Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073442 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073442
Unique NameTCONS_00073442
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3329

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073442 ID=TCONS_00073442|Name=TCONS_00073442|organism=Clytia hemisphaerica|type=transcript|length=3329bp
AGCCAGTTGAAAAATATGGCctaaaaatgctaaaaacgaCAGAATGTGGA
AAATAAAACTAACCATCTTCTTCTGAATTCATCAGCATAATCATTCCCCC
ATAATAGTTGCTTCTAAAATAATCAGAATCAGAATTTGGTACTATATTGA
TATCACCAACTCCAAGATCTTTCCAAGCTGGCTCTCCTCCAGATTCTTGC
TCTTGTGCCTTGTATAATTTGACTCTTTTTTCCAGAGTCCTGGCTTGATG
ATACCTATTCatctttctttgatttcattgATGCATTCTGAACGAGATTG
CAAATGATCCAAAATTGGAATTTACTTTAGATTTTCCAAAACATtcaaca
ataaagacaaaatatCAGAATTGTCCGCCAATTTGAAATTGATTCCATTG
CTAAACGCACCAAGGTTCGGAAGAAGCAAGATTCTAGCCTTGGTCCGACT
ATTAAACTGAAATATTCCCGTGATAGGGAAAGCACTGTAACTCTTCTTCC
GAATGAGTGATGAGCTCGGTAAACATTTGGTCAATGAGCTATTTAGACCA
TAACTGATTAAGATCTGTCTCATTCAACGAGCGCAGCCAGTTAGGTTTTA
AATTCACTATGATGTGTTTACGATTTGTTTTGGATTACATCATGATCCGA
CTCAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCA
CACTGTATTTAATCTgaaatgCAACCTTACTAATAAAGAGATATCGAGCA
ATATGGGTGTCTCGTGCAAGAACTGTGGTGGGACTGAAATTGACCATGAT
CAAGCTCGCGGGGATTCAGTATGTGTTGGATGTGGGTCAGTTGTAGAGAG
TCTTTGCATTGTCAATGAAGttgaatttcaagaaaatagcGCTGGTAACG
CTTCTGTTATTGGCCAATTCGTTTCTGCAGAAGGGCATCACAGCAGAGCA
GGATATAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAA
TGGAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGATGACAAATC
ATTGTTTGGAATCTGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGG
TTTACATCAGGTCGAAGAACCATTCACGTCATTGGCGCGTGCTTGTACCT
GGTCTCTCGAACGGAAAAAACTCCTCatATGCTACTCGATGTTTGTGATG
TTGTGCAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATTGGCG
CGAGAATTATGCATCGATTGCCCCATTGTTGACCCATCATTATACATCCA
CCGCTTTGCACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCA
TGTCTGCACTTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTT
GGGAGAAGGCCTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGCAGCCAA
ATTGTACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCA
TGAGTAAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCC
ACTGGTAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGA
GGCCGACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCAC
AAGAAATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAA
GTTACACgaactcaagaaaaattagaggAATTGCTGgataaaaggaaaaa
tattcAATTCGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATT
ATAGAAAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGAC
GAAAACGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGA
AGGTGGCGTCAAGAAACCTCCAGAGAATGAAGagccttcttcttcttctt
cggaGAAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCT
AGCAGCACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGA
TGAGAAAAAACAATTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACA
ATAGTGATGAAATCGACCTGGATGGAATTAATGATGACGAAATTGACATG
TTGCTGCTAACAgaagaagaaatcaaaatcaaaacagaagTTTGGTTGGA
AGAAAACCGAGAGTACCTCATCAAAATGAAAGagaaagaagaagagcaac
gaagaaaagaagaagaagaaaataaagatgGCATCAAAAAGAAGAAGCGA
AAATACAAgcgaaaaaacaacaaagatcgACCGGTTTGCGAAACTGCAGA
CGAAGCAATCAAAACGATGTTGGCGGAACGTAAACTTTCCAGTAAAATCA
ATTACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAATATACCAGGTTAT
GAAGAGAATGAACCGAGTATCGTTCCCAAAGTGGAAATGCCGTCGGCTGA
TATCTCTATGGTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTG
TTTACGAAACTGGTTCAACGCTTGCAACATCCAAACGTGCTGTCAGTAAG
CGAAGCAAGTCTATGAGCGGACCAATCTTCGGCACAGCTTATCAATCTAA
AAAGTTTAAAACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGA
AAGAAGACAAAACCAGTGAACTCGATGTCGACGAGAAGCCATTGGAGACG
GTGGTGGAATCAGGTCCTGTACAACACCACAACGAGGCTCAGAATCATGA
GTACGAGGATGAAGAGGAAGAAATTGTGACCGCTTCTTCACTCTTCGCCA
AACAAATGGACTGTGATGAGGATTACGGAGGATTTGACGATGAAGATGAT
GGATCGTTTTATTGACCAACAAATTGCTCATATCTCTTTCTATTTCTGTA
TTACACATCTAGGTCTCGTCCTACTCTGTGCAAAATGCCAATGCGTGTGG
TTAGTTAGCCTGTATCACCGGGAAATTCACTGGATTAAACTTTAGGAGCT
TATCTTTCTTACACATGCAAACGAAAAGCTCTAGCTACAATACAGCTACA
AAGTATAGTTTCCTAAACAATAGTATATGTCTTTGTATTGATGGCGCTCT
GAAGCCTAGATATGTACTCCACTCTAGGttgatattttcagtttttaagg
AATTTTCTTCTCGATTGTAATAAATAGAAATTTGAAATACTATCAAAAGa
ttcaaaatatattatttattgttttaccaaaatctttcaattttccttgt
tttgaTTTCTAAAATTCCTCAACTTTTCG
Run BLAST on NCBI

protein sequence of TCONS_00073442-protein

>TCONS_00073442-protein ID=TCONS_00073442-protein|Name=TCONS_00073442-protein|organism=Clytia hemisphaerica|type=polypeptide|length=768bp
MMCLRFVLDYIMIRLSFPAWRQHFFVLFKNHTVFNLKCNLTNKEISSNMG
VSCKNCGGTEIDHDQARGDSVCVGCGSVVESLCIVNEVEFQENSAGNASV
IGQFVSAEGHHSRAGYKYSLGRDHRQVILDNGKRLINQLGSNLKMTNHCL
ESAFMFYKMAVSKRFTSGRRTIHVIGACLYLVSRTEKTPHMLLDVCDVVQ
CDVVTLGRVFLQLARELCIDCPIVDPSLYIHRFAHQLDFGEKENEVSMSA
LRIMARMKKDWIHFGRRPSALCGAALIIAAKLYNFEVTMKDIVKLVRMSK
TTVFKRLMDFSKTATGKLTTDEFKTVDLEEEADPPCYTEGRNRVKFAQEI
SGQYHFVSTDVLAQVTRTQEKLEELLDKRKNIQFDIEDTKSESKAFDYRK
ELPRDYSLYSYELDENGEFKTPSKFIIHKEEGGVKKPPENEEPSSSSSEK
DENDELNQMKGTVASSTLIIDQSRIQKVKCDEKKQLKEESNQGNQNNNSD
EIDLDGINDDEIDMLLLTEEEIKIKTEVWLEENREYLIKMKEKEEEQRRK
EEEENKDGIKKKKRKYKRKNNKDRPVCETADEAIKTMLAERKLSSKINYD
VLRGLKSEDNIPGYEENEPSIVPKVEMPSADISMVTGRSEVEESMPVVYE
TGSTLATSKRAVSKRSKSMSGPIFGTAYQSKKFKTETKVNLPSSSVGKED
KTSELDVDEKPLETVVESGPVQHHNEAQNHEYEDEEEEIVTASSLFAKQM
DCDEDYGGFDDEDDGSFY
Run BLAST on NCBI

transcript from alignment at scaffold_92:156498..175005+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073442 ID=TCONS_00073442|Name=TCONS_00073442|organism=Clytia hemisphaerica|type=transcript|length=18508bp|location=Sequence derived from alignment at scaffold_92:156498..175005+ (Clytia hemisphaerica)
AGCCAGTTGAAAAATATGGCctaaaaatgctaaaaacgaCAGAATGTGGA AAATAAAACTAACCATCTTCTTCTGAATTCATCAGCATAATCATTCCCCC ATAATAGTTGCTTCTAAAATAATCAGAATCAGAATTTGGTACTATATTGA TATCACCAACTCCAAGATCTTTCCAAGCTGGCTCTCCTCCAGATTCTTGC TCTTGTGCCTTGTATAATTTGACTCTTTTTTCCAGAGTCCTGGCTTGATG ATACCTATTCatctttctttgatttcattgATGCATTCTGAACGAGATTG CAAATGATCCAAAATTGGAATTTACTTTAGATTTTCCAAAACATtcaaca ataaagacaaaatatCAGAATTGTCCGCCAATTTGAAATTGATTCCATTG CTAAACGCACCAAGGTTCGGAAGAAGCAAGATTCTAGCCTTGGTCCGACT ATTAAACTGAAATATTCCCGTGATAGGGAAAGCACTGTAACTCTTCTTCC GAATGAGTGATGAGCTCGGTAAACATTTGGTCAATGAGCTATTTAGACCA TAACTGATTAAGATCTGTCTCATTCAACGAGCGCAGCCAGTTAGGTTTTA AATTCACTATGATGTGTTTACGATTTGTTTTGGATTACATCATGATCCGA CTCAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCA CACTGTATTTAATCTGTAAGTGTACTGTTTCAAGAAATAGGATGaagttt tttgaactttttagggAAGACATGAAGGGGGGTGCTGCGTGACTCCTTTT GCCTTTTCATTCCAGAccggttggcaaacgatatcatccaccaggatgca tcctctcttattttccccctattttctactttcctatcttttATATCCTG ATTTCTGACTTTATCTAGTGTTTCTatctgttttctaagtatttttctga aatttgactGTACCGGTGAAATTggtctccgaccccggctcgaacgacca aatgcaagcaaccttggtatAATACATCCCCAATGCCTAACGTTGCCTAA CCGCTTGCGCCACACCGAAACACGACAGGAtactgtcattcacaaatact tatagcgtgtaattcagtcaggcacatcctggcaaatgaacggggtattt ttcacttgcgaccattgccaaatgaacggggtcgaaaacgaaagtgacgt aatagggccgaatacccagtttaattgaaccgggttggaaatattttgct tcatttcaaagaactgcatagatgaaattttttttccatgggtcaatttt gtcttcgaagattgaagaaacttttaatgaaaaaataaagttcccagttg tcttccttttttccctttttcagtttgaagttcattttttttattttcac gcttttagcctgagacgtcctatctcatttacactgggtgacgaataccc catgcaaatgctcaccccgttcatttgccaggatgtgcctgactgttgta atttacagacctttattaagaaagctcccaaccctaccggtgccacTACa aggatcccgtagggatcctaAATAAGGTCACAGGGTACagatgcccctaa gaaggcctgcggccttatattgtgactctcgagctccaaccctaataTTA TCTGATAATAACCGagcccccgtctaggtccgcagattgaaaaatttcac ttgcatcctggtggatgatatcgtctgccaaccttCCAGACCAGACATGA CGCATGAGTTGTGGTCCAGACTGGATGGAGTTTCCCCTAGTCGTTTTCTG CTAAAGAATGGCCATTGGGCGGgctaggaccctgccgacgcaccggactg tccagtgtatttgtccggtggcaaaaagaaaagtatccttgagctacacc ggacgcaatcagtccggtgtcagtccggtgttgcatacagggaattttgg acgccggacatttatgaaacaaaaaattaaaaacactggacgcaccggac tggtcatgtcctgtgttttgattgtccggttggaaaaaatatccttctct gacaccggacatccaacttccttaagtccggtgtagaaattgtccggtgg taaaaaaaattctcattttacaccggactttcgcatgtccggtgttcgtt aagtccggtgcgtcggcagggtcctggcaggctattccaaaaatatatac aggGGTATTGGCAAACCTGTTACACCAACccccttgaaaattttgaataa caaattatccTTTGAAAATTTGGGCTAGCTAACTAGATAGAGTCCCCTGG GGAagttgaaattttatgaaaaagggACTGGAAAACATGCCATGAGCGGA GAGAAATGATCCCCTTGGAACAAAATTCCCCTGGAAAAtctactgtcaac tgctctaacttgggacgattggtttggcctgtattttcacttactgttaa atctcaatatgacaacaaatttgttttgcaagtttatcaatcatactttc tgtcataacatgtcacgataactcgTGTGTACTCCACTGTTACGGAACaa ctttcatatttcaatttaaaagcctactcggtgcgaaagagaaattgtgt attttttaacgGATACAGGGTatgtccagacgatctcaatcaaacagaat cgacaatcgaaccagttgaaccaaattgaacgtaatcgacccattgaaat tcgattggcgaacgcaatcgaatctcaatcgaacatcaaagttctgggta atattcgattttttatgtttggaagaaaatttttacatcAGTGGTTGCCA AATAAGGAAAAGTCCAATTAAACATATACGAACCTAATCAAACGCATTCA AACACATTCGAATACGAATCctaatcaaacgcaatcgaatatcaatcgaa tctgaaaattgcggtaatattcgattgagattcgattgcattcgacaatc gaatttcaatcagtcaATTGCGTTCGGTTTGGTTCGATCgtcaattccgt tcgattgagatcgtctgggtaTGTGAACATGGTGAATTCACACActcaat tttctcgagattcgaaaaaataaaaacacaaaaattgttCTCTATAGATT TTTTcttgtagaaaaaatattttatatattatttcaaagaaacatACACA ATGTTTAAAAGGTACATCTATTGATACGTTTCAACTTTTGTGTTCAAATG ATGTCAAAGAAGCTTTTTTGTTTGTGTGAGAGAGACTCTTCTTCGTAATA AGTTCTCTGAAGGATTCGCATTCATCTTGTTATCAAACATCAACGGTGGA GATTATTTTGGCAGAATTTTGTGAGGATAATTACatagttttgcatactt ttcacaaattttCATTCTTTCAGACTGCTCGGGTGAGTTAGGGAgtgtct agatttttaaaaatcccAGATCCCAAATTCGCGATcaatagcacccattc tcagggattcacttatggatttttagatgccctataccttaaggtttcag gacccggttgtggtgtaattaaatattaacctaaaaattaattattatgA AAAGTGtaagttatgacgtcataaatcacAAAATAGCTCCAACTCTATAA GTGAgtcgggttggtgtaatttaagatgcatgATCTAACGATTTAAGATT CACAATgtgcgatccatgcataaagtatgctgattattcctaataattgt