Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073414 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073414
Unique NameTCONS_00073414
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2730

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073414 ID=TCONS_00073414|Name=TCONS_00073414|organism=Clytia hemisphaerica|type=transcript|length=2730bp
AtagaattccaaaaaaaaaacacaaataatTTATAACTGTTTGTCCAAAA
CTAgttcaaaatggtgaaattaacaGCAGATTTAATTGAGATTGCTCCAC
AGTATACCAACCCTTTGAGAGATCGTGAAATTGATTTACGTGGGAACAAA
ATATCTGTCATTGAAAATCTTGGCGCAACTCTTGATCAATTTGATTGCAT
AGATATATCAGACAATGATGTCAAGAAGTTGGAGTCTTTTCCACTCTTAA
AACGTCTCAAAATGCTCATCTGTAACAATAATAGAATCTGTCGTTTTGAA
GAGAACTTGGAGGAATCATTACCAGCTCTGGAAGATTTGGTGTTGTCAAA
TAACAATGTGCAAGAATTGatcgATTTAGACCCATTGTCAACGATAAAAA
GTTTACGTTCAGTATGCTTCCTTCGGAATCCAGTTGCAAATAAACAAAAC
TACCGGCTATATTTGATCTTCAAAATCCCTCAACTTCGCGTTGTCGACTT
CAAAAGAATAAAAGATAAAGAGAGGTCGGCAGCTAACAGACTCTTCAAGA
GCAAGAAAGGggagattttacaaaaagatATCGCTGCTAAGCGTAGTAAA
ACATTTGAAGTCAAAGATATCCAACCAACGCAAGAAGACGTTGAATTTCT
GGCCCAAAAATATAAAGACCAAGAAGCTATCAAGGAAGCCATTTCTAAAG
CCACCACACTGGAAGAAGTTCGGAAATTGGAATTACTTTTACAGCAGGGC
CACGTCCCCGGTAAAACAGGTGATGGAGATAACCAAAATGAAGACGAGGA
AGAAATGGAAACAGCATGATTATTATCTTCATAATGCAAATTTTTTCATA
CCTGATGATCTTAGGTCATGATAACCTAACCCTCGAACGTTGCTCCTTGT
ACATTTTCCAgaactgtcttttttgaaattaaaatctcCTTCAAAAGGGg
cattttttatgcaaaatgtcgTGTTCATTCTGTGCAGGAGGCTTTTATAT
TTNTTGAAATTAAAATCTCCTTCAAAAGGGgcattttttatgcaaaatgt
cgTGTTCATTCTGTTCAGGAGGCTTTTATATTTCTATAAACTTTAATTAA
TAGATTTATAACATTAAAGCTTTTTACCTGTGTCTTTCGGAGAAAACTGA
TAGATCAGATGCTCTTTCTTGGCACTCACGCCTATGGCAacatttttatc
gttttttaacAATAGGAATAAAATACAGCCTTTTTACAGAGCattgtttc
ttttttctccCTGCAGATAGACAGTCAACACAATTAGTATTTCCATTCAG
GAAGGCTTAGACTTCGGGATTTCTTTTGCCGAAGGTCAATGTTATTATGA
TTATAATTACCTCATTAATATTAATACTGgttgtttttgtatttgagAAT
TTAATTACTCGTATAGCCTTTGTGTAAGATATATACATAATATTAGAGTT
CTAGTGTTGCTTCATATTTTGAACTCTTTTCTGTCACTATACTCatctat
tttactttttttcgtttaagTGAACCTAGAAAAAACAACaagtaataaga
aaaaaagaagtcttAAATAGATATCCTAAGAATGAAGGAATTCGACACCA
CCAAATACCGAATGATTGAAACGATCACAGCGAGCGCAAAACACCGACCT
CCGCTACATAGCGATCCGAAAATATTTGAACCTTTAATTCTACCCAAACA
CGACCGTAAAATTGGTATCGGAGTTCAAGTTTTTACGGGACTTTTCGCCA
TTTACGGTGTTCTTTTCATGGACTTTGGTAACAGAGAACATTGCTTTTCG
GCAATCCGACGAGCCTTTTTCGGCAAATTGAATTCGTGGATGACGATACG
ACCTGAAGATGAACCTTACATTGCGAGACGGGTGGAAGAGATGAAACTTA
GAGTTAAACAAGTTGATGAAACCAAAGCAATTTATGGTGGAAATAATTGA
ATGNAGAGTTAAACAAGTTGATGAAACCAAAGCAATCTATGGTGGAAATA
ATTGAATGCAGTCTCCAAATATAGTTGGGGTAAATAAAGACTTTCGAGTG
TCGTATATGCCTAGAAAAATTTAGTATAATTTGCTCGAAATGTTCTCTGC
GTGTATGACCTTTGGCAAAAGTTTTTCTTCCTAAATTAAAGGATTGTGAT
CGGCTTACGTGATCAATAAGCTTTCAAACGTACGATTTTGTGCTACAAGA
ATATGGACATCATTGAACCGCTTGCAATCAAGTTGTAAGCAAGTTGAAGA
ATCAATccctaattcatgatatgcaccattgcaatgtcttctgacattac
atcacggatccaatagctgattggttgtaagtgacttaaaatcagtcaat
acgtcactttcaaccaatcagctgttgggtccgtggaggatattgcaatg
gtgcatatcatgaatatgtcTCTGTCATCTTAATCTGTTGAAAGATTGTC
AACTATTTGATATGGATTTGAGGCAAATGAAATGCATTAGTGTTGATTAC
TGTTGGTAGTAACGGAACATGTTGCTCATAAACTTGACATAAAAATAAGA
AAGTTCGGTAAATCTCTGGTCATCTTGGTTTGAATGTTGTGTGTGAGTGT
GATCTAATTATGTACAGAAATGATGATTTTATTGCAATTAAGTATTGTAT
TTAGATGActgaaaacttttatttttatctaaaattttaaatattaaaat
cattctaaatGGAAAAAGATTAGCAGTGAT
Run BLAST on NCBI

protein sequence of TCONS_00073414-protein

>TCONS_00073414-protein ID=TCONS_00073414-protein|Name=TCONS_00073414-protein|organism=Clytia hemisphaerica|type=polypeptide|length=252bp
MVKLTADLIEIAPQYTNPLRDREIDLRGNKISVIENLGATLDQFDCIDIS
DNDVKKLESFPLLKRLKMLICNNNRICRFEENLEESLPALEDLVLSNNNV
QELIDLDPLSTIKSLRSVCFLRNPVANKQNYRLYLIFKIPQLRVVDFKRI
KDKERSAANRLFKSKKGEILQKDIAAKRSKTFEVKDIQPTQEDVEFLAQK
YKDQEAIKEAISKATTLEEVRKLELLLQQGHVPGKTGDGDNQNEDEEEME
TA
Run BLAST on NCBI

transcript from alignment at scaffold_91:397367..403754-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073414 ID=TCONS_00073414|Name=TCONS_00073414|organism=Clytia hemisphaerica|type=transcript|length=6388bp|location=Sequence derived from alignment at scaffold_91:397367..403754- (Clytia hemisphaerica)
ATAGAATTCCAAAAAAAAAACACAAATAATTTATAACTGTTTGTCCAAAA CTAGTTCAAAATGGTGAAATTAACAGCAGATTTAATTGAGATTGCTCCAC AGTATACCAACCCTTTGAGAGATCGTGAAATTGATTTACGTGGGAACAAA ATATCTGTCATTGAAAATCTTGGCGCAACTCTTGTAAGTTTTATCTTATC TTGATGGTTCTTTCAATTGTATTTACTGTAAATATATGAATGATGGCCTA AATTCTGACAGCTCAAAATAATATCAATCAGATAATTTAGCTCCAAGGAC ATAATCAGTTTTTGGTCCACCGTATTAATGACTGGATTACATATCAAATT TCTCGGGTTTTTGCTTTTTAGGCTTTCTCATGCCAAAAATGTTATTAATC TCTCAGTTCCATCTATCTGTTATGATGTATTTAATCTATTTTTCAGGATC AATTTGATTGCATAGATATATCAGACAATGATGTCAAGAAGTTGGAGTCT TTTCCACTCTTAAAACGTCTCAAAATGCTCATCTGTAACAATAATAGAAT CTGGTGAGTGACTGGCTTGAGTTTTGATTTATTTTACTTAGACTTAGATG CGTTATCTCTTATATGAAAAAATGCTTTTGAGGTCTTTTTAAGTTTGTAC TGCTCTAGGTTTGTTTGCTTATTTCTGCAAACTTTAGGGAACGTTTCGAA GATCTTTTATGTAGGCTTCATTCTACCCTTATTGTTGTAATTATTATCGT TTCCTCTCAAGCAAGTTTGAGACTCGACTGATACAATATTCATTTAAAAA ACCACCAACCCTTATGTATTTTTTAAGGTTAGATATATATTGACGGTGGG TAAAGGTAAGAGTTTCAATTTTCCTGAAAACATTCGCGAAAGCGAATACA TCTGGCGTCACCCAAATTTTCCTTAACAAACAATTTAAACGCTGCGCTGG TTATTTTGTCAGAATGTGTTTACATAGATCATGGGTTGAATAAAATGAGT TCTACCAACTGGTTGGAAAGGAATCGGACTGGATATTTTAACACATTTTC CTTGAATTCTGATTCTTTTACAGTATTTAGTGGCATATTTTACACTATGC TTTGGCATGGGTAGTATTCGAGCTTTTGTTTTGAACTATTTCCATCATTT GATTTTTACCATTGATTTTGTTGGTTATGTTAGCTACTGTTTGGGTTCAG TTGTCAAACATTTTCTACTGGAAAGGTGGATTTCAGTTTTCATCACAGAT CTATTTTGCTTCTTAGAGTATAACGTATATTTCCTTGAAATTTGTTTCTT TTCAGGGATATTTTGTTACTTTTAGGTTACCTCACCAAGCAGGAACTCCC ACAGTGAAAACAAAGAAACTATTGAGCCGTCTAAAACAAGTCCTAAGAAG AAACTTGCCTTGATCTCATCTCATGCTGGCATATCTTTTCAAATCTATGT TGCCCTTATCAGTTTTCTTTATTTTTTTTTCTTCTTTCAAACGGCAGTCG TTTTGAAGAGAACTTGGAGGAATCATTACCAGCTCTGGAAGATTTGGTGT TGTCAAATAACAATGTGCAAGAATTGGTATGAATTGATTATTTGGTTACA TCCAGTCAACCCTCCTTAATCTACGAGGGGTTCGGGTTCAAACGGCGTTA AATGTGTGTTTGTCTGTGTGTTTGTTTGCCATGATTTCAGACTTCTTTCC TTGTAAACAGGAGTGCAAACTCCTTTTGGTGCATTTGTTTTTTTTTGCAA CGGATTGATAGTTGTATTTCATTCACCAAACATTTTAGCTGAATTTAATG ATCTCACCTTTGAATGATTTCTGTTTTTCACATAACTTGGCGAAGTTTTT ATCCCAATTGCAGGATTATTTTAGACATCTCTGTTCAAACAATATCGTAA AAATGAAAATTTATTCTGTGTGTTTTATTTCTTGCTAAACAATAATCTTT CAGCTCCTCTCAGTTACATACTTTTTTTGTTTTTAGATCGATTTAGACCC ATTGTCAACGATAAAAAGTTTACGTTCAGTATGGTATGTATTTTCTTTCC TTTCTCTTTCTCCTACTAAAGGTTTTACAAAGCTTTCTCTAATAAAGAAA CATTGATGAGTTTAAAGGTTCATGCAAAATATAGTGTACCCGCCATTAGT CGAACGTTATTTCATCGTTTTCTCAGCTCACAAACCTTTATAACCGACGA ACTCTTCAAAAATTAAGCTTTCCATAACAAAGAAGCTTAGCTTTCCTAAT GATTGCTTTAGTTACCAAGATAGGACTGTAAGGTTGTCTGCTAAACGGAA AGAGTTGTACTGCAATAGAAATTAGTCCCAGAAGACTTTGTGTGTGTGTG GATTTGATGTGATTAACAGAGTTACTACGCATAAGCATACCAGGATAATC ACGACTACGGACGAAAAATGTAATAAGCTAGTGAAAATACGAAATTTGAT TGGTTGAAACTCACTAGCCTGTTAAATTTTCGTTCGTCGTCGTGATTTTA CTGATTTAACTTTACTACTTACAATATTATGTAGTATGAACTATGCTTGA CTTTTATACTTTGAACTTTTTTGTTCTAGCTTCCTTCGGAATCCAGTTGC AAATAAACAAAACTACCGGCTATATTTGATCTTCAAAATCCCTCAACTTC GCGTTGTCGACTTCAAAAGAATAAAAGATAAAGTATGTTCTGTTGCTTTT GTAACTGTGAATTTTTCACTCCAACCAAATGAGAGAAAATTATGGAAAGT ACTGCAAAATATAGTGTATCCGCCATTAGTCGGACGTTATTTCATTGTCT TCCCAGCTCACAAACCATTATAATCGACAAATCTCCAATAATTAAACTTT GATTGGAAAAGAATACTTATTCACGCCGAGTAAACATTACGTTTGCATTC TTTTCAATTTAAGATATTTTAGTACATAACTAAAAAGCTGAACGAAGATC TGAAATCTTTTACACTATTTTACAAACGTCGAATTTTAATTTCTGTCAAA AGGTAGAAAGAATAAGCAAACTGTCTTATTGTGTCTCCCTTTTATTTCCC TCCTTCTTTTATTCATTTTTGTTGATTTTACTGGATATGTCTTTTAAAAT GTTTTCATTCTTTATTTTATGTCCTTTTGTGTTATCATTTTTTCTCGAAA TAGGTATTGACGCTAGCTAGTAAAGTTCAATGACATTGAATTTCTTATAT TTCTGTCTCTAAAGTGATGAATAATGATTTTACCAATATCTTACTTTTTT TCAGGAGAGGTCGGCAGCTAACAGACTCTTCAAGAGCAAGAAAGGGGAGA TTTTACAAAAAGATATCGCTGCTAAGCGTAGTAAAACGTAAGAAACAGTT TGGGTGTTTCCAACAGTCAGTGGAGTCTGTTTTAAGTGGAAACTTTTTTT CATTCAAATGTCTGCTTAATTCGAACAAGTTTTATGGTCCCTTCAGTTAA CAATACCATCTCACTCCATTACTCGAAATTTCCCTAACTCAAACATACAT TTGCTCCCAGTGCGTGTTTGAGTTACGGATACTTCACTGTACCGACAAAA TGAATTACAGTTTATGATTCTTCTTGTGATCATTCTATGAAAGCCTCAGT ACGTTTGCTGAACATACCTCCTCCCCCCTTCGAATATGGCCGCATTAGAA CGTTAGTGAAACATCATTAACTACGAAAGTCATGCCAATCTCTCTATCTC TTAACTTATTTTATCCGTTTTCATCATTATCAGATTTGAAGTCAAAGATA TCCAACCAACGCAAGAAGACGTTGAATTTCTGGCCCAAAAATATAAAGAC CAAGAAGCTATCAAGGTTTTTCATTCTATATTCAATGTTATAATAATTAA AGTACTCTGTAGGGTCCTATCTAGGTGTAAAATGAGGAGAAACCTTTCAA AAAAATTTTAAAGGAATCGGAAACGCTATGAGGCCATCTCTTTGCTGGCT AAATGGAACACCCAATGTACAGCGAGACACTACACGTCTTTTTTTATAAG GAACACGTTTATAAGGAACTTGAGGCTGAGAATAAGAAAACAAGTTAATG AACACCAAGAGTTAAAATTGAACTTCACACGTTTACAAATTCCTAGACAA AAAATGATAAATATTGATAAAATAACGTTCAATTGTTCGTCTTTTGTCAA TTGTTCAACAAATCATCAAATCAGTCCAACCTTACCAGCTAAGTAAATAA GGAACTTGATAAGGAATTTCGAGGCTGGAATTCTCTGGAAAAATATGGAA CTCCAGGCTTGGAGCCAACTTAAGGTTCCTTATAAAAAAAACGTGTAGTC TTTTCGTTGATAATTTTAACATTTTCTTGATTTCTTTCGTAGGAAGCCAT TTCTAAAGCCACCACACTGGAAGAAGTTCGGAAATTGGAATTACTTTTAC AGCAGGGCCACGTCCCCGGTAAAACAGGTGATGGAGATAACCAAAATGAA GACGAGGAAGAAATGGAAACAGCATGATTATTATCTTCATAATGCAAATT TTTTCATACCTGATGATCTTAGGTCATGATAACCTAACCCTCGAACGTTG CTCCTTGTACATTTTCCAGAACTGTCTTTTTTGAAATTAAAATCTCCTTC AAAAGGGGCATTTTTTATGCAAAATGTCGTGTTCATTCTGTGCAGGAGGC TTTTATATTTNTTGAAATTAAAATCTCCTTCAAAAGGGGCATTTTTTATG CAAAATGTCGTGTTCATTCTGTTCAGGAGGCTTTTATATTTCTATAAACT TTAATTAATAGATTTATAACATTAAAGCTTTTTACCTGTGTCTTTCGGAG AAAACTGATAGATCAGATGCTCTTTCTTGGCACTCACGCCTATGGCAACA TTTTTATCGTTTTTTAACAATAGGAATAAAATACAGCCTTTTTACAGAGC ATTGTTTCTTTTTTCTCCCTGCAGATAGACAGTCAACACAATTAGTATTT CCATTCAGGAAGGCTTAGACTTCGGGATTTCTTTTGCCGAAGGTCAATGT TATTATGATTATAATTACCTCATTAATATTAATACTGGTTGTTTTTGTAT TTGAGAATTTAATTACTCGTATAGCCTTTGTGTAAGATATATACATAATA TTAGAGTTCTAGTGTTGCTTCATATTTTGAACTCTTTTCTGTCACTATAC TCATCTATTTTACTTTTTTTCGTTTAAGTGAACCTAGAAAAAACAACAAG TAATAAGAAAAAAAGAAGTCTTAAATAGATATCCTAAGAATGAAGGAATT CGACACCACCAAATACCGAATGATTGAAACGATCACAGCGAGCGCAAAAC ACCGACCTCCGCTACATAGCGATCCGAAAATATTTGAACCTTTAATTCTA CCCAAACACGACCGTAAAATTGGTATCGGAGTTCAAGTTTTTACGGGACT TTTCGCCATTTACGGTGTTCTTTTCATGGACTTTGGTAACAGAGAACATT GCTTTTCGGCAATCCGACGAGCCTTTTTCGGCAAATTGAATTCGTGGATG ACGATACGACCTGAAGATGAACCTTACATTGCGAGACGGGTGGAAGAGAT GAAACTTAGAGTTAAACAAGTTGATGAAACCAAAGCAATTTATGGTGGAA ATAATTGAATGNAGAGTTAAACAAGTTGATGAAACCAAAGCAATCTATGG TGGAAATAATTGAATGCAGTCTCCAAATATAGTTGGGGTAAATAAAGACT TTCGAGTGTCGTATATGCCTAGAAAAATTTAGTATAATTTGCTCGAAATG TTCTCTGCGTGTATGACCTTTGGCAAAAGTTTTTCTTCCTAAATTAAAGG ATTGTGATCGGCTTACGTGATCAATAAGCTTTCAAACGTACGATTTTGTG CTACAAGAATATGGACATCATTGAACCGCTTGCAATCAAGTTGTAAGCAA GTTGAAGAATCAATCCCTAATTCATGATATGCACCATTGCAATGTCTTCT GACATTACATCACGGATCCAATAGCTGATTGGTTGTAAGTGACTTAAAAT CAGTCAATACGTCACTTTCAACCAATCAGCTGTTGGGTCCGTGGAGGATA TTGCAATGGTGCATATCATGAATATGTCTCTGTCATCTTAATCTGTTGAA AGATTGTCAACTATTTGATATGGATTTGAGGCAAATGAAATGCATTAGTG TTGATTACTGTTGGTAGTAACGGAACATGTTGCTCATAAACTTGACATAA AAATAAGAAAGTTCGGTAAATCTCTGGTCATCTTGGTTTGAATGTTGTGT GTGAGTGTGATCTAATTATGTACAGAAATGATGATTTTATTGCAATTAAG TATTGTATTTAGATGACTGAAAACTTTTATTTTTATCTAAAATTTTAAAT ATTAAAATCATTCTAAATGGAAAAAGATTAGCAGTGAT

Coding sequence (CDS) from alignment at scaffold_91:397367..403754-

>TCONS_00073414 ID=TCONS_00073414|Name=TCONS_00073414|organism=Clytia hemisphaerica|type=CDS|length=6072bp|location=Sequence derived from alignment at scaffold_91:397367..403754- (Clytia hemisphaerica)
GAAGCCATTTCTAAAGCCACCACACTGGAAGAAGTTCGGAAATTGGAATT
ACTTTTACAGCAGGGCCACGTCCCCGGTAAAACAGGTGATGGAGATAACC
AAAATGAAGACGAGGAAGAAATGGAAACAGCATGAATTTGAAGTCAAAGA
TATCCAACCAACGCAAGAAGACGTTGAATTTCTGGCCCAAAAATATAAAG
ACCAAGAAGCTATCAAGGAGAGGTCGGCAGCTAACAGACTCTTCAAGAGC
AAGAAAGGGGAGATTTTACAAAAAGATATCGCTGCTAAGCGTAGTAAAAC
CTTCCTTCGGAATCCAGTTGCAAATAAACAAAACTACCGGCTATATTTGA
TCTTCAAAATCCCTCAACTTCGCGTTGTCGACTTCAAAAGAATAAAAGAT
AAAATCGATTTAGACCCATTGTCAACGATAAAAAGTTTACGTTCAGTATG
TCGTTTTGAAGAGAACTTGGAGGAATCATTACCAGCTCTGGAAGATTTGG
TGTTGTCAAATAACAATGTGCAAGAATTGGATCAATTTGATTGCATAGAT
ATATCAGACAATGATGTCAAGAAGTTGGAGTCTTTTCCACTCTTAAAACG
TCTCAAAATGCTCATCTGTAACAATAATAGAATCTGATGGTGAAATTAAC
AGCAGATTTAATTGAGATTGCTCCACAGTATACCAACCCTTTGAGAGATC
GTGAAATTGATTTACGTGGGAACAAAATATCTGTCATTGAAAATCTTGGC
GCAACTCTTGAAGCCATTTCTAAAGCCACCACACTGGAAGAAGTTCGGAA
ATTGGAATTACTTTTACAGCAGGGCCACGTCCCCGGTAAAACAGGTGATG
GAGATAACCAAAATGAAGACGAGGAAGAAATGGAAACAGCATGAATTTGA
AGTCAAAGATATCCAACCAACGCAAGAAGACGTTGAATTTCTGGCCCAAA
AATATAAAGACCAAGAAGCTATCAAGGAGAGGTCGGCAGCTAACAGACTC
TTCAAGAGCAAGAAAGGGGAGATTTTACAAAAAGATATCGCTGCTAAGCG
TAGTAAAACCTTCCTTCGGAATCCAGTTGCAAATAAACAAAACTACCGGC
TATATTTGATCTTCAAAATCCCTCAACTTCGCGTTGTCGACTTCAAAAGA
ATAAAAGATAAAATCGATTTAGACCCATTGTCAACGATAAAAAGTTTACG
TTCAGTATGTCGTTTTGAAGAGAACTTGGAGGAATCATTACCAGCTCTGG
AAGATTTGGTGTTGTCAAATAACAATGTGCAAGAATTGGATCAATTTGAT
TGCATAGATATATCAGACAATGATGTCAAGAAGTTGGAGTCTTTTCCACT
CTTAAAACGTCTCAAAATGCTCATCTGTAACAATAATAGAATCTGATGGT
GAAATTAACAGCAGATTTAATTGAGATTGCTCCACAGTATACCAACCCTT
TGAGAGATCGTGAAATTGATTTACGTGGGAACAAAATATCTGTCATTGAA
AATCTTGGCGCAACTCTTGAAGCCATTTCTAAAGCCACCACACTGGAAGA
AGTTCGGAAATTGGAATTACTTTTACAGCAGGGCCACGTCCCCGGTAAAA
CAGGTGATGGAGATAACCAAAATGAAGACGAGGAAGAAATGGAAACAGCA
TGAATTTGAAGTCAAAGATATCCAACCAACGCAAGAAGACGTTGAATTTC
TGGCCCAAAAATATAAAGACCAAGAAGCTATCAAGGAGAGGTCGGCAGCT
AACAGACTCTTCAAGAGCAAGAAAGGGGAGATTTTACAAAAAGATATCGC
TGCTAAGCGTAGTAAAACCTTCCTTCGGAATCCAGTTGCAAATAAACAAA
ACTACCGGCTATATTTGATCTTCAAAATCCCTCAACTTCGCGTTGTCGAC
TTCAAAAGAATAAAAGATAAAATCGATTTAGACCCATTGTCAACGATAAA
AAGTTTACGTTCAGTATGTCGTTTTGAAGAGAACTTGGAGGAATCATTAC
CAGCTCTGGAAGATTTGGTGTTGTCAAATAACAATGTGCAAGAATTGGAT
CAATTTGATTGCATAGATATATCAGACAATGATGTCAAGAAGTTGGAGTC
TTTTCCACTCTTAAAACGTCTCAAAATGCTCATCTGTAACAATAATAGAA
TCTGATGGTGAAATTAACAGCAGATTTAATTGAGATTGCTCCACAGTATA
CCAACCCTTTGAGAGATCGTGAAATTGATTTACGTGGGAACAAAATATCT
GTCATTGAAAATCTTGGCGCAACTCTTGAAGCCATTTCTAAAGCCACCAC
ACTGGAAGAAGTTCGGAAATTGGAATTACTTTTACAGCAGGGCCACGTCC
CCGGTAAAACAGGTGATGGAGATAACCAAAATGAAGACGAGGAAGAAATG
GAAACAGCATGAATTTGAAGTCAAAGATATCCAACCAACGCAAGAAGACG
TTGAATTTCTGGCCCAAAAATATAAAGACCAAGAAGCTATCAAGGAGAGG
TCGGCAGCTAACAGACTCTTCAAGAGCAAGAAAGGGGAGATTTTACAAAA
AGATATCGCTGCTAAGCGTAGTAAAACCTTCCTTCGGAATCCAGTTGCAA
ATAAACAAAACTACCGGCTATATTTGATCTTCAAAATCCCTCAACTTCGC
GTTGTCGACTTCAAAAGAATAAAAGATAAAATCGATTTAGACCCATTGTC
AACGATAAAAAGTTTACGTTCAGTATGTCGTTTTGAAGAGAACTTGGAGG
AATCATTACCAGCTCTGGAAGATTTGGTGTTGTCAAATAACAATGTGCAA
GAATTGGATCAATTTGATTGCATAGATATATCAGACAATