTTTTCACACGCCAGATAACAAAAC
TATCGAAGATGAAAGCTGAAACAACGGCTCAACAGAATGCGTAACCATCC
CACGAAGTTTGGACGGACGCCTTCAAGTCTCACATCGGAAGGGACTGCCA
CACGTCATCTACTGCCGCCTGTGGAGGTGGGCGGACCTTCAAAGTCATCA
TGAGTTACGCGCCATCGATAGTTGTACGTACGCCTTCAACCTGAAGAGAG
ATTACGTTTGCGTCAACCCGTACCATTATTTACGCGTCGAAACTCCCGAT
GAGCAGTACAATGTTTCTTTCTTTCAATGCACCCATTGTAAAACGATTAC
TTCAATACAAAGTTGGAAACGGAGAAGACGTTTGGTCAGAAAAAGCTATC
AAAAGTTTGGTCAAGAAACTGAAGAAAAATGGTGGACTTCAGGAGCTGGA
AAAAGCAGTAATTAATCAAGATTTCGACGCCGTTCTTTACGAAGAGCCGG
ATGAATGGTGTTCTATCAACTACAATGAATTACGTCAGCGGACGGGTGAT
ACGTTTAGCGGTACGCGTCCTGTCCTTACGGTAGATGGGTACACGGACCC
ATCGAACACCGACAGATTTTGTCTAGGGCTGCTCTCCAATCCGAATCGAA
CGGATGATATAGAAGAATCGCGGCGTCACATCGGTAAAGGTGTTCGCTTG
TATTATTTTGGCGGTGAGGTGTTCGCCGAATGCGTGAGCGATAGCAGTAT
CTTCGTTCAAAGTTCCAATTGTAATCGACGCTACGGATGGCATCCAGCCA
CTGTCTGTAAAGTACCCTCCGGTTGTAATCTCAAGATCTTCAACAATCAA
GAATTTGCAAAGTTGTTAGCAGACTCTGTTCACTTGGGCTTTCACAATGT
GTACCAACTTAAGTCCATGTGTATGATTCGTTTGAGTTTCGTCAAAGGTT
GGGGAGCAGACTACCGTAGACAAACCGTCACCAGTACACCTTGCTGGATT
GAGATTCGCCTCAATGGTCCTCTCAAATGGTTGGACAAAGTATTGGTGCA
GATGGGCGCCCCCGGAGATCGAGTCAGCTCAAACTCTTAAATATTTTGAC
GCCGCCAAACCAAGAAATCGTACCTGACGGTGCAAGTTGTATGACGGATA
TCGAACCAATGAACTTCAATAGTCTTTCAACACCAGGATCGTTGTTCTCA
CCGGCATCCATATCAGTGAATACCAATCAGAACAATTTTCAAGCGCCACA
AAGTGTTGCACAACAAAGTCCGTCCGACGATCAACAATCTTTCCCACAAC
AACAACAACAACAACAGTTTCAACAACCGATGCAATGGTCCTCCAATAAC
ACCACCGAGCATTCTCCCGCACAGCAGAACAACACGACACAACCACAAGA
CGCTCTGCAGCGACAACTTTCCTCTCAATCACAATCGCAAGCCCAATCAC
CTCTTAGTGATCTCAGTGACTTATTGTCACCAGTCAGCCAGACGCTTTCA
ATACCATCGCTACCTTCCAACCCACAAAGTCCAGTTGCATCGCCTTCCAT
GATGCCACCTATCCTGGTGCCACGACAACCGCGAGCGGGTGCGGATTCCA
CCGCCACCAAGGCTGAAGTGAAAGAAGAAACGAAATCAACGGAAACTTTT
CACACGCCAGATAACAAAACTATCGAAGATGAAAGCTGAAACAACGGCTC
AACAGAATGCGTAACCATCCCACGAAGTTTGGACGGACGCCTTCAAGTCT
CACATCGGAAGGGACTGCCACACGTCATCTACTGCCGCCTGTGGAGGTGG
GCGGACCTTCAAAGTCATCATGAGTTACGCGCCATCGATAGTTGTACGTA
CGCCTTCAACCTGAAGAGAGATTACGTTTGCGTCAACCCGTACCATTATT
TACGCGTCGAAACTCCCGATGAGCAGTACAATGTTTCTTTCTTTCAATGC
ACCCATTGTAAAACGATTACTTCAATACAAAGTTGGAAACGGAGAAGACG
TTTGGTCAGAAAAAGCTATCAAAAGTTTGGTCAAGAAACTGAAGAAAAAT
GGTGGACTTCAGGAGCTGGAAAAAGCAGTAATTAATCAAGATTTCGACGC
CGTTCTTTACGAAGAGCCGGATGAATGGTGTTCTATCAACTACAATGAAT
TACGTCAGCGGACGGGTGATACGTTTAGCGGTACGCGTCCTGTCCTTACG
GTAGATGGGTACACGGACCCATCGAACACCGACAGATTTTGTCTAGGGCT
GCTCTCCAATCCGAATCGAACGGATGATATAGAAGAATCGCGGCGTCACA
TCGGTAAAGGTGTTCGCTTGTATTATTTTGGCGGTGAGGTGTTCGCCGAA
TGCGTGAGCGATAGCAGTATCTTCGTTCAAAGTTCCAATTGTAATCGACG
CTACGGATGGCATCCAGCCACTGTCTGTAAAGTACCCTCCGGTTGTAATC
TCAAGATCTTCAACAATCAAGAATTTGCAAAGTTGTTAGCAGACTCTGTT
CACTTGGGCTTTCACAATGTGTACCAACTTAAGTCCATGTGTATGATTCG
TTTGAGTTTCGTCAAAGGTTGGGGAGCAGACTACCGTAGACAAACCGTCA
CCAGTACACCTTGCTGGATTGAGATTCGCCTCAATGGTCCTCTCAAATGG
TTGGACAAAGTATTGGTGCAGATGGGCGCCCCCGGAGATCGAGTCAGCTC
AAACTCTTAAATATTTTGACGCCGCCAAACCAAGAAATCGTACCTGACGG
TGCAAGTTGTATGACGGATATCGAACCAATGAACTTCAATAGTCTTTCAA
CACCAGGATCGTTGTTCTCACCGGCATCCATATCAGTGAATACCAATCAG
AACAATTTTCAAGCGCCACAAAGTGTTGCACAACAAAGTCCGTCCGACGA
TCAACAATCTTTCCCACAACAACAACAACAACAACAGTTTCAACAACCGA
TGCAATGGTCCTCCAATAACACCACCGAGCATTCTCCCGCACAGCAGAAC
AACACGACACAACCACAAGACGCTCTGCAGCGACAACTTTCCTCTCAATC
ACAATCGCAAGCCCAATCACCTCTTAGTGATCTCAGTGACTTATTGTCAC
CAGTCAGCCAGACGCTTTCAATACCATCGCTACCTTCCAACCCACAAAGT
CCAGTTGCATCGCCTTCCATGATGCCACCTATCCTGGTGCCACGACAACC
GCGAGCGGGTGCGGATTCCACCGCCACCAAGGCTGAAGTGAAAGAAGAAA
CGAAATCAACGGAAACTTTTCACACGCCAGATAACAAAACTATCGAAGAT
GAAAGCTGAAACAACGGCTCAACAGAATGCGTAACCATCCCACGAAGTTT
GGACGGACGCCTTCAAGTCTCACATCGGAAGGGACTGCCACACGTCATCT
ACTGCCGCCTGTGGAGGTGGGCGGACCTTCAAAGTCATCATGAGTTACGC
GCCATCGATAGTTGTACGTACGCCTTCAACCTGAAGAGAGATTACGTTTG
CGTCAACCCGTACCATTATTTACGCGTCGAAACTCCCGATGAGCAGTACA
ATGTTTCTTTCTTTCAATGCACCCATTGTAAAACGATTACTTCAATACAA
AGTTGGAAACGGAGAAGACGTTTGGTCAGAAAAAGCTATCAAAAGTTTGG
TCAAGAAACTGAAGAAAAATGGTGGACTTCAGGAGCTGGAAAAAGCAGTA
ATTAATCAAGATTTCGACGCCGTTCTTTACGAAGAGCCGGATGAATGGTG
TTCTATCAACTACAATGAATTACGTCAGCGGACGGGTGATACGTTTAGCG
GTACGCGTCCTGTCCTTACGGTAGATGGGTACACGGACCCATCGAACACC
GACAGATTTTGTCTAGGGCTGCTCTCCAATCCGAATCGAACGGATGATAT
AGAAGAATCGCGGCGTCACATCGGTAAAGGTGTTCGCTTGTATTATTTTG
GCGGTGAGGTGTTCGCCGAATGCGTGAGCGATAGCAGTATCTTCGTTCAA
AGTTCCAATTGTAATCGACGCTACGGATGGCATCCAGCCACTGTCTGTAA
AGTACCCTCCGGTTGTAATCTCAAGATCTTCAACAATCAAGAATTTGCAA
AGTTGTTAGCAGACTCTGTTCACTTGGGCTTTCACAATGTGTACCAACTT
AAGTCCATGTGTATGATTCGTTTGAGTTTCGTCAAAGGTTGGGGAGCAGA
CTACCGTAGACAAACCGTCACCAGTACACCTTGCTGGATTGAGATTCGCC
TCAATGGTCCTCTCAAATGGTTGGACAAAGTATTGGTGCAGATGGGCGCC
CCCGGAGATCGAGTCAGCTCAAACTCTTAAATATTTTGACGCCGCCAAAC
CAAGAAATCGTACCTGACGGTGCAAGTTGTATGACGGATATCGAACCAAT
GAACTTCAATAGTCTTTCAACACCAGGATCGTTGTTCTCACCGGCATCCA
TATCAGTGAATACCAATCAGAACAATTTTCAAGCGCCACAAAGTGTTGCA
CAACAAAGTCCGTCCGACGATCAACAATCTTTCCCACAACAACAACAACA
ACAACAGTTTCAACAACCGATGCAATGGTCCTCCAATAACACCACCGAGC
ATTCTCCCGCACAGCAGAACAACACGACACAACCACAAGACGCTCTGCAG
CGACAACTTTCCTCTCAATCACAATCGCAAGCCCAATCACCTCTTAGTGA
TCTCAGTGACTTATTGTCACCAGTCAGCCAGACGCTTTCAATACCATCGC
TACCTTCCAACCCACAAAGTCCAGTTGCATCGCCTTCCATGATGCCACCT
ATCCTGGTGCCACGACAACCGCGAGCGGGTGCGGATTCCACCGCCACCAA
GGCTGAAGTGAAAGAAGAAACGAAATCAACGGAAACTTTTCACACGCCAG
ATAACAAAACTATCGAAGATGAAAGCTGAAACAACGGCTCAACAGAATGC
GTAACCATCCCACGAAGTTTGGACGGACGCCTTCAAGTCTCACATCGGAA
GGGACTGCCACACGTCATCTACTGCCGCCTGTGGAGGTGGGCGGACCTTC
AAAGTCATCATGAGTTACGCGCCATCGATAGTTGTACGTACGCCTTCAAC
CTGAAGAGAGATTACGTTTGCGTCAACCCGTACCATTATTTACGCGTCGA
AACTCCCGATGAGCAGTACAATGTTTCTTTCTTTCAATGCACCCATTGTA
AAACGATTACTTCAATACAAAGTTGGAAACGGAGAAGACGTTTGGTCAGA
AAAAGCTATCAAAAGTTTGGTCAAGAAACTGAAGAAAAATGGTGGACTTC
AGGAGCTGGAAAAAGCAGTAATTAATCAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045593XLOC_045593Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073458-exon-scaffold_92-1575043694:125931..126321TCONS_00073458-exon-scaffold_92-1575043694:125931..126321Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1575043694:96883..97113TCONS_00073458-exon-scaffold_92-1575043694:96883..97113Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1575043694:96442..96579TCONS_00073458-exon-scaffold_92-1575043694:96442..96579Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1575043694:96129..96206TCONS_00073458-exon-scaffold_92-1575043694:96129..96206Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1575043694:95628..95882TCONS_00073458-exon-scaffold_92-1575043694:95628..95882Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1575043694:94801..94845TCONS_00073458-exon-scaffold_92-1575043694:94801..94845Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1575043694:94522..94563TCONS_00073458-exon-scaffold_92-1575043694:94522..94563Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1575043694:94165..94203TCONS_00073458-exon-scaffold_92-1575043694:94165..94203Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1575043694:89818..91484TCONS_00073458-exon-scaffold_92-1575043694:89818..91484Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1510915933:125931..126321TCONS_00073458-exon-scaffold_92-1510915933:125931..126321Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1510915933:96883..97113TCONS_00073458-exon-scaffold_92-1510915933:96883..97113Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1510915933:96442..96579TCONS_00073458-exon-scaffold_92-1510915933:96442..96579Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1510915933:96129..96206TCONS_00073458-exon-scaffold_92-1510915933:96129..96206Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1510915933:95628..95882TCONS_00073458-exon-scaffold_92-1510915933:95628..95882Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1510915933:94801..94845TCONS_00073458-exon-scaffold_92-1510915933:94801..94845Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1510915933:94522..94563TCONS_00073458-exon-scaffold_92-1510915933:94522..94563Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1510915933:94165..94203TCONS_00073458-exon-scaffold_92-1510915933:94165..94203Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1510915933:89818..91484TCONS_00073458-exon-scaffold_92-1510915933:89818..91484Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1491911889:125931..126321TCONS_00073458-exon-scaffold_92-1491911889:125931..126321Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1491911889:96883..97113TCONS_00073458-exon-scaffold_92-1491911889:96883..97113Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1491911889:96442..96579TCONS_00073458-exon-scaffold_92-1491911889:96442..96579Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1491911889:96129..96206TCONS_00073458-exon-scaffold_92-1491911889:96129..96206Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1491911889:95628..95882TCONS_00073458-exon-scaffold_92-1491911889:95628..95882Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1491911889:94801..94845TCONS_00073458-exon-scaffold_92-1491911889:94801..94845Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1491911889:94522..94563TCONS_00073458-exon-scaffold_92-1491911889:94522..94563Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1491911889:94165..94203TCONS_00073458-exon-scaffold_92-1491911889:94165..94203Clytia hemisphaericaexon
TCONS_00073458-exon-scaffold_92-1491911889:89818..91484TCONS_00073458-exon-scaffold_92-1491911889:89818..91484Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073458-proteinTCONS_00073458-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:89818..126321 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
5.6546 5.07896 8.05722 7.50175 48.5407 38.8942 40.9607 45.2698 33.9054 44.9718 42.2269 38.3412 43.1711 51.5977 36.5806 50.8538 36.1538 39.0656 26.5418 24.896 37.1451 39.0563 28.3379 33.6253 38.347 34.719 30.2749 30.7004 28.4189 28.5497
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003619MAD_homology1_Dwarfin-type
IPR001132SMAD_dom_Dwarfin-type
IPR013019MAD_homology_MH1
IPR017855SMAD_dom-like
IPR008984SMAD_FHA_domain
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
GO:0005667transcription factor complex
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007179transforming growth factor beta receptor signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0007179 transforming growth factor beta receptor signaling pathway
cellular_component GO:0005622 intracellular
cellular_component GO:0005667 transcription factor complex
molecular_function GO:0005515 protein binding
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
Blast
BLAST of TCONS_00073458 vs. Swiss-Prot (Human)
Match: SMAD2 (Mothers against decapentaplegic homolog 2 OS=Homo sapiens GN=SMAD2 PE=1 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 1.701e-102
Identity = 154/217 (70.97%), Postives = 175/217 (80.65%), Query Frame = 1
Query: 1186 LTPPNQEIVPDDFDAVLYEEPDEWCSINYNELRQRTGDTFSGTRPVLTVDGYTDPSNTDRFCLGLLSNPNRTDDIEESRRHIGKGVRLYYFGGEVFAECVSDSSIFVQSSNCNRRYGWHPATVCKVPSGCNLKIFNNQEFAKLLADSVHLGFHNVYQLKSMCMIRLSFVKGWGADYRRQTVTSTPCWIEIRLNGPLKWLDKVLVQMGAPGDRVSSNS 1836
            L+P N  +   D   V Y EP  WCSI Y EL QR G+TF  ++P LTVDG+TDPSN++RFCLGLLSN NR   +E +RRHIG+GVRLYY GGEVFAEC+SDS+IFVQS NCN+RYGWHPATVCK+P GCNLKIFNNQEFA LLA SV+ GF  VYQL  MC IR+SFVKGWGA+YRRQTVTSTPCWIE+ LNGPL+WLDKVL QMG+P  R SS S
Sbjct:  254 LSPVNHSL---DLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 467          

HSP 2 Score: 166.007 bits (419), Expect = 1.772e-43
Identity = 106/187 (56.68%), Postives = 119/187 (63.64%), Query Frame = 1
Query:  220 MSSTMFLSFNAPIVKRLLQYKVG------------NG-EDVWSEXXXXXXXXXXXXNGGLQELEKAVINQGNNGSTECVTIP------------------------------RSLDGRLQVSHRKGLPHVIYCRLWRWADLQSHHELRAIDSCTYAFNLKRDYVCVNPYHYLRVETPVMPPILVPRQ 651
            MSS   L F  P+VKRLL +K              NG E+ W EKA+KSLVKKLKK G L ELEKA+  Q  N +T+CVTIP                              RSLDGRLQVSHRKGLPHVIYCRLWRW DL SHHEL+AI++C YAFNLK+D VCVNPYHY RVETPV+PP+LVPR 
Sbjct:    1 MSS--ILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQ--NCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRH 183          
The following BLAST results are available for this feature:
BLAST of TCONS_00073458 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SMAD21.701e-10270.97Mothers against decapentaplegic homolog 2 OS=Homo ... [more]
back to top