CATAAAGCTTTAAATTATaaaacataattctaaaacaatggcataatctt ttctcgcttttgtttaccatgttgaatttatgcaacaaaatagaaataag taAGCAATGGAATTACGAATAtttacgaccgtaaaattatgaaaaaaact aacttacATAATATTGATGATGAGAAAAAAAAGTAGaatgcacaagaaat attttttctctcaacctctcagttttaacaatcataatcaaatataggaa tttctttcttaaaggaaataaaagaatatattgacgaacaatatgtTCTg aggaccgtaatgtacgaagcaaaaaacgggtGCTCTATTAATTGTCtaat gagaaagaattttctttcagtaaacaattcccctatattgATTCATTGAT TGATTCAAATTGTGAAAGAGTACAGGAGGTGAATGCactttaaatttctt taaatataatttgCATTATCTTggataaatgatgtttttgaaattaattg agtttcagcgaatgaaggggtcatgcagttattatataaacactatgaca attactaccgtggtggtatataaaccaaaatttgggaaaacagttactcc accagtggactaactgcaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtagtacactatggaa taactgcaagggtggtggtgtctgtagaaaatgtccaaaattgcagttac tccacatagtgtcaaggagtaactgcaagaccccccctgAATGAAAGTTa gtaaattgcctaaatattttagcatgattagcataattacgcatgaatta acatattttatgcaaggatcgcgaatcgtgcatcgtgaatcgttagatcg tgcatcttaaattacaccaacccaagtgagtctgctaaattgtgtgggtt gcgtgggtgcgtgggtcaatatttttgcgtgggtcatttttttgtgtggg tcaaaatattttttgcatgggtcaaattttttgtgTGGGTCATATGTTTT GCATGGGTCATAtgttttgcgtgggtcaaattttttggttgggtcaaatt ttttgcgtgggtcatattttttgtgtgggtcatatttttgcgtgggtcat tatatttttttgtgtaggtcaaaatttttgcgtgggtcaaaattctctct gtaattcgaaaaaataccTTCCCTTGAAATTTGAACTAGTTACAtccaaa atgttggatgtgttttacataacaccttttggtttattttgtttattttg catagcTGTACTTGTACAGTTCCATAATTTCTGAATATGGTGAATTTGTT CCAATAAACGTGTTCAGAAAGAATGTTTCCAACAGGGGAGTGTCTTTTTA TAAGTGGAATGTTCCCTTTTGGGAGATTTCGTCCAAAATTAATACTGTAG TTACGTTTTGTATATACCTAAGAATGGCAAAAAAAATGTACACAATTAAG cggctttatattttttttaattccccTAACTAAACATGTTAGCTTTTATA GCTTCTTGTAGCACGCTTTAATCTTTTGGGTTGCCTTTGAGTGTTAAAGA ACAAAGCAAATGACgacaaaatctgaaattttttttacaaaagttatGTT CATTAGGTGACCGATTACTAAACAATTTAATTGTTGTCAATTATTTTGTC CACCCCACTggtaatttctttgatttaagtacattaaaggccaattaaaa aaattggacgaaataaagacgctgtactttttttcaaaacaagagAAAAG GAGAGGAAAAAATTCAATAGAAAGGAAAGAAGCAATGAACGGTCATATCT CATTTTTGTTGCTTAAAGTTATAGTGTTTATTTCCATGACACTGGAATCC TGAAATATATcatgctaaaattcaaaagtgagatCCTGAAGTTTGTCTAC AAAAATTAGACGGGTGTGTGTTGATTCTGTATAATATTATAGTAAATAAG TGCAGCTATGCAAAATAAACCACAATGCGTTACATAAAAACGAtgtgctt ttgtttagttttcgtagatacacaacacatttttgtataaaataacttga aaattttaatttgacaaaaaaacgagttagctaactcgaaagttttaatt tggtaaaaaaattgagttagcTGAAAANGTTAGCTAActcaaaagtttta atttggtaaaaaaatcgagttagctgaaaaatcaacaaaaaaatagtGAT CCACGCAAAaactttgacccacgcaaaaactttgacccacgcaaaaaata tgacccacgcaaaaaatatgatcATTAGGCGACTACTCATTAGTAACTAC AGTATTAATTTTGGACGAAATCTCCCAAAAGGGAACATTCCACTTATAAA AAGACACTCCCCTGTTGGAAACATTCTTTCTGAACACGTTTATTGGAACA AATTCACCATATTCAGAAATTATGGAACTGTACAAGTACAgctatgcaaa ataaacaaaataaaccaaaacgtgttatgtaatacacatccaacattttg gaTGTAACTAGTTCAAATTTCAAGGGAAggtattttttcgaattacagag agaattttgacccacgcaaaaattttgacctacacaaaaaaatataatga cccacgcaaaaatatgacccacacaaaaaataatgacccacacaaaaaat atgacccacacaaaaaatatgacccacacaaaaaaatatgacccacacaa aaaatatgacccacacaaaaaatatgacccacacaaaaaataatgactca cgcaaaaaatatgacccacgcaaattTTTGATGCACGCACCcatgcaaaa atattgacccaagCACCCACGCAACAGACGCACGCATAAGTACATGTaga atctttgtcaaattttgaccaaagatgcatcttaaTTGTGCCAAGCTTTT CAACGAAAAattgacgtcagcaaaaattgcaaaaaatcgaaatatgcaat attttgctgacatcatcaaattttcaaaaaaaattttcaaNagcaaaaat tgcaaaaaatcgaaatatgcAATATTTTGCAGAcatcatcaaatttttca aaaatttttttctcaaaaagttacattttagtTCGATGCATCTATGGTTC AAATTTGTATGTATTGTATGCatttttaatattatagcgATTTTACGATT Catcatgacgtcaccaaattcgatcaaattatgatgtcataattacaatt tttttaattatagaTTTTTGTGGTGATATTTAATTAGGTCACAACCTGAT TGATAAACTTCaaggtatagaggtactttagagccctaatctggctgcta ttggtCGCTTACTTAGGGTAAACTGCTAGGTAtttgagacttgccctaag tcaaTTGAGTGAAACCACTTTTTCATACCCATACCCACCATCGCAATTTT TGTGTAAACAAATCACGAAGTTTTCTCTCTTTCTGAGTCTGATCtaaagt tttttacaagaacataaaCTGACATGAGGACTTTTTGAGACTATGATTCT GACCTCTTATAAGTAAAGTGAATTAAAGATATTATATACATGTGTGTGGC ATGTAGCGATGGGGTAGAGTATTCCTTCAATAATCGGATTCGAAAATCGG GATTACATTGGAAAATCATGGTAAACCGGAATTTTCACACAGTGATAAAA ATTCCTGTATCCGCCCCTGTGCTAGGTTAGACTTTGACCGCTAAGTTGGG TTGCGACCGCTGGCAGAAAAAAGTACACCTCCCCGCCAACCATAAAACCA CAAAAATAAAAGGTGCACAAAAATTGATGAGATTATTAAGCTAAAGTATT TGATTTCTCTCTCCTTTAGAAATACAAAAAAGATTATTGCAACTCTGAGA AATCTTGTTGACATTAACTaactattattttttaaaggaaatgCAACCTT ACTAATAAAGAGATATCGAGCAATATGGGTGTCTCGTGCAAGAACTGTGG TGGGACTGAAATTGACCATGATCAAGCTCGCGGGGATTCAGTATGTGTTG GATGTGGGTCAGTTGTAGAGAGTCTTTGCATTGTCAATGAAGttgaattt caagaaaatagcGCTGGTAACGCTTCTGTTATTGGCCAATTCGTTTCTGC AGAAGGTAGGTGAAAAATGAATaaagcttttctttttttcttgagtTTTC TTGTGCTActataatacaataatgaccggttagtgaggttTGTACTGAGG AATATTGCCcaaggtcaagtaacgaccgagcttgcaaGGTTGTTGCGATG ACcaagggcaatattttcagtacatcccgaaaaaaccggtcttttttgta tttgttaaccgtttccttcagcttcggttgatttttagcgctttatccag gaaaaatagtgaaataaagtgaaaaaggcaagcgaaaagagatgaaaaat tgctataatttctgacgtcagaaatagaaaatgagagaaatgatgttaAC GNAAAAGGCAAGCGAAAAGAGAtgaaaaaatgttataatttctgacgtca gaaatagaaaatgagagaaatgatgtcaacacATTGTtcatttcctttga aaaagtgacgtcacaatgaattttcctaacgacgggcaactctggacagt gtaggcccgtcgtcgtgcaaaaagaaccaattgtattgcgcaaaaagccg tgtagcccgctttgaaaaagtaacgGGTTAACAATGTGAGATGTTACATA TTGAGATGTCAATAAAAATAATGTTGCTCCAAGACCACCAGGTAAGAATG GTCAACAACAACAGCTTGTTCCGATTTAATTCTACATTGAAAATAATGAT AACAATTTGTCCCCTTTGCATAGCAAAGTCATTACAAGAACTTGATTTTA ACCTAATCAATCAAACCACGGCACGGTTAAACATGTTATTGTTATAAATT CACTGATTCAATAATCTTTAATTTTTCCAGGGCATCACAGCAGAGCAGGA TATAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAATGG TAAGAAACCTAAATCTTGTATTTTGCAGTATAAACCTTGGTAATTTTATT CTAGAGaatctttgaaaagttttggaaGTAAGTCTGGAAACTCTCGCTTT GTAACAAAATCTGTAGTTAGAGTTTTGTcccaattttgtttttgatcaaa atcagatgAGTACCCTATTTTGATGCTGGAACTTTTTAGGAAAACGTCTT ATCAACCAGCTTGGTTCCAACCTGAAGATGACAAACCATTGTTTAGAATC TGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTTTACATCAGGTC GAAGAACCATTCACGTCATTGGCGCTTGCTTGTACCTGGTCTCTCGAACG GAAAAAACTCCTCGTAAGTTGCAATCAAGAATCAAGTCAacagaattttt tgaaaagacaaTAACTGAAAGAGTGAAGAAGATGAAGCAGATTTCATTAT TCttgcttttatttttagatATGCTACTCGATGTTTGTGATGTTGTGCAG GTATTTactttgaaatttattgaaaatcacCTGATCAATTTCCGACAGAG GAATATTGctcatattttttgttgaattagGTCAATTTTAGTAAGGTAAT ATCATTAAGTCGTGACATTGTGTTTACTTTCTGCTGCTACTAAAGATACA TAAGCTTTAAGGTTTGAAttcaatcttaaatattttgtcTCCCAACTTTC TTAAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATNTTTTGTc ccaattttgtttttgatcaaaatcagatgAGTACTCTATTTTGATGCTGG AACTTTTTAGGAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGAT GACAAATCATTGTTTGGAATCTGCTTTCATGTTTTACAAGATGGCAGTCA GTAAGAGGTTTACATCAGGTCGAAGAACCATTCACGTCATTGGCGCGTGC TTGTACCTGGTCTCTCGAACGGAAAAAACTCCTCGTAAGTTGCAATCAAG AATCAAGTCAacagaattttttgaaaagacaaTAACTGAAAGAGTGAAGA AGATGAAGCAGATTTCATTATTCttgcttttatttttagatATGCTACTC GATGTTTGTGATGTTGTGCAGGTATTTactttgaaatttattgaaaatca cCTGATCAATTTCCGACAGAGGAATATTGctcatattttttgttgaatta gGTCAATTTTAGTAAGGTAATATCATTAAGTCGTGACATTGTGTTTACTT TCTGCTGCTACTAAAGATACATAAGCTTTAAGGTTTGAAttcaatcttaa atattttgtcTCCCAACTTTCTTAAGTGTGATGTTGTGACCCTTGGTAGA GTGTTTTTACAATTGGCGCGAGAATTATGCATCGATTGCCCCATTGTTGG TGAGTCTTATTATTCATCTACAAGTGGCAGCTGTCAAAGAAAAAATCCAT ATTTTACACCCCTCCTTTTTTGATAAGGGATAATTTACATAAGGGTTTCA AGGAAGGGTCAAGTTTCAAATGTAATGGGCTTTAGGCTCATAGAAGATTC ATTAAACTTTTAGGCCAAAGAATTGTCTTTTTGAAGACTACTTAGCCTGT TGTTGATTCAGCCGttgattttgaactttttttggtgCCCGATTTTGAAT CTCTAATACTTATTTTCGCACACAGACCCATCATTATACATCCACCGCTT TGCACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCATGTCTG CACTTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTTGGGAGA AGGCCTTCAGCTTTGTGTGGCGCAGGTATGTTATGTGTTTGTGGTCATGA AAGAAATCACTTCCCAAAAAGAACTAAAtctctgtaaaaaaaatatattg ctctgccacccaaatctcctgattgaatatagttggacagaaattcttat ttcttcacatatatatctcttcgatttttttattcaatttgcGATTTCTA GTGCAGCGTCTTTTGATTGACCTGGCTTTTTTCGCTAGATTTTTActtgt gtcccaaaaaaaatcattttgaaaagatGAGTTGAAAGTCAAGCAAATAA ATCTGCGTGATTTTCTTTCGTTTCATAGCTTTGATCATAGCAGCCAAATT GTACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCATGA GTAAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCCACT GGTAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGGC CGACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAAG AAATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAAGTT ACACgaactcaagaaaaattagaggAATTGCTGgataaaaggaaaaatat tcAATTCGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATTATA GAAAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGACGAA AACGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGAAGG TGGCGTCAAGAAACCTCCAGAGAATGAAGagccttcttcttcttcttcgg aGAAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCTAGC AGCACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGATGA GAAAAAACGTAAGCTGTAAACGTGTTTTGAGTTCATTTTATCCACGATTG AAGTCCTTTTGATTCACCAGTCTGATTACGTATGATCTTTTAAATTTCCA CGTTCGAAATATGCTATCGTATTTTTCTCTATTCAAGTTTCCTTGGTTAT AGGAGTGTGGCCTTTCTATTAATTGTAGAGTCCACTTTTTAAATACTCGA ATATTTTCACACTGAGTGCATTTTCTGGTTAAAAATAATAGCGAGCAAAT CGTAAACTGCTCTATTTTTGAGTCAGCGGTTAAGAATTTATCATTTGAGT CTCTTCTTTTTTTCGCaaatattttctatttgatACCTTATTGGGATGTA TAATGCTTATTGGAGGGTGGTTCTTGATAGAGGATGGTGCTTTAGGGCGG CTCTTAAAAGAGAACAGTCGTGATTTTTGTCACCTTTTTTTTAGCAGACT CATGAATATTACGCATTTAATACTTTAATTAAACCTACTTCTCTTCAGAA TTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACAATAGTGATGAAAT CGACCTGGATGGAATTAATGATGACGAAATTGACATGGTATTTATTTAtc aattcattcattcatccatcCTTTCATTTTCATCCGAGtgatttgttttt ttagttGTTTGAAAAGATTCCAAGAAATAGTTCATACTTGAGCTTGGGTT TAGGTAGAGgataatattattttcatcaatttctgaacaaggaaaattta ctctttcattacTCATCGTACACGGGAAGCTTTTTTGTATAATTCTTCTT TTCCGTTCTACATGATTTCAGTTGCTGCTAACAgaagaagaaatcaaaat caaaacagaagTTTGGTTGGAAGAAAACCGAGAGTACCTCATCAAAATGA AAGGTTGATAATCCTTGTTTGTTGCTATACGCGTCTGTAAAACACTCTGT CTCTCTGAACTGCTAAAAACTTTGTAGCTGATGGAAGGAGCTGAATTCTG ATCGGGATAGAAAATCATCTGTTTTTAATTGGTAATGGTATGGACTCTCA AAATTACAGCGACTTTTGCAATTGATCTGAAGCATCGGGGTATTTTTCTC ACCGTGACAATTTTACTGCAAATTGATATAAGGTTGTACTAAAGTATTGA AAATGCCTTCTTAGTAATCATTTTAAAGTAACTAAAAATAGCTTGACCCT GGTCCGAATTCAGAAGGATTCCCCTGTTTAgtatgattttgttttttttg tacagagaaagaagaagagcaacgaagaaaagaagaagaagaaaataaag atgGCATCAAAAAGGTTCGTTCACTTTGTTGACCATAGACTTTTTCActt ttccatccgccatcttggatcatatgcaaaaatacagaaaaGAAAAAGCC GGGGTTGGATtcagttggaaaatatgcaaaacatatgcaagtttacacaa agattataAAGCGAACAAGCAGGAACAAGAAGAAACATTATACTCATTAA AAGAATGAAAGATCAAACTTCAAAGTTCAAaaagaaatactaaaaaaaac attaaaaatttaaaagaaatcttttttttgccatgctattcccaggagaa taatttatcgtcagccgaataaggattattctTGCAACTTTGCTGATGAT CTTTCAGCTTGAGTTtttgtctaatgttatggtcttttgaagggCTGGTT CTAAGAGGCGAGAAAATATAATTATTTCTGGTTTTCAAGAGGGGCAAAAc caatctttcttctacaagattaaactttaatataatgcctgCCAATTATG GAGTCAAAGAGGCTCCACTATGGAAAGTTTAACTTTAGAGTTTATCTTTT TTCAGAAGAAGCGAAAATACAAgcgaaaaaacaacaaagatcgACCGGTT TGCGAAACTGCAGACGAAGCAATCAAAACGATGTTGGCGGAACGTAAACT TTCCAGTAAAATCAATTACGATGTCCTGCGAGGCTTGAAGTCTGAAGATA ATATACCAGGTGAGAAGCCAGTCATTTGCTTGATTTACCGAATCGATCTT CATTTACCGTATTTTTCGAGAAAACGCACCAGGcatttattgaatttatc aGTTTTGGTTGGGCTTTGAAGGGGAACTTTATTTTGCCTTTCTGTTTTAT TTGAGTACAAATTTTTGACCCTAATAAAATCAGTTCgaacaatgaaaaaa taaacgacCCTCCTAGGGAGGCGATTATTCGAAGGGGACGTTTAGAGAAA TTTTTTCTCATAGGAGGGATATTTATTAGGGGGTATTTGAAATAAGGAAg catttattcgaagtaatattTGTCAACTtgagttgagctagaatctgaga atgtttGTCTGtgtatctgtctgtctgtaactttggggcagcctggagac ttcaaaaatggtcggatttggctgaaatttagcacacttgttctttgggt gaatatatggggtgttttttttcatttttcaaaaattttgatttttgggg cctagtgacgagtttttcgccaaaacgaggctaaaactttggggcagcct ggagacttcaaaaaattttggatttgcctgaaatttggcacacttgtttt TTGGGTTGATATTTGGGgttttttagatttagattttttggGCCTGGGCA ATTATCTTTTGTTTTCCCGGAGCAAGAGGTTCTTACTGGTATTTCTTCTT TGAAGGTTTTGAATCTTCTTTGTCAATTTGAGTAGTCAGGATATAAATGT GAACGTATTCAATTCGTATTAGGTTATGAAGAGAATGAACCGAGTATCGT TCCCAAAGTGGAAATGCCGTCGGCTGATATCTCTATGGTAACCGGAAGAA GTGAGGTGGAAGAGAGTATGCCGGTTGTTTACGAAACTGGTTCAACGCTT GCAACATCCAAACGTGCTGTCAGTAAGCGAAGGTTGGTTGAGCAAGAATA TTTTAACTTGTCTATTTTCCTTGTTCTGTGATATCCAAACTATGAAACCC TTCATGATGGACAATTTTGGCCAAGATTTCATCATGATTTTCACAGTACA GTTCAAATGATCAAGTTTCCGCTtgatttttcttggaaaatttcttttaa tcTATTTTCTTTTCCACTGCAGCAAGTCTATGAGCGGACCAATCTTCGGC ACAGCTTATCAATCTAAAAAGTTTAAAGTAAGTGTTGTGTGCTAGCGTAT CTTCTTCGGTCAAAAATCCCATGCTACAGGTTTGATGCAGTTGGTTTGAT TGTTTAATGGAGAGGTGAAAGCATATTTTCGATGTCTGGATccgtatacc ttatcggggaaaacttcgtcggggaaaagtgacgaaattttggacaagtg acgaatattttccccgacgaaaattttccccggccttaatgcgtttacca actaccagcaagtgacgaatttttccccgacgaaaattttcaccgaggaa gttttccccgataaggtgtAATTTTTCTTATGTCTGAAATCTGATCATTA AAAATTAAGCCTTTGTATAAAATGactctttcaaaattttggaaatttcc gAAATTTCCTAAAAAGAGACGGGATAGCAAGATGGGAATTGGATTTGTTA ATTTTCGCTCGCTGTACTAATCTAAAAGCCCAAGCTAACAAAATTATCGC GGTACTTAATTTTTGTTGTAGTGACTAAGATTTCCCCAAACTAAATTACG TGCTATTTATTGAATATGATTTACACGAATCTTATCCCTTTCATGATTGT TTCGTGGTTTACTCGAAAATGTTCTCCGCTTTTTTTTCTCAGACGGAGAC GAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAAAGAAGACAAAACCAGTG AACTCGATGTCGACGAGAAGCCATTGGAGACGGTGGTGGAATCAGGTCCT GTACAACACCACAACGAGGCTCAGAATCATGAGTACGAGGATGAAGAGGA AGAAATTGTGACCGCTTCTTCACTCTTCGCCAAACAAATGGACTGTAAGT TGTTGATCTTCTAAACGAATCCCATTCCTAAAGACCAAGTGCAgaacttt attattattatacagatTTACAAGCTAGGCTCACAGTGGGCCTCTAACCG ATCTTATTTTACACTATTCTTGAATCTTATTTTGAGGGATGGTTTTCCCA TGCATCGTTGAGGTTTTCTTTGAAGGTCTTGATAGACTTTGCTGTAACGA CATTTCTCGGCAGTCTATTCCAGGTTGGCACACATCTGTAATAAAAGGAT TTCGTTTGTGGTCCGTGGAAACCGCCATTCGCGAAGTTAGGTAGAAGCTC ACGAGCGTGTCTTCGATTTGGACGCGGACGTTTAGTCAACTTGTCAGGTA TTTTGAGCCTATCAAAATACGAAAGGCTGCGGTACGTTGGGACCAATCTT GTTGCACGTCTTTGCACTCCCTAAAGTAAGTTGATATGCTTACGTAATCT TGGTGACCAAACTGATTGTGCGTACACAAGGTGTGGTCGGACAAATGTTG AATATAGCGTAAGGAGGATCTCCGGAGTTGTTAAGTTGGTGAAACCTGGT TTAATGACACCAAGCATTGAGTTtgctttttttacttgattggCTATATG GTCTTCAAATGTCAATTCAGCATCAACCAATATACCCAGGTCTTTTGTTC AAATACATGCTCAAGCTGAATATCACCAAGACGATACGGATGAGCGTGTT TTATATTTACGAATTTGCCGAGTGTAAGGACGTGACATTTATCCGGATGG AACTGTAATAGCCAATCGTTGGACCATTTTTTGAGTGTGTCTATATCACT TTGTATGGCAAGGGAGTCATAGACTGAATCTACCTCTCTGAAGATCTTTG TATCATCTGCGAAAAGTAGCAGAGCCGAAATCACCTTTTCAGGCAAATCA TTTATGTACAGTGTAAAGATTAGAGGGCCCAAGACACTTCCTTGTGGTAT TCCATATAATACACTATCCACCTTGGATTTTGATTGGTTTACTTTGACCA ACTGCTTCCATCCACTCAGAAACGATGAAATCCAGTTCTTTATTGATCCA ACTATGCCATACCCTTCTAGCTTTTTGCAAAGCCTACGATGAGGCACTGT ATCAAATGCTTTAGCGAAATCAAAATAGATGCAGTCTACAACTTTTCCGT CTGATATACTTTCACAGCACCTGCCGACATATTTCAATAGTTGAGTAACA GTGGAACGTCTACTGATGAAGCCATGCTGCTTATCTGATAAAAGGTTTAA GTTTGTCAGGTGGTTCGTGATATGTTCTCGTAGATCGACTCATTCATCAG CTTGCAAACCACGGATGTTAAACTCACTGGTCTGTAATTGATGGCCAAGT TATGCGCGCCTTTGTTCTTGAAGATGGGCGTGACGTGAGCAACCTTCCAA TCCTCAGGTAGTACCCCTTCAGCCAGTGTCTTATTCATAAGCCTTGAAAG GGGCTCGGAAATTTCGTCGACAAGCTCTTTCAACATTCTTGGATATATTT CATCAGGACCAAAAGATTTGTTTGTATCCAGATCCTTGATCTTCTTACTT GTCATATCTTTAGTTATGATGATGTCTGCAATATCTTGTTCTGTTCTTCG TGGAAATTCCGGAAGTTCTCCTTCAGGCTCGATGGTAAAGACACTGCAGA ATTGTTTTTGGAGAATGTTTGCTTTCTCGTGGTCTTTGTGACGTAGCGAT GACTTGTCTTCAGGTGACTCGAGAAGTGACGAAACACCTGTCGCAGCTTT CATCTTACTTCTTAGATGCGACCAAAAGACCTTTGGTTTCGTTTTCGGTT TTCGGTTTTCGTTACTTAATTTACTTATAATTAAGTATTTTATTCTTAAT TATGACTATTGGAACTTTTTAGCGCAAAAGGTTTCGAACATTTTATAATG TGAAAATTACAAGATATACAACTCGATGATCGGACCAGAGTTTGATTTGa gttgtatttcttttttttacatcTCAAGggttggaagaaaattttaacct aattcaaatttccagggggttaaaagttattttttaatttccaaGGGGTA AAAAGATTGATTTTAGTACACCCACCCTCACATTGGAtccttttttcagt tttttgccAGTTTTCCATGGGATATTCgtaatattttaagatttttttgg cTTGAGAAAAGTTTGGCCATCCCCTGTATAGATATAAGTAGAATAGCCTT ATACagcaaagtttgaaattatcttCTTTCTTTATATGAAGGTGATGAGG ATTACGGAGGATTTGACGATGAAGATGATGGATCGTTTTATTGACCAACA AATTGCTCATATCTCTTTCTATTTCTGTATTACACATCTAGGTCTCGTCC TACTCTGTGCAAAATGCCAATGCGTGTGGTTAGTTAGCCTGTATCACCGG GAAATTCACTGGATTAAACTTTAGGAGCTTATCTTTCTTACACATGCAAA CGAAAAGCTCTAGCTACAATACAGCTACAAAGTATAGTTTCCTAAACAAT AGTATATGTCTTTGTATTGATGGCGCTCTGAAGCCTAGATATGTACTCCA CTCTAGGttgatattttcagtttttaaggAATTTTCTTCTCGATTGTAAT AAATAGAAATTTGAAATACTATCAAAAGattcaaaatatattatttattg ttttaccaaaatctttcaattttccttgttttgaTTTCTAAAATTCCTCA ACTTTTCG

Coding sequence (CDS) from alignment at scaffold_92:156498..175005+

>TCONS_00073442 ID=TCONS_00073442|Name=TCONS_00073442|organism=Clytia hemisphaerica|type=CDS|length=36912bp|location=Sequence derived from alignment at scaffold_92:156498..175005+ (Clytia hemisphaerica)
ATGATGTGTTTACGATTTGTTTTGGATTACATCATGATCCGACTCAGCTT
TCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCACACTGTAT
TTAATCTgaaatgCAACCTTACTAATAAAGAGATATCGAGCAATATGGGT
GTCTCGTGCAAGAACTGTGGTGGGACTGAAATTGACCATGATCAAGCTCG
CGGGGATTCAGTATGTGTTGGATGTGGGTCAGTTGTAGAGAGTCTTTGCA
TTGTCAATGAAGttgaatttcaagaaaatagcGCTGGTAACGCTTCTGTT
ATTGGCCAATTCGTTTCTGCAGAAGGGCATCACAGCAGAGCAGGATATAA
ATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAATGGAAAAC
GTCTTATCAACCAGCTTGGTTCCAACCTGAAGATGACAAATCATTGTTTG
GAATCTGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTTTACATC
AGGTCGAAGAACCATTCACGTCATTGGCGCGTGCTTGTACCTGGTCTCTC
GAACGGAAAAAACTCCTCatATGCTACTCGATGTTTGTGATGTTGTGCAG
TGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATTGGCGCGAGAATT
ATGCATCGATTGCCCCATTGTTGACCCATCATTATACATCCACCGCTTTG
CACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCATGTCTGCA
CTTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTTGGGAGAAG
GCCTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGCAGCCAAATTGTACA
ACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCATGAGTAAA
ACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCCACTGGTAA
ATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGGCCGACC
CACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAAGAAATA
AGTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAAGTTACACg
aactcaagaaaaattagaggAATTGCTGgataaaaggaaaaatattcAAT
TCGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATTATAGAAAA
GAACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGACGAAAACGG
TGAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGAAGGTGGCG
TCAAGAAACCTCCAGAGAATGAAGagccttcttcttcttcttcggaGAAA
GATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCTAGCAGCAC
TCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGATGAGAAAA
AACAATTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACAATAGTGAT
GAAATCGACCTGGATGGAATTAATGATGACGAAATTGACATGTTGCTGCT
AACAgaagaagaaatcaaaatcaaaacagaagTTTGGTTGGAAGAAAACC
GAGAGTACCTCATCAAAATGAAAGagaaagaagaagagcaacgaagaaaa
gaagaagaagaaaataaagatgGCATCAAAAAGAAGAAGCGAAAATACAA
gcgaaaaaacaacaaagatcgACCGGTTTGCGAAACTGCAGACGAAGCAA
TCAAAACGATGTTGGCGGAACGTAAACTTTCCAGTAAAATCAATTACGAT
GTCCTGCGAGGCTTGAAGTCTGAAGATAATATACCAGGTTATGAAGAGAA
TGAACCGAGTATCGTTCCCAAAGTGGAAATGCCGTCGGCTGATATCTCTA
TGGTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTGTTTACGAA
ACTGGTTCAACGCTTGCAACATCCAAACGTGCTGTCAGTAAGCGAAGCAA
GTCTATGAGCGGACCAATCTTCGGCACAGCTTATCAATCTAAAAAGTTTA
AAACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAAAGAAGAC
AAAACCAGTGAACTCGATGTCGACGAGAAGCCATTGGAGACGGTGGTGGA
ATCAGGTCCTGTACAACACCACAACGAGGCTCAGAATCATGAGTACGAGG
ATGAAGAGGAAGAAATTGTGACCGCTTCTTCACTCTTCGCCAAACAAATG
GACTGTGATGAGGATTACGGAGGATTTGACGATGAAGATGATGGATCGTT
TTATTGAATGATGTGTTTACGATTTGTTTTGGATTACATCATGATCCGAC
TCAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCAC
ACTGTATTTAATCTgaaatgCAACCTTACTAATAAAGAGATATCGAGCAA
TATGGGTGTCTCGTGCAAGAACTGTGGTGGGACTGAAATTGACCATGATC
AAGCTCGCGGGGATTCAGTATGTGTTGGATGTGGGTCAGTTGTAGAGAGT
CTTTGCATTGTCAATGAAGttgaatttcaagaaaatagcGCTGGTAACGC
TTCTGTTATTGGCCAATTCGTTTCTGCAGAAGGGCATCACAGCAGAGCAG
GATATAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAAT
GGAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGATGACAAATCA
TTGTTTGGAATCTGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGT
TTACATCAGGTCGAAGAACCATTCACGTCATTGGCGCGTGCTTGTACCTG
GTCTCTCGAACGGAAAAAACTCCTCatATGCTACTCGATGTTTGTGATGT
TGTGCAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATTGGCGC
GAGAATTATGCATCGATTGCCCCATTGTTGACCCATCATTATACATCCAC
CGCTTTGCACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCAT
GTCTGCACTTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTTG
GGAGAAGGCCTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGCAGCCAAA
TTGTACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCAT
GAGTAAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCCA
CTGGTAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAG
GCCGACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCACA
AGAAATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAAG
TTACACgaactcaagaaaaattagaggAATTGCTGgataaaaggaaaaat
attcAATTCGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATTA
TAGAAAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGACG
AAAACGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGAA
GGTGGCGTCAAGAAACCTCCAGAGAATGAAGagccttcttcttcttcttc
ggaGAAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCTA
GCAGCACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGAT
GAGAAAAAACAATTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACAA
TAGTGATGAAATCGACCTGGATGGAATTAATGATGACGAAATTGACATGT
TGCTGCTAACAgaagaagaaatcaaaatcaaaacagaagTTTGGTTGGAA
GAAAACCGAGAGTACCTCATCAAAATGAAAGagaaagaagaagagcaacg
aagaaaagaagaagaagaaaataaagatgGCATCAAAAAGAAGAAGCGAA
AATACAAgcgaaaaaacaacaaagatcgACCGGTTTGCGAAACTGCAGAC
GAAGCAATCAAAACGATGTTGGCGGAACGTAAACTTTCCAGTAAAATCAA
TTACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAATATACCAGGTTATG
AAGAGAATGAACCGAGTATCGTTCCCAAAGTGGAAATGCCGTCGGCTGAT
ATCTCTATGGTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTGT
TTACGAAACTGGTTCAACGCTTGCAACATCCAAACGTGCTGTCAGTAAGC
GAAGCAAGTCTATGAGCGGACCAATCTTCGGCACAGCTTATCAATCTAAA
AAGTTTAAAACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAA
AGAAGACAAAACCAGTGAACTCGATGTCGACGAGAAGCCATTGGAGACGG
TGGTGGAATCAGGTCCTGTACAACACCACAACGAGGCTCAGAATCATGAG
TACGAGGATGAAGAGGAAGAAATTGTGACCGCTTCTTCACTCTTCGCCAA
ACAAATGGACTGTGATGAGGATTACGGAGGATTTGACGATGAAGATGATG
GATCGTTTTATTGAATGATGTGTTTACGATTTGTTTTGGATTACATCATG
ATCCGACTCAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAA
GAACCACACTGTATTTAATCTgaaatgCAACCTTACTAATAAAGAGATAT
CGAGCAATATGGGTGTCTCGTGCAAGAACTGTGGTGGGACTGAAATTGAC
CATGATCAAGCTCGCGGGGATTCAGTATGTGTTGGATGTGGGTCAGTTGT
AGAGAGTCTTTGCATTGTCAATGAAGttgaatttcaagaaaatagcGCTG
GTAACGCTTCTGTTATTGGCCAATTCGTTTCTGCAGAAGGGCATCACAGC
AGAGCAGGATATAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCT
AGATAATGGAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGATGA
CAAATCATTGTTTGGAATCTGCTTTCATGTTTTACAAGATGGCAGTCAGT
AAGAGGTTTACATCAGGTCGAAGAACCATTCACGTCATTGGCGCGTGCTT
GTACCTGGTCTCTCGAACGGAAAAAACTCCTCatATGCTACTCGATGTTT
GTGATGTTGTGCAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAA
TTGGCGCGAGAATTATGCATCGATTGCCCCATTGTTGACCCATCATTATA
CATCCACCGCTTTGCACATCAGCTAGATTttggtgaaaaagaaaatgaag
tctCCATGTCTGCACTTCGTATTATGGCTCGAATGAAAAAAGATTGGATA
CATTTTGGGAGAAGGCCTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGC
AGCCAAATTGTACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAG
TTCGCATGAGTAAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAA
ACAGCCACTGGTAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGA
AGAGGAGGCCGACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGT
TTGCACAAGAAATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTA
GCACAAGTTACACgaactcaagaaaaattagaggAATTGCTGgataaaag
gaaaaatattcAATTCGATATCGAAGATACGAAATCGGAATCCAAAGCAT
TCGATTATAGAAAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAA
TTAGACGAAAACGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAA
AGAAGAAGGTGGCGTCAAGAAACCTCCAGAGAATGAAGagccttcttctt
cttcttcggaGAAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACT
GTCGCTAGCAGCACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAA
GTGTGATGAGAAAAAACAATTGAAAGAAGAAAGTAACCAAGGCAACCAAA
ACAACAATAGTGATGAAATCGACCTGGATGGAATTAATGATGACGAAATT
GACATGTTGCTGCTAACAgaagaagaaatcaaaatcaaaacagaagTTTG
GTTGGAAGAAAACCGAGAGTACCTCATCAAAATGAAAGagaaagaagaag
agcaacgaagaaaagaagaagaagaaaataaagatgGCATCAAAAAGAAG
AAGCGAAAATACAAgcgaaaaaacaacaaagatcgACCGGTTTGCGAAAC
TGCAGACGAAGCAATCAAAACGATGTTGGCGGAACGTAAACTTTCCAGTA
AAATCAATTACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAATATACCA
GGTTATGAAGAGAATGAACCGAGTATCGTTCCCAAAGTGGAAATGCCGTC
GGCTGATATCTCTATGGTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGC
CGGTTGTTTACGAAACTGGTTCAACGCTTGCAACATCCAAACGTGCTGTC
AGTAAGCGAAGCAAGTCTATGAGCGGACCAATCTTCGGCACAGCTTATCA
ATCTAAAAAGTTTAAAACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCG
TTGGGAAAGAAGACAAAACCAGTGAACTCGATGTCGACGAGAAGCCATTG
GAGACGGTGGTGGAATCAGGTCCTGTACAACACCACAACGAGGCTCAGAA
TCATGAGTACGAGGATGAAGAGGAAGAAATTGTGACCGCTTCTTCACTCT
TCGCCAAACAAATGGACTGTGATGAGGATTACGGAGGATTTGACGATGAA
GATGATGGATCGTTTTATTGAATGATGTGTTTACGATTTGTTTTGGATTA
CATCATGATCCGACTCAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGC
TTTTTAAGAACCACACTGTATTTAATCTgaaatgCAACCTTACTAATAAA
GAGATATCGAGCAATATGGGTGTCTCGTGCAAGAACTGTGGTGGGACTGA
AATTGACCATGATCAAGCTCGCGGGGATTCAGTATGTGTTGGATGTGGGT
CAGTTGTAGAGAGTCTTTGCATTGTCAATGAAGttgaatttcaagaaaat
agcGCTGGTAACGCTTCTGTTATTGGCCAATTCGTTTCTGCAGAAGGGCA
TCACAGCAGAGCAGGATATAAATATTCTCTAGGAAGAGATCATCGTCAAG
TCATCCTAGATAATGGAAAACGTCTTATCAACCAGCTTGGTTCCAACCTG
AAGATGACAAATCATTGTTTGGAATCTGCTTTCATGTTTTACAAGATGGC
AGTCAGTAAGAGGTTTACATCAGGTCGAAGAACCATTCACGTCATTGGCG
CGTGCTTGTACCTGGTCTCTCGAACGGAAAAAACTCCTCatATGCTACTC
GATGTTTGTGATGTTGTGCAGTGTGATGTTGTGACCCTTGGTAGAGTGTT
TTTACAATTGGCGCGAGAATTATGCATCGATTGCCCCATTGTTGACCCAT
CATTATACATCCACCGCTTTGCACATCAGCTAGATTttggtgaaaaagaa
aatgaagtctCCATGTCTGCACTTCGTATTATGGCTCGAATGAAAAAAGA
TTGGATACATTTTGGGAGAAGGCCTTCAGCTTTGTGTGGCGCAGCTTTGA
TCATAGCAGCCAAATTGTACAACTTCGAGGTGACCATGAAAGACATTGTG
AAGTTAGTTCGCATGAGTAAAACGACCGTTTTCAAACGATTGATGGATTT
CAGTAAAACAGCCACTGGTAAATTAACAACAGACGAGTTCAAAACAGTCG
ACCTTGAAGAGGAGGCCGACCCACCTTGTTATACAGAAGGGCGTAACCGT
GTCAAGTTTGCACAAGAAATAAGTGGACAATATCATTTTGTATCGACAGA
TGTTTTAGCACAAGTTACACgaactcaagaaaaattagaggAATTGCTGg
ataaaaggaaaaatattcAATTCGATATCGAAGATACGAAATCGGAATCC
AAAGCATTCGATTATAGAAAAGAACTACCGCGAGATTATTCTTTGTACAG
TTACGAATTAGACGAAAACGGTGAATTTAAGACACCATCAAAGTTCATCA
TTCATAAAGAAGAAGGTGGCGTCAAGAAACCTCCAGAGAATGAAGagcct
tcttcttcttcttcggaGAAAGATGAgaatgatgagctgaatcaaaTGAA
AGGAACTGTCGCTAGCAGCACTCTTATTATCGATCAAAGTCGAATACAAA
AGGTCAAGTGTGATGAGAAAAAACAATTGAAAGAAGAAAGTAACCAAGGC
AACCAAAACAACAATAGTGATGAAATCGACCTGGATGGAATTAATGATGA
CGAAATTGACATGTTGCTGCTAACAgaagaagaaatcaaaatcaaaacag
aagTTTGGTTGGAAGAAAACCGAGAGTACCTCATCAAAATGAAAGagaaa
gaagaagagcaacgaagaaaagaagaagaagaaaataaagatgGCATCAA
AAAGAAGAAGCGAAAATACAAgcgaaaaaacaacaaagatcgACCGGTTT
GCGAAACTGCAGACGAAGCAATCAAAACGATGTTGGCGGAACGTAAACTT
TCCAGTAAAATCAATTACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAA
TATACCAGGTTATGAAGAGAATGAACCGAGTATCGTTCCCAAAGTGGAAA
TGCCGTCGGCTGATATCTCTATGGTAACCGGAAGAAGTGAGGTGGAAGAG
AGTATGCCGGTTGTTTACGAAACTGGTTCAACGCTTGCAACATCCAAACG
TGCTGTCAGTAAGCGAAGCAAGTCTATGAGCGGACCAATCTTCGGCACAG
CTTATCAATCTAAAAAGTTTAAAACGGAGACGAAAGTGAACCTGCCCAGT
AGCAGCGTTGGGAAAGAAGACAAAACCAGTGAACTCGATGTCGACGAGAA
GCCATTGGAGACGGTGGTGGAATCAGGTCCTGTACAACACCACAACGAGG
CTCAGAATCATGAGTACGAGGATGAAGAGGAAGAAATTGTGACCGCTTCT
TCACTCTTCGCCAAACAAATGGACTGTGATGAGGATTACGGAGGATTTGA
CGATGAAGATGATGGATCGTTTTATTGAATGATGTGTTTACGATTTGTTT
TGGATTACATCATGATCCGACTCAGCTTTCCAGCATGGCGTCAACATTTT
TTTGTGCTTTTTAAGAACCACACTGTATTTAATCTgaaatgCAACCTTAC
TAATAAAGAGATATCGAGCAATATGGGTGTCTCGTGCAAGAACTGTGGTG
GGACTGAAATTGACCATGATCAAGCTCGCGGGGATTCAGTATGTGTTGGA
TGTGGGTCAGTTGTAGAGAGTCTTTGCATTGTCAATGAAGttgaatttca
agaaaatagcGCTGGTAACGCTTCTGTTATTGGCCAATTCGTTTCTGCAG
AAGGGCATCACAGCAGAGCAGGATATAAATATTCTCTAGGAAGAGATCAT
CGTCAAGTCATCCTAGATAATGGAAAACGTCTTATCAACCAGCTTGGTTC
CAACCTGAAGATGACAAATCATTGTTTGGAATCTGCTTTCATGTTTTACA
AGATGGCAGTCAGTAAGAGGTTTACATCAGGTCGAAGAACCATTCACGTC
ATTGGCGCGTGCTTGTACCTGGTCTCTCGAACGGAAAAAACTCCTCatAT
GCTACTCGATGTTTGTGATGTTGTGCAGTGTGATGTTGTGACCCTTGGTA
GAGTGTTTTTACAATTGGCGCGAGAATTATGCATCGATTGCCCCATTGTT
GACCCATCATTATACATCCACCGCTTTGCACATCAGCTAGATTttggtga
aaaagaaaatgaagtctCCATGTCTGCACTTCGTATTATGGCTCGAATGA
AAAAAGATTGGATACATTTTGGGAGAAGGCCTTCAGCTTTGTGTGGCGCA
GCTTTGATCATAGCAGCCAAATTGTACAACTTCGAGGTGACCATGAAAGA
CATTGTGAAGTTAGTTCGCATGAGTAAAACGACCGTTTTCAAACGATTGA
TGGATTTCAGTAAAACAGCCACTGGTAAATTAACAACAGACGAGTTCAAA
ACAGTCGACCTTGAAGAGGAGGCCGACCCACCTTGTTATACAGAAGGGCG
TAACCGTGTCAAGTTTGCACAAGAAATAAGTGGACAATATCATTTTGTAT
CGACAGATGTTTTAGCACAAGTTACACgaactcaagaaaaattagaggAA
TTGCTGgataaaaggaaaaatattcAATTCGATATCGAAGATACGAAATC
GGAATCCAAAGCATTCGATTATAGAAAAGAACTACCGCGAGATTATTCTT
TGTACAGTTACGAATTAGACGAAAACGGTGAATTTAAGACACCATCAAAG
TTCATCATTCATAAAGAAGAAGGTGGCGTCAAGAAACCTCCAGAGAATGA
AGagccttcttcttcttcttcggaGAAAGATGAgaatgatgagctgaatc
aaaTGAAAGGAACTGTCGCTAGCAGCACTCTTATTATCGATCAAAGTCGA
ATACAAAAGGTCAAGTGTGATGAGAAAAAACAATTGAAAGAAGAAAGTAA
CCAAGGCAACCAAAACAACAATAGTGATGAAATCGACCTGGATGGAATTA
ATGATGACGAAATTGACATGTTGCTGCTAACAgaagaagaaatcaaaatc
aaaacagaagTTTGGTTGGAAGAAAACCGAGAGTACCTCATCAAAATGAA
AGagaaagaagaagagcaacgaagaaaagaagaagaagaaaataaagatg
GCATCAAAAAGAAGAAGCGAAAATACAAgcgaaaaaacaacaaagatcgA
CCGGTTTGCGAAACTGCAGACGAAGCAATCAAAACGATGTTGGCGGAACG
TAAACTTTCCAGTAAAATCAATTACGATGTCCTGCGAGGCTTGAAGTCTG
AAGATAATATACCAGGTTATGAAGAGAATGAACCGAGTATCGTTCCCAAA
GTGGAAATGCCGTCGGCTGATATCTCTATGGTAACCGGAAGAAGTGAGGT
GGAAGAGAGTATGCCGGTTGTTTACGAAACTGGTTCAACGCTTGCAACAT
CCAAACGTGCTGTCAGTAAGCGAAGCAAGTCTATGAGCGGACCAATCTTC
GGCACAGCTTATCAATCTAAAAAGTTTAAAACGGAGACGAAAGTGAACCT
GCCCAGTAGCAGCGTTGGGAAAGAAGACAAAACCAGTGAACTCGATGTCG
ACGAGAAGCCATTGGAGACGGTGGTGGAATCAGGTCCTGTACAACACCAC
AACGAGGCTCAGAATCATGAGTACGAGGATGAAGAGGAAGAAATTGTGAC
CGCTTCTTCACTCTTCGCCAAACAAATGGACTGTGATGAGGATTACGGAG
GATTTGACGATGAAGATGATGGATCGTTTTATTGAATGATGTGTTTACGA
TTTGTTTTGGATTACATCATGATCCGACTCAGCTTTCCAGCATGGCGTCA
ACATTTTTTTGTGCTTTTTAAGAACCACACTGTATTTAATCTgaaatgCA
ACCTTACTAATAAAGAGATATCGAGCAATATGGGTGTCTCGTGCAAGAAC
TGTGGTGGGACTGAAATTGACCATGATCAAGCTCGCGGGGATTCAGTATG
TGTTGGATGTGGGTCAGTTGTAGAGAGTCTTTGCATTGTCAATGAAGttg
aatttcaagaaaatagcGCTGGTAACGCTTCTGTTATTGGCCAATTCGTT
TCTGCAGAAGGGCATCACAGCAGAGCAGGATATAAATATTCTCTAGGAAG
AGATCATCGTCAAGTCATCCTAGATAATGGAAAACGTCTTATCAACCAGC
TTGGTTCCAACCTGAAGATGACAAATCATTGTTTGGAATCTGCTTTCATG
TTTTACAAGATGGCAGTCAGTAAGAGGTTTACATCAGGTCGAAGAACCAT
TCACGTCATTGGCGCGTGCTTGTACCTGGTCTCTCGAACGGAAAAAACTC
CTCatATGCTACTCGATGTTTGTGATGTTGTGCAGTGTGATGTTGTGACC
CTTGGTAGAGTGTTTTTACAATTGGCGCGAGAATTATGCATCGATTGCCC
CATTGTTGACCCATCATTATACATCCACCGCTTTGCACATCAGCTAGATT
ttggtgaaaaagaaaatgaagtctCCATGTCTGCACTTCGTATTATGGCT
CGAATGAAAAAAGATTGGATACATTTTGGGAGAAGGCCTTCAGCTTTGTG
TGGCGCAGCTTTGATCATAGCAGCCAAATTGTACAACTTCGAGGTGACCA
TGAAAGACATTGTGAAGTTAGTTCGCATGAGTAAAACGACCGTTTTCAAA
CGATTGATGGATTTCAGTAAAACAGCCACTGGTAAATTAACAACAGACGA
GTTCAAAACAGTCGACCTTGAAGAGGAGGCCGACCCACCTTGTTATACAG
AAGGGCGTAACCGTGTCAAGTTTGCACAAGAAATAAGTGGACAATATCAT
TTTGTATCGACAGATGTTTTAGCACAAGTTACACgaactcaagaaaaatt
agaggAATTGCTGgataaaaggaaaaatattcAATTCGATATCGAAGATA
CGAAATCGGAATCCAAAGCATTCGATTATAGAAAAGAACTACCGCGAGAT
TATTCTTTGTACAGTTACGAATTAGACGAAAACGGTGAATTTAAGACACC
ATCAAAGTTCATCATTCATAAAGAAGAAGGTGGCGTCAAGAAACCTCCAG
AGAATGAAGagccttcttcttcttcttcggaGAAAGATGAgaatgatgag
ctgaatcaaaTGAAAGGAACTGTCGCTAGCAGCACTCTTATTATCGATCA
AAGTCGAATACAAAAGGTCAAGTGTGATGAGAAAAAACAATTGAAAGAAG
AAAGTAACCAAGGCAACCAAAACAACAATAGTGATGAAATCGACCTGGAT
GGAATTAATGATGACGAAATTGACATGTTGCTGCTAACAgaagaagaaat
caaaatcaaaacagaagTTTGGTTGGAAGAAAACCGAGAGTACCTCATCA
AAATGAAAGagaaagaagaagagcaacgaagaaaagaagaagaagaaaat
aaagatgGCATCAAAAAGAAGAAGCGAAAATACAAgcgaaaaaacaacaa
agatcgACCGGTTTGCGAAACTGCAGACGAAGCAATCAAAACGATGTTGG
CGGAACGTAAACTTTCCAGTAAAATCAATTACGATGTCCTGCGAGGCTTG
AAGTCTGAAGATAATATACCAGGTTATGAAGAGAATGAACCGAGTATCGT
TCCCAAAGTGGAAATGCCGTCGGCTGATATCTCTATGGTAACCGGAAGAA
GTGAGGTGGAAGAGAGTATGCCGGTTGTTTACGAAACTGGTTCAACGCTT
GCAACATCCAAACGTGCTGTCAGTAAGCGAAGCAAGTCTATGAGCGGACC
AATCTTCGGCACAGCTTATCAATCTAAAAAGTTTAAAACGGAGACGAAAG
TGAACCTGCCCAGTAGCAGCGTTGGGAAAGAAGACAAAACCAGTGAACTC
GATGTCGACGAGAAGCCATTGGAGACGGTGGTGGAATCAGGTCCTGTACA
ACACCACAACGAGGCTCAGAATCATGAGTACGAGGATGAAGAGGAAGAAA
TTGTGACCGCTTCTTCACTCTTCGCCAAACAAATGGACTGTGATGAGGAT
TACGGAGGATTTGACGATGAAGATGATGGATCGTTTTATTGAATGATGTG
TTTACGATTTGTTTTGGATTACATCATGATCCGACTCAGCTTTCCAGCAT
GGCGTCAACATTTTTTTGTGCTTTTTAAGAACCACACTGTATTTAATCTg
aaatgCAACCTTACTAATAAAGAGATATCGAGCAATATGGGTGTCTCGTG
CAAGAACTGTGGTGGGACTGAAATTGACCATGATCAAGCTCGCGGGGATT
CAGTATGTGTTGGATGTGGGTCAGTTGTAGAGAGTCTTTGCATTGTCAAT
GAAGttgaatttcaagaaaatagcGCTGGTAACGCTTCTGTTATTGGCCA
ATTCGTTTCTGCAGAAGGGCATCACAGCAGAGCAGGATATAAATATTCTC
TAGGAAGAGATCATCGTCAAGTCATCCTAGATAATGGAAAACGTCTTATC
AACCAGCTTGGTTCCAACCTGAAGATGACAAATCATTGTTTGGAATCTGC
TTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTTTACATCAGGTCGAA
GAACCATTCACGTCATTGGCGCGTGCTTGTACCTGGTCTCTCGAACGGAA
AAAACTCCTCatATGCTACTCGATGTTTGTGATGTTGTGCAGTGTGATGT
TGTGACCCTTGGTAGAGTGTTTTTACAATTGGCGCGAGAATTATGCATCG
ATTGCCCCATTGTTGACCCATCATTATACATCCACCGCTTTGCACATCAG
CTAGATTttggtgaaaaagaaaatgaagtctCCATGTCTGCACTTCGTAT
TATGGCTCGAATGAAAAAAGATTGGATACATTTTGGGAGAAGGCCTTCAG
CTTTGTGTGGCGCAGCTTTGATCATAGCAGCCAAATTGTACAACTTCGAG
GTGACCATGAAAGACATTGTGAAGTTAGTTCGCATGAGTAAAACGACCGT
TTTCAAACGATTGATGGATTTCAGTAAAACAGCCACTGGTAAATTAACAA
CAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGGCCGACCCACCTTGT
TATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAAGAAATAAGTGGACA
ATATCATTTTGTATCGACAGATGTTTTAGCACAAGTTACACgaactcaag
aaaaattagaggAATTGCTGgataaaaggaaaaatattcAATTCGATATC
GAAGATACGAAATCGGAATCCAAAGCATTCGATTATAGAAAAGAACTACC
GCGAGATTATTCTTTGTACAGTTACGAATTAGACGAAAACGGTGAATTTA
AGACACCATCAAAGTTCATCATTCATAAAGAAGAAGGTGGCGTCAAGAAA
CCTCCAGAGAATGAAGagccttcttcttcttcttcggaGAAAGATGAgaa
tgatgagctgaatcaaaTGAAAGGAACTGTCGCTAGCAGCACTCTTATTA
TCGATCAAAGTCGAATACAAAAGGTCAAGTGTGATGAGAAAAAACAATTG
AAAGAAGAAAGTAACCAAGGCAACCAAAACAACAATAGTGATGAAATCGA
CCTGGATGGAATTAATGATGACGAAATTGACATGTTGCTGCTAACAgaag
aagaaatcaaaatcaaaacagaagTTTGGTTGGAAGAAAACCGAGAGTAC
CTCATCAAAATGAAAGagaaagaagaagagcaacgaagaaaagaagaaga
agaaaataaagatgGCATCAAAAAGAAGAAGCGAAAATACAAgcgaaaaa
acaacaaagatcgACCGGTTTGCGAAACTGCAGACGAAGCAATCAAAACG
ATGTTGGCGGAACGTAAACTTTCCAGTAAAATCAATTACGATGTCCTGCG
AGGCTTGAAGTCTGAAGATAATATACCAGGTTATGAAGAGAATGAACCGA
GTATCGTTCCCAAAGTGGAAATGCCGTCGGCTGATATCTCTATGGTAACC
GGAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTGTTTACGAAACTGGTTC
AACGCTTGCAACATCCAAACGTGCTGTCAGTAAGCGAAGCAAGTCTATGA
GCGGACCAATCTTCGGCACAGCTTATCAATCTAAAAAGTTTAAAACGGAG
ACGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAAAGAAGACAAAACCAG
TGAACTCGATGTCGACGAGAAGCCATTGGAGACGGTGGTGGAATCAGGTC
CTGTACAACACCACAACGAGGCTCAGAATCATGAGTACGAGGATGAAGAG
GAAGAAATTGTGACCGCTTCTTCACTCTTCGCCAAACAAATGGACTGTGA
TGAGGATTACGGAGGATTTGACGATGAAGATGATGGATCGTTTTATTGAA
TGATGTGTTTACGATTTGTTTTGGATTACATCATGATCCGACTCAGCTTT
CCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCACACTGTATT
TAATCTgaaatgCAACCTTACTAATAAAGAGATATCGAGCAATATGGGTG
TCTCGTGCAAGAACTGTGGTGGGACTGAAATTGACCATGATCAAGCTCGC
GGGGATTCAGTATGTGTTGGATGTGGGTCAGTTGTAGAGAGTCTTTGCAT
TGTCAATGAAGttgaatttcaagaaaatagcGCTGGTAACGCTTCTGTTA
TTGGCCAATTCGTTTCTGCAGAAGGGCATCACAGCAGAGCAGGATATAAA
TATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAATGGAAAACG
TCTTATCAACCAGCTTGGTTCCAACCTGAAGATGACAAATCATTGTTTGG
AATCTGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTTTACATCA
GGTCGAAGAACCATTCACGTCATTGGCGCGTGCTTGTACCTGGTCTCTCG
AACGGAAAAAACTCCTCatATGCTACTCGATGTTTGTGATGTTGTGCAGT
GTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATTGGCGCGAGAATTA
TGCATCGATTGCCCCATTGTTGACCCATCATTATACATCCACCGCTTTGC
ACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCATGTCTGCAC
TTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTTGGGAGAAGG
CCTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGCAGCCAAATTGTACAA
CTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCATGAGTAAAA
CGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCCACTGGTAAA
TTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGGCCGACCC
ACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAAGAAATAA
GTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAAGTTACACga
actcaagaaaaattagaggAATTGCTGgataaaaggaaaaatattcAATT
CGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATTATAGAAAAG
AACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGACGAAAACGGT
GAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGAAGGTGGCGT
CAAGAAACCTCCAGAGAATGAAGagccttcttcttcttcttcggaGAAAG
ATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCTAGCAGCACT
CTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGATGAGAAAAA
ACAATTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACAATAGTGATG
AAATCGACCTGGATGGAATTAATGATGACGAAATTGACATGTTGCTGCTA
ACAgaagaagaaatcaaaatcaaaacagaagTTTGGTTGGAAGAAAACCG
AGAGTACCTCATCAAAATGAAAGagaaagaagaagagcaacgaagaaaag
aagaagaagaaaataaagatgGCATCAAAAAGAAGAAGCGAAAATACAAg
cgaaaaaacaacaaagatcgACCGGTTTGCGAAACTGCAGACGAAGCAAT
CAAAACGATGTTGGCGGAACGTAAACTTTCCAGTAAAATCAATTACGATG
TCCTGCGAGGCTTGAAGTCTGAAGATAATATACCAGGTTATGAAGAGAAT
GAACCGAGTATCGTTCCCAAAGTGGAAATGCCGTCGGCTGATATCTCTAT
GGTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTGTTTACGAAA
CTGGTTCAACGCTTGCAACATCCAAACGTGCTGTCAGTAAGCGAAGCAAG
TCTATGAGCGGACCAATCTTCGGCACAGCTTATCAATCTAAAAAGTTTAA
AACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAAAGAAGACA
AAACCAGTGAACTCGATGTCGACGAGAAGCCATTGGAGACGGTGGTGGAA
TCAGGTCCTGTACAACACCACAACGAGGCTCAGAATCATGAGTACGAGGA
TGAAGAGGAAGAAATTGTGACCGCTTCTTCACTCTTCGCCAAACAAATGG
ACTGTGATGAGGATTACGGAGGATTTGACGATGAAGATGATGGATCGTTT
TATTGAATGATGTGTTTACGATTTGTTTTGGATTACATCATGATCCGACT
CAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCACA
CTGTATTTAATCTgaaatgCAACCTTACTAATAAAGAGATATCGAGCAAT
ATGGGTGTCTCGTGCAAGAACTGTGGTGGGACTGAAATTGACCATGATCA
AGCTCGCGGGGATTCAGTATGTGTTGGATGTGGGTCAGTTGTAGAGAGTC
TTTGCATTGTCAATGAAGttgaatttcaagaaaatagcGCTGGTAACGCT
TCTGTTATTGGCCAATTCGTTTCTGCAGAAGGGCATCACAGCAGAGCAGG
ATATAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAATG
GAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGATGACAAATCAT
TGTTTGGAATCTGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTT
TACATCAGGTCGAAGAACCATTCACGTCATTGGCGCGTGCTTGTACCTGG
TCTCTCGAACGGAAAAAACTCCTCatATGCTACTCGATGTTTGTGATGTT
GTGCAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATTGGCGCG
AGAATTATGCATCGATTGCCCCATTGTTGACCCATCATTATACATCCACC
GCTTTGCACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCATG
TCTGCACTTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTTGG
GAGAAGGCCTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGCAGCCAAAT
TGTACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCATG
AGTAAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCCAC
TGGTAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGG
CCGACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAA
GAAATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAAGT
TACACgaactcaagaaaaattagaggAATTGCTGgataaaaggaaaaata
ttcAATTCGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATTAT
AGAAAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGACGA
AAACGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGAAG
GTGGCGTCAAGAAACCTCCAGAGAATGAAGagccttcttcttcttcttcg
gaGAAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCTAG
CAGCACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGATG
AGAAAAAACAATTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACAAT
AGTGATGAAATCGACCTGGATGGAATTAATGATGACGAAATTGACATGTT
GCTGCTAACAgaagaagaaatcaaaatcaaaacagaagTTTGGTTGGAAG
AAAACCGAGAGTACCTCATCAAAATGAAAGagaaagaagaagagcaacga
agaaaagaagaagaagaaaataaagatgGCATCAAAAAGAAGAAGCGAAA
ATACAAgcgaaaaaacaacaaagatcgACCGGTTTGCGAAACTGCAGACG
AAGCAATCAAAACGATGTTGGCGGAACGTAAACTTTCCAGTAAAATCAAT
TACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAATATACCAGGTTATGA
AGAGAATGAACCGAGTATCGTTCCCAAAGTGGAAATGCCGTCGGCTGATA
TCTCTATGGTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTGTT
TACGAAACTGGTTCAACGCTTGCAACATCCAAACGTGCTGTCAGTAAGCG
AAGCAAGTCTATGAGCGGACCAATCTTCGGCACAGCTTATCAATCTAAAA
AGTTTAAAACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAAA
GAAGACAAAACCAGTGAACTCGATGTCGACGAGAAGCCATTGGAGACGGT
GGTGGAATCAGGTCCTGTACAACACCACAACGAGGCTCAGAATCATGAGT
ACGAGGATGAAGAGGAAGAAATTGTGACCGCTTCTTCACTCTTCGCCAAA
CAAATGGACTGTGATGAGGATTACGGAGGATTTGACGATGAAGATGATGG
ATCGTTTTATTGAATGATGTGTTTACGATTTGTTTTGGATTACATCATGA
TCCGACTCAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAG
AACCACACTGTATTTAATCTgaaatgCAACCTTACTAATAAAGAGATATC
GAGCAATATGGGTGTCTCGTGCAAGAACTGTGGTGGGACTGAAATTGACC
ATGATCAAGCTCGCGGGGATTCAGTATGTGTTGGATGTGGGTCAGTTGTA
GAGAGTCTTTGCATTGTCAATGAAGttgaatttcaagaaaatagcGCTGG
TAACGCTTCTGTTATTGGCCAATTCGTTTCTGCAGAAGGGCATCACAGCA
GAGCAGGATATAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTA
GATAATGGAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGATGAC
AAATCATTGTTTGGAATCTGCTTTCATGTTTTACAAGATGGCAGTCAGTA
AGAGGTTTACATCAGGTCGAAGAACCATTCACGTCATTGGCGCGTGCTTG
TACCTGGTCTCTCGAACGGAAAAAACTCCTCatATGCTACTCGATGTTTG
TGATGTTGTGCAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAAT
TGGCGCGAGAATTATGCATCGATTGCCCCATTGTTGACCCATCATTATAC
ATCCACCGCTTTGCACATCAGCTAGATTttggtgaaaaagaaaatgaagt
ctCCATGTCTGCACTTCGTATTATGGCTCGAATGAAAAAAGATTGGATAC
ATTTTGGGAGAAGGCCTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGCA
GCCAAATTGTACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGT
TCGCATGAGTAAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAA
CAGCCACTGGTAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAA
GAGGAGGCCGACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTT
TGCACAAGAAATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTAG
CACAAGTTACACgaactcaagaaaaattagaggAATTGCTGgataaaagg
aaaaatattcAATTCGATATCGAAGATACGAAATCGGAATCCAAAGCATT
CGATTATAGAAAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAAT
TAGACGAAAACGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAAA
GAAGAAGGTGGCGTCAAGAAACCTCCAGAGAATGAAGagccttcttcttc
ttcttcggaGAAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACTG
TCGCTAGCAGCACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAG
TGTGATGAGAAAAAACAATTGAAAGAAGAAAGTAACCAAGGCAACCAAAA
CAACAATAGTGATGAAATCGACCTGGATGGAATTAATGATGACGAAATTG
ACATGTTGCTGCTAACAgaagaagaaatcaaaatcaaaacagaagTTTGG
TTGGAAGAAAACCGAGAGTACCTCATCAAAATGAAAGagaaagaagaaga
gcaacgaagaaaagaagaagaagaaaataaagatgGCATCAAAAAGAAGA
AGCGAAAATACAAgcgaaaaaacaacaaagatcgACCGGTTTGCGAAACT
GCAGACGAAGCAATCAAAACGATGTTGGCGGAACGTAAACTTTCCAGTAA
AATCAATTACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAATATACCAG
GTTATGAAGAGAATGAACCGAGTATCGTTCCCAAAGTGGAAATGCCGTCG
GCTGATATCTCTATGGTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGCC
GGTTGTTTACGAAACTGGTTCAACGCTTGCAACATCCAAACGTGCTGTCA
GTAAGCGAAGCAAGTCTATGAGCGGACCAATCTTCGGCACAGCTTATCAA
TCTAAAAAGTTTAAAACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCGT
TGGGAAAGAAGACAAAACCAGTGAACTCGATGTCGACGAGAAGCCATTGG
AGACGGTGGTGGAATCAGGTCCTGTACAACACCACAACGAGGCTCAGAAT
CATGAGTACGAGGATGAAGAGGAAGAAATTGTGACCGCTTCTTCACTCTT
CGCCAAACAAATGGACTGTGATGAGGATTACGGAGGATTTGACGATGAAG
ATGATGGATCGTTTTATTGAATGATGTGTTTACGATTTGTTTTGGATTAC
ATCATGATCCGACTCAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCT
TTTTAAGAACCACACTGTATTTAATCTgaaatgCAACCTTACTAATAAAG
AGATATCGAGCAATATGGGTGTCTCGTGCAAGAACTGTGGTGGGACTGAA
ATTGACCATGATCAAGCTCGCGGGGATTCAGTATGTGTTGGATGTGGGTC
AGTTGTAGAGAGTCTTTGCATTGTCAATGAAGttgaatttcaagaaaata
gcGCTGGTAACGCTTCTGTTATTGGCCAATTCGTTTCTGCAGAAGGGCAT
CACAGCAGAGCAGGATATAAATATTCTCTAGGAAGAGATCATCGTCAAGT
CATCCTAGATAATGGAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGA
AGATGACAAATCATTGTTTGGAATCTGCTTTCATGTTTTACAAGATGGCA
GTCAGTAAGAGGTTTACATCAGGTCGAAGAACCATTCACGTCATTGGCGC
GTGCTTGTACCTGGTCTCTCGAACGGAAAAAACTCCTCatATGCTACTCG
ATGTTTGTGATGTTGTGCAGTGTGATGTTGTGACCCTTGGTAGAGTGTTT
TTACAATTGGCGCGAGAATTATGCATCGATTGCCCCATTGTTGACCCATC
ATTATACATCCACCGCTTTGCACATCAGCTAGATTttggtgaaaaagaaa
atgaagtctCCATGTCTGCACTTCGTATTATGGCTCGAATGAAAAAAGAT
TGGATACATTTTGGGAGAAGGCCTTCAGCTTTGTGTGGCGCAGCTTTGAT
CATAGCAGCCAAATTGTACAACTTCGAGGTGACCATGAAAGACATTGTGA
AGTTAGTTCGCATGAGTAAAACGACCGTTTTCAAACGATTGATGGATTTC
AGTAAAACAGCCACTGGTAAATTAACAACAGACGAGTTCAAAACAGTCGA
CCTTGAAGAGGAGGCCGACCCACCTTGTTATACAGAAGGGCGTAACCGTG
TCAAGTTTGCACAAGAAATAAGTGGACAATATCATTTTGTATCGACAGAT
GTTTTAGCACAAGTTACACgaactcaagaaaaattagaggAATTGCTGga
taaaaggaaaaatattcAATTCGATATCGAAGATACGAAATCGGAATCCA
AAGCATTCGATTATAGAAAAGAACTACCGCGAGATTATTCTTTGTACAGT
TACGAATTAGACGAAAACGGTGAATTTAAGACACCATCAAAGTTCATCAT
TCATAAAGAAGAAGGTGGCGTCAAGAAACCTCCAGAGAATGAAGagcctt
cttcttcttcttcggaGAAAGATGAgaatgatgagctgaatcaaaTGAAA
GGAACTGTCGCTAGCAGCACTCTTATTATCGATCAAAGTCGAATACAAAA
GGTCAAGTGTGATGAGAAAAAACAATTGAAAGAAGAAAGTAACCAAGGCA
ACCAAAACAACAATAGTGATGAAATCGACCTGGATGGAATTAATGATGAC
GAAATTGACATGTTGCTGCTAACAgaagaagaaatcaaaatcaaaacaga
agTTTGGTTGGAAGAAAACCGAGAGTACCTCATCAAAATGAAAGagaaag
aagaagagcaacgaagaaaagaagaagaagaaaataaagatgGCATCAAA
AAGAAGAAGCGAAAATACAAgcgaaaaaacaacaaagatcgACCGGTTTG
CGAAACTGCAGACGAAGCAATCAAAACGATGTTGGCGGAACGTAAACTTT
CCAGTAAAATCAATTACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAAT
ATACCAGGTTATGAAGAGAATGAACCGAGTATCGTTCCCAAAGTGGAAAT
GCCGTCGGCTGATATCTCTATGGTAACCGGAAGAAGTGAGGTGGAAGAGA
GTATGCCGGTTGTTTACGAAACTGGTTCAACGCTTGCAACATCCAAACGT
GCTGTCAGTAAGCGAAGCAAGTCTATGAGCGGACCAATCTTCGGCACAGC
TTATCAATCTAAAAAGTTTAAAACGGAGACGAAAGTGAACCTGCCCAGTA
GCAGCGTTGGGAAAGAAGACAAAACCAGTGAACTCGATGTCGACGAGAAG
CCATTGGAGACGGTGGTGGAATCAGGTCCTGTACAACACCACAACGAGGC
TCAGAATCATGAGTACGAGGATGAAGAGGAAGAAATTGTGACCGCTTCTT
CACTCTTCGCCAAACAAATGGACTGTGATGAGGATTACGGAGGATTTGAC
GATGAAGATGATGGATCGTTTTATTGAATGATGTGTTTACGATTTGTTTT
GGATTACATCATGATCCGACTCAGCTTTCCAGCATGGCGTCAACATTTTT
TTGTGCTTTTTAAGAACCACACTGTATTTAATCTgaaatgCAACCTTACT
AATAAAGAGATATCGAGCAATATGGGTGTCTCGTGCAAGAACTGTGGTGG
GACTGAAATTGACCATGATCAAGCTCGCGGGGATTCAGTATGTGTTGGAT
GTGGGTCAGTTGTAGAGAGTCTTTGCATTGTCAATGAAGttgaatttcaa
gaaaatagcGCTGGTAACGCTTCTGTTATTGGCCAATTCGTTTCTGCAGA
AGGGCATCACAGCAGAGCAGGATATAAATATTCTCTAGGAAGAGATCATC
GTCAAGTCATCCTAGATAATGGAAAACGTCTTATCAACCAGCTTGGTTCC
AACCTGAAGATGACAAATCATTGTTTGGAATCTGCTTTCATGTTTTACAA
GATGGCAGTCAGTAAGAGGTTTACATCAGGTCGAAGAACCATTCACGTCA
TTGGCGCGTGCTTGTACCTGGTCTCTCGAACGGAAAAAACTCCTCatATG
CTACTCGATGTTTGTGATGTTGTGCAGTGTGATGTTGTGACCCTTGGTAG
AGTGTTTTTACAATTGGCGCGAGAATTATGCATCGATTGCCCCATTGTTG
ACCCATCATTATACATCCACCGCTTTGCACATCAGCTAGATTttggtgaa
aaagaaaatgaagtctCCATGTCTGCACTTCGTATTATGGCTCGAATGAA
AAAAGATTGGATACATTTTGGGAGAAGGCCTTCAGCTTTGTGTGGCGCAG
CTTTGATCATAGCAGCCAAATTGTACAACTTCGAGGTGACCATGAAAGAC
ATTGTGAAGTTAGTTCGCATGAGTAAAACGACCGTTTTCAAACGATTGAT
GGATTTCAGTAAAACAGCCACTGGTAAATTAACAACAGACGAGTTCAAAA
CAGTCGACCTTGAAGAGGAGGCCGACCCACCTTGTTATACAGAAGGGCGT
AACCGTGTCAAGTTTGCACAAGAAATAAGTGGACAATATCATTTTGTATC
GACAGATGTTTTAGCACAAGTTACACgaactcaagaaaaattagaggAAT
TGCTGgataaaaggaaaaatattcAATTCGATATCGAAGATACGAAATCG
GAATCCAAAGCATTCGATTATAGAAAAGAACTACCGCGAGATTATTCTTT
GTACAGTTACGAATTAGACGAAAACGGTGAATTTAAGACACCATCAAAGT
TCATCATTCATAAAGAAGAAGGTGGCGTCAAGAAACCTCCAGAGAATGAA
GagccttcttcttcttcttcggaGAAAGATGAgaatgatgagctgaatca
aaTGAAAGGAACTGTCGCTAGCAGCACTCTTATTATCGATCAAAGTCGAA
TACAAAAGGTCAAGTGTGATGAGAAAAAACAATTGAAAGAAGAAAGTAAC
CAAGGCAACCAAAACAACAATAGTGATGAAATCGACCTGGATGGAATTAA
TGATGACGAAATTGACATGTTGCTGCTAACAgaagaagaaatcaaaatca
aaacagaagTTTGGTTGGAAGAAAACCGAGAGTACCTCATCAAAATGAAA
GagaaagaagaagagcaacgaagaaaagaagaagaagaaaataaagatgG
CATCAAAAAGAAGAAGCGAAAATACAAgcgaaaaaacaacaaagatcgAC
CGGTTTGCGAAACTGCAGACGAAGCAATCAAAACGATGTTGGCGGAACGT
AAACTTTCCAGTAAAATCAATTACGATGTCCTGCGAGGCTTGAAGTCTGA
AGATAATATACCAGGTTATGAAGAGAATGAACCGAGTATCGTTCCCAAAG
TGGAAATGCCGTCGGCTGATATCTCTATGGTAACCGGAAGAAGTGAGGTG
GAAGAGAGTATGCCGGTTGTTTACGAAACTGGTTCAACGCTTGCAACATC
CAAACGTGCTGTCAGTAAGCGAAGCAAGTCTATGAGCGGACCAATCTTCG
GCACAGCTTATCAATCTAAAAAGTTTAAAACGGAGACGAAAGTGAACCTG
CCCAGTAGCAGCGTTGGGAAAGAAGACAAAACCAGTGAACTCGATGTCGA
CGAGAAGCCATTGGAGACGGTGGTGGAATCAGGTCCTGTACAACACCACA
ACGAGGCTCAGAATCATGAGTACGAGGATGAAGAGGAAGAAATTGTGACC
GCTTCTTCACTCTTCGCCAAACAAATGGACTGTGATGAGGATTACGGAGG
ATTTGACGATGAAGATGATGGATCGTTTTATTGAATGATGTGTTTACGAT
TTGTTTTGGATTACATCATGATCCGACTCAGCTTTCCAGCATGGCGTCAA
CATTTTTTTGTGCTTTTTAAGAACCACACTGTATTTAATCTgaaatgCAA
CCTTACTAATAAAGAGATATCGAGCAATATGGGTGTCTCGTGCAAGAACT
GTGGTGGGACTGAAATTGACCATGATCAAGCTCGCGGGGATTCAGTATGT
GTTGGATGTGGGTCAGTTGTAGAGAGTCTTTGCATTGTCAATGAAGttga
atttcaagaaaatagcGCTGGTAACGCTTCTGTTATTGGCCAATTCGTTT
CTGCAGAAGGGCATCACAGCAGAGCAGGATATAAATATTCTCTAGGAAGA
GATCATCGTCAAGTCATCCTAGATAATGGAAAACGTCTTATCAACCAGCT
TGGTTCCAACCTGAAGATGACAAATCATTGTTTGGAATCTGCTTTCATGT
TTTACAAGATGGCAGTCAGTAAGAGGTTTACATCAGGTCGAAGAACCATT
CACGTCATTGGCGCGTGCTTGTACCTGGTCTCTCGAACGGAAAAAACTCC
TCatATGCTACTCGATGTTTGTGATGTTGTGCAGTGTGATGTTGTGACCC
TTGGTAGAGTGTTTTTACAATTGGCGCGAGAATTATGCATCGATTGCCCC
ATTGTTGACCCATCATTATACATCCACCGCTTTGCACATCAGCTAGATTt
tggtgaaaaagaaaatgaagtctCCATGTCTGCACTTCGTATTATGGCTC
GAATGAAAAAAGATTGGATACATTTTGGGAGAAGGCCTTCAGCTTTGTGT
GGCGCAGCTTTGATCATAGCAGCCAAATTGTACAACTTCGAGGTGACCAT
GAAAGACATTGTGAAGTTAGTTCGCATGAGTAAAACGACCGTTTTCAAAC
GATTGATGGATTTCAGTAAAACAGCCACTGGTAAATTAACAACAGACGAG
TTCAAAACAGTCGACCTTGAAGAGGAGGCCGACCCACCTTGTTATACAGA
AGGGCGTAACCGTGTCAAGTTTGCACAAGAAATAAGTGGACAATATCATT
TTGTATCGACAGATGTTTTAGCACAAGTTACACgaactcaagaaaaatta
gaggAATTGCTGgataaaaggaaaaatattcAATTCGATATCGAAGATAC
GAAATCGGAATCCAAAGCATTCGATTATAGAAAAGAACTACCGCGAGATT
ATTCTTTGTACAGTTACGAATTAGACGAAAACGGTGAATTTAAGACACCA
TCAAAGTTCATCATTCATAAAGAAGAAGGTGGCGTCAAGAAACCTCCAGA
GAATGAAGagccttcttcttcttcttcggaGAAAGATGAgaatgatgagc
tgaatcaaaTGAAAGGAACTGTCGCTAGCAGCACTCTTATTATCGATCAA
AGTCGAATACAAAAGGTCAAGTGTGATGAGAAAAAACAATTGAAAGAAGA
AAGTAACCAAGGCAACCAAAACAACAATAGTGATGAAATCGACCTGGATG
GAATTAATGATGACGAAATTGACATGTTGCTGCTAACAgaagaagaaatc
aaaatcaaaacagaagTTTGGTTGGAAGAAAACCGAGAGTACCTCATCAA
AATGAAAGagaaagaagaagagcaacgaagaaaagaagaagaagaaaata
aagatgGCATCAAAAAGAAGAAGCGAAAATACAAgcgaaaaaacaacaaa
gatcgACCGGTTTGCGAAACTGCAGACGAAGCAATCAAAACGATGTTGGC
GGAACGTAAACTTTCCAGTAAAATCAATTACGATGTCCTGCGAGGCTTGA
AGTCTGAAGATAATATACCAGGTTATGAAGAGAATGAACCGAGTATCGTT
CCCAAAGTGGAAATGCCGTCGGCTGATATCTCTATGGTAACCGGAAGAAG
TGAGGTGGAAGAGAGTATGCCGGTTGTTTACGAAACTGGTTCAACGCTTG
CAACATCCAAACGTGCTGTCAGTAAGCGAAGCAAGTCTATGAGCGGACCA
ATCTTCGGCACAGCTTATCAATCTAAAAAGTTTAAAACGGAGACGAAAGT
GAACCTGCCCAGTAGCAGCGTTGGGAAAGAAGACAAAACCAGTGAACTCG
ATGTCGACGAGAAGCCATTGGAGACGGTGGTGGAATCAGGTCCTGTACAA
CACCACAACGAGGCTCAGAATCATGAGTACGAGGATGAAGAGGAAGAAAT
TGTGACCGCTTCTTCACTCTTCGCCAAACAAATGGACTGTGATGAGGATT
ACGGAGGATTTGACGATGAAGATGATGGATCGTTTTATTGAATGATGTGT
TTACGATTTGTTTTGGATTACATCATGATCCGACTCAGCTTTCCAGCATG
GCGTCAACATTTTTTTGTGCTTTTTAAGAACCACACTGTATTTAATCTga
aatgCAACCTTACTAATAAAGAGATATCGAGCAATATGGGTGTCTCGTGC
AAGAACTGTGGTGGGACTGAAATTGACCATGATCAAGCTCGCGGGGATTC
AGTATGTGTTGGATGTGGGTCAGTTGTAGAGAGTCTTTGCATTGTCAATG
AAGttgaatttcaagaaaatagcGCTGGTAACGCTTCTGTTATTGGCCAA
TTCGTTTCTGCAGAAGGGCATCACAGCAGAGCAGGATATAAATATTCTCT
AGGAAGAGATCATCGTCAAGTCATCCTAGATAATGGAAAACGTCTTATCA
ACCAGCTTGGTTCCAACCTGAAGATGACAAATCATTGTTTGGAATCTGCT
TTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTTTACATCAGGTCGAAG
AACCATTCACGTCATTGGCGCGTGCTTGTACCTGGTCTCTCGAACGGAAA
AAACTCCTCatATGCTACTCGATGTTTGTGATGTTGTGCAGTGTGATGTT
GTGACCCTTGGTAGAGTGTTTTTACAATTGGCGCGAGAATTATGCATCGA
TTGCCCCATTGTTGACCCATCATTATACATCCACCGCTTTGCACATCAGC
TAGATTttggtgaaaaagaaaatgaagtctCCATGTCTGCACTTCGTATT
ATGGCTCGAATGAAAAAAGATTGGATACATTTTGGGAGAAGGCCTTCAGC
TTTGTGTGGCGCAGCTTTGATCATAGCAGCCAAATTGTACAACTTCGAGG
TGACCATGAAAGACATTGTGAAGTTAGTTCGCATGAGTAAAACGACCGTT
TTCAAACGATTGATGGATTTCAGTAAAACAGCCACTGGTAAATTAACAAC
AGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGGCCGACCCACCTTGTT
ATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAAGAAATAAGTGGACAA
TATCATTTTGTATCGACAGATGTTTTAGCACAAGTTACACgaactcaaga
aaaattagaggAATTGCTGgataaaaggaaaaatattcAATTCGATATCG
AAGATACGAAATCGGAATCCAAAGCATTCGATTATAGAAAAGAACTACCG
CGAGATTATTCTTTGTACAGTTACGAATTAGACGAAAACGGTGAATTTAA
GACACCATCAAAGTTCATCATTCATAAAGAAGAAGGTGGCGTCAAGAAAC
CTCCAGAGAATGAAGagccttcttcttcttcttcggaGAAAGATGAgaat
gatgagctgaatcaaaTGAAAGGAACTGTCGCTAGCAGCACTCTTATTAT
CGATCAAAGTCGAATACAAAAGGTCAAGTGTGATGAGAAAAAACAATTGA
AAGAAGAAAGTAACCAAGGCAACCAAAACAACAATAGTGATGAAATCGAC
CTGGATGGAATTAATGATGACGAAATTGACATGTTGCTGCTAACAgaaga
agaaatcaaaatcaaaacagaagTTTGGTTGGAAGAAAACCGAGAGTACC
TCATCAAAATGAAAGagaaagaagaagagcaacgaagaaaagaagaagaa
gaaaataaagatgGCATCAAAAAGAAGAAGCGAAAATACAAgcgaaaaaa
caacaaagatcgACCGGTTTGCGAAACTGCAGACGAAGCAATCAAAACGA
TGTTGGCGGAACGTAAACTTTCCAGTAAAATCAATTACGATGTCCTGCGA
GGCTTGAAGTCTGAAGATAATATACCAGGTTATGAAGAGAATGAACCGAG
TATCGTTCCCAAAGTGGAAATGCCGTCGGCTGATATCTCTATGGTAACCG
GAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTGTTTACGAAACTGGTTCA
ACGCTTGCAACATCCAAACGTGCTGTCAGTAAGCGAAGCAAGTCTATGAG
CGGACCAATCTTCGGCACAGCTTATCAATCTAAAAAGTTTAAAACGGAGA
CGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAAAGAAGACAAAACCAGT
GAACTCGATGTCGACGAGAAGCCATTGGAGACGGTGGTGGAATCAGGTCC
TGTACAACACCACAACGAGGCTCAGAATCATGAGTACGAGGATGAAGAGG
AAGAAATTGTGACCGCTTCTTCACTCTTCGCCAAACAAATGGACTGTGAT
GAGGATTACGGAGGATTTGACGATGAAGATGATGGATCGTTTTATTGAAT
GATGTGTTTACGATTTGTTTTGGATTACATCATGATCCGACTCAGCTTTC
CAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCACACTGTATTT
AATCTgaaatgCAACCTTACTAATAAAGAGATATCGAGCAATATGGGTGT
CTCGTGCAAGAACTGTGGTGGGACTGAAATTGACCATGATCAAGCTCGCG
GGGATTCAGTATGTGTTGGATGTGGGTCAGTTGTAGAGAGTCTTTGCATT
GTCAATGAAGttgaatttcaagaaaatagcGCTGGTAACGCTTCTGTTAT
TGGCCAATTCGTTTCTGCAGAAGGGCATCACAGCAGAGCAGGATATAAAT
ATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAATGGAAAACGT
CTTATCAACCAGCTTGGTTCCAACCTGAAGATGACAAATCATTGTTTGGA
ATCTGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTTTACATCAG
GTCGAAGAACCATTCACGTCATTGGCGCGTGCTTGTACCTGGTCTCTCGA
ACGGAAAAAACTCCTCatATGCTACTCGATGTTTGTGATGTTGTGCAGTG
TGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATTGGCGCGAGAATTAT
GCATCGATTGCCCCATTGTTGACCCATCATTATACATCCACCGCTTTGCA
CATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCATGTCTGCACT
TCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTTGGGAGAAGGC
CTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGCAGCCAAATTGTACAAC
TTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCATGAGTAAAAC
GACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCCACTGGTAAAT
TAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGGCCGACCCA
CCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAAGAAATAAG
TGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAAGTTACACgaa
ctcaagaaaaattagaggAATTGCTGgataaaaggaaaaatattcAATTC
GATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATTATAGAAAAGA
ACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGACGAAAACGGTG
AATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGAAGGTGGCGTC
AAGAAACCTCCAGAGAATGAAGagccttcttcttcttcttcggaGAAAGA
TGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCTAGCAGCACTC
TTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGATGAGAAAAAA
CAATTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACAATAGTGATGA
AATCGACCTGGATGGAATTAATGATGACGAAATTGACATGTTGCTGCTAA
CAgaagaagaaatcaaaatcaaaacagaagTTTGGTTGGAAGAAAACCGA
GAGTACCTCATCAAAATGAAAGagaaagaagaagagcaacgaagaaaaga
agaagaagaaaataaagatgGCATCAAAAAGAAGAAGCGAAAATACAAgc
gaaaaaacaacaaagatcgACCGGTTTGCGAAACTGCAGACGAAGCAATC
AAAACGATGTTGGCGGAACGTAAACTTTCCAGTAAAATCAATTACGATGT
CCTGCGAGGCTTGAAGTCTGAAGATAATATACCAGGTTATGAAGAGAATG
AACCGAGTATCGTTCCCAAAGTGGAAATGCCGTCGGCTGATATCTCTATG
GTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTGTTTACGAAAC
TGGTTCAACGCTTGCAACATCCAAACGTGCTGTCAGTAAGCGAAGCAAGT
CTATGAGCGGACCAATCTTCGGCACAGCTTATCAATCTAAAAAGTTTAAA
ACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAAAGAAGACAA
AACCAGTGAACTCGATGTCGACGAGAAGCCATTGGAGACGGTGGTGGAAT
CAGGTCCTGTACAACACCACAACGAGGCTCAGAATCATGAGTACGAGGAT
GAAGAGGAAGAAATTGTGACCGCTTCTTCACTCTTCGCCAAACAAATGGA
CTGTGATGAGGATTACGGAGGATTTGACGATGAAGATGATGGATCGTTTT
ATTGAATGATGTGTTTACGATTTGTTTTGGATTACATCATGATCCGACTC
AGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCACAC
TGTATTTAATCTgaaatgCAACCTTACTAATAAAGAGATATCGAGCAATA
TGGGTGTCTCGTGCAAGAACTGTGGTGGGACTGAAATTGACCATGATCAA
GCTCGCGGGGATTCAGTATGTGTTGGATGTGGGTCAGTTGTAGAGAGTCT
TTGCATTGTCAATGAAGttgaatttcaagaaaatagcGCTGGTAACGCTT
CTGTTATTGGCCAATTCGTTTCTGCAGAAGGGCATCACAGCAGAGCAGGA
TATAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAATGG
AAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGATGACAAATCATT
GTTTGGAATCTGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTTT
ACATCAGGTCGAAGAACCATTCACGTCATTGGCGCGTGCTTGTACCTGGT
CTCTCGAACGGAAAAAACTCCTCatATGCTACTCGATGTTTGTGATGTTG
TGCAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATTGGCGCGA
GAATTATGCATCGATTGCCCCATTGTTGACCCATCATTATACATCCACCG
CTTTGCACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCATGT
CTGCACTTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTTGGG
AGAAGGCCTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGCAGCCAAATT
GTACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCATGA
GTAAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCCACT
GGTAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGGC
CGACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAAG
AAATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAAGTT
ACACgaactcaagaaaaattagaggAATTGCTGgataaaaggaaaaatat
tcAATTCGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATTATA
GAAAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGACGAA
AACGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGAAGG
TGGCGTCAAGAAACCTCCAGAGAATGAAGagccttcttcttcttcttcgg
aGAAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCTAGC
AGCACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGATGA
GAAAAAACAATTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACAATA
GTGATGAAATCGACCTGGATGGAATTAATGATGACGAAATTGACATGTTG
CTGCTAACAgaagaagaaatcaaaatcaaaacagaagTTTGGTTGGAAGA
AAACCGAGAGTACCTCATCAAAATGAAAGagaaagaagaagagcaacgaa
gaaaagaagaagaagaaaataaagatgGCATCAAAAAGAAGAAGCGAAAA
TACAAgcgaaaaaacaacaaagatcgACCGGTTTGCGAAACTGCAGACGA
AGCAATCAAAACGATGTTGGCGGAACGTAAACTTTCCAGTAAAATCAATT
ACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAATATACCAGGTTATGAA
GAGAATGAACCGAGTATCGTTCCCAAAGTGGAAATGCCGTCGGCTGATAT
CTCTATGGTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTGTTT
ACGAAACTGGTTCAACGCTTGCAACATCCAAACGTGCTGTCAGTAAGCGA
AGCAAGTCTATGAGCGGACCAATCTTCGGCACAGCTTATCAATCTAAAAA
GTTTAAAACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAAAG
AAGACAAAACCAGTGAACTCGATGTCGACGAGAAGCCATTGGAGACGGTG
GTGGAATCAGGTCCTGTACAACACCACAACGAGGCTCAGAATCATGAGTA
CGAGGATGAAGAGGAAGAAATTGTGACCGCTTCTTCACTCTTCGCCAAAC
AAATGGACTGTGATGAGGATTACGGAGGATTTGACGATGAAGATGATGGA
TCGTTTTATTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045584XLOC_045584Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073442-exon-scaffold_92-1491911889:156498..157212TCONS_00073442-exon-scaffold_92-1491911889:156498..157212Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:156498..157212TCONS_00073442-exon-scaffold_92-1510915933:156498..157212Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:156498..157212TCONS_00073442-exon-scaffold_92-1575043694:156498..157212Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:164435..164652TCONS_00073442-exon-scaffold_92-1491911889:164435..164652Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:164435..164652TCONS_00073442-exon-scaffold_92-1510915933:164435..164652Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:164435..164652TCONS_00073442-exon-scaffold_92-1575043694:164435..164652Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:165478..165546TCONS_00073442-exon-scaffold_92-1491911889:165478..165546Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:165478..165546TCONS_00073442-exon-scaffold_92-1510915933:165478..165546Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:165478..165546TCONS_00073442-exon-scaffold_92-1575043694:165478..165546Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:166358..166531TCONS_00073442-exon-scaffold_92-1491911889:166358..166531Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:166358..166531TCONS_00073442-exon-scaffold_92-1510915933:166358..166531Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:166358..166531TCONS_00073442-exon-scaffold_92-1575043694:166358..166531Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:166637..166668TCONS_00073442-exon-scaffold_92-1491911889:166637..166668Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:166637..166668TCONS_00073442-exon-scaffold_92-1510915933:166637..166668Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:166637..166668TCONS_00073442-exon-scaffold_92-1575043694:166637..166668Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:166874..166946TCONS_00073442-exon-scaffold_92-1491911889:166874..166946Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:166874..166946TCONS_00073442-exon-scaffold_92-1510915933:166874..166946Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:166874..166946TCONS_00073442-exon-scaffold_92-1575043694:166874..166946Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:167223..167372TCONS_00073442-exon-scaffold_92-1491911889:167223..167372Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:167223..167372TCONS_00073442-exon-scaffold_92-1510915933:167223..167372Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:167223..167372TCONS_00073442-exon-scaffold_92-1575043694:167223..167372Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:167676..168305TCONS_00073442-exon-scaffold_92-1491911889:167676..168305Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:167676..168305TCONS_00073442-exon-scaffold_92-1510915933:167676..168305Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:167676..168305TCONS_00073442-exon-scaffold_92-1575043694:167676..168305Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:168796..168884TCONS_00073442-exon-scaffold_92-1491911889:168796..168884Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:168796..168884TCONS_00073442-exon-scaffold_92-1510915933:168796..168884Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:168796..168884TCONS_00073442-exon-scaffold_92-1575043694:168796..168884Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:169119..169200TCONS_00073442-exon-scaffold_92-1491911889:169119..169200Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:169119..169200TCONS_00073442-exon-scaffold_92-1510915933:169119..169200Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:169119..169200TCONS_00073442-exon-scaffold_92-1575043694:169119..169200Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:169553..169611TCONS_00073442-exon-scaffold_92-1491911889:169553..169611Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:169553..169611TCONS_00073442-exon-scaffold_92-1510915933:169553..169611Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:169553..169611TCONS_00073442-exon-scaffold_92-1575043694:169553..169611Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:170153..170306TCONS_00073442-exon-scaffold_92-1491911889:170153..170306Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:170153..170306TCONS_00073442-exon-scaffold_92-1510915933:170153..170306Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:170153..170306TCONS_00073442-exon-scaffold_92-1575043694:170153..170306Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:171070..171229TCONS_00073442-exon-scaffold_92-1491911889:171070..171229Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:171070..171229TCONS_00073442-exon-scaffold_92-1510915933:171070..171229Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:171070..171229TCONS_00073442-exon-scaffold_92-1575043694:171070..171229Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:171420..171474TCONS_00073442-exon-scaffold_92-1491911889:171420..171474Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:171420..171474TCONS_00073442-exon-scaffold_92-1510915933:171420..171474Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:171420..171474TCONS_00073442-exon-scaffold_92-1575043694:171420..171474Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:172090..172291TCONS_00073442-exon-scaffold_92-1491911889:172090..172291Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:172090..172291TCONS_00073442-exon-scaffold_92-1510915933:172090..172291Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:172090..172291TCONS_00073442-exon-scaffold_92-1575043694:172090..172291Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1491911889:174539..175005TCONS_00073442-exon-scaffold_92-1491911889:174539..175005Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1510915933:174539..175005TCONS_00073442-exon-scaffold_92-1510915933:174539..175005Clytia hemisphaericaexon
TCONS_00073442-exon-scaffold_92-1575043694:174539..175005TCONS_00073442-exon-scaffold_92-1575043694:174539..175005Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073442-proteinTCONS_00073442-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:156498..175005 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.25307 4.16906 2.95974 4.70875 5.40309 3.63301 3.65347 5.85347 2.73244 3.75126 6.10441 4.30124 5.87136 4.67617 2.86473 3.23664 3.40558 3.25595 2.53873 1.66468 2.8804 2.16948 4.87357 5.14368 10.2068 9.90963 2.71873 2.38154 3.29537 3.46372
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000812TFIIB
IPR013763Cyclin-like
IPR011665BRF1_TBP-bd_dom
IPR013137Znf_TFIIB
IPR013150TFIIB_cyclin
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0070897DNA-templated transcriptional preinitiation complex assembly
Vocabulary: Molecular Function
TermDefinition
GO:0017025TBP-class protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0070897 DNA-templated transcriptional preinitiation complex assembly
biological_process GO:0006355 regulation of transcription, DNA-templated
molecular_function GO:0017025 TBP-class protein binding
Blast
BLAST of TCONS_00073442 vs. Swiss-Prot (Human)
Match: TF3B (Transcription factor IIIB 90 kDa subunit OS=Homo sapiens GN=BRF1 PE=1 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.877e-94
Identity = 162/303 (53.47%), Postives = 224/303 (73.93%), Query Frame = 3
Query:  756 GVSCKNCGGTEIDHDQARGDXXXXXXXXXXESLCIVNEVEFQENSAGNASVIGQFVSAEGHHSR----AGYKYSLGRDHRQVILDNGKRLINQLGSNLKMTNHCLESAFMFYKMAVSKRFTSGRRTIHVIGACLYLVSRTEKTPHMLLXXXXXXXXXXXTLGRVFLQLARELCIDCPIVDPSLYIHRFAHQLDFGEKENEVSMSALRIMARMKKDWIHFGRRPSALCGAALIIAAKLYNFEVTMKDIVKLVRMSKTTVFKRLMDFSKTATGKLTTDEFKTVDLEEEADPPCYTEGRNRVKFAQ 1652
            G  C+ CGGT+I+ D ARGD+VC  CGSV+E   IV+EV+F E+S G +S +GQFVS +G         G+  +LG++ R   L NG+R I+ LG+ L++  HCL++AF F+KMAVS+  T GR+  HVI ACLYLV RTE TPHMLLD+ D++Q +V  LG+ FL LARELCI+ P +DP LYI RFAH L+FGEK +EVSM+ALR++ RMK+DW+H GRRPS LCGAAL++AA++++F  T+K+++ +V++ ++T+ KRL +F  T T +LT DEF  +DLEEE DPP YT G+ +++  Q
Sbjct:    3 GRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQ 305          
The following BLAST results are available for this feature:
BLAST of TCONS_00073442 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TF3B2.877e-9453.47Transcription factor IIIB 90 kDa subunit OS=Homo s... [more]
back to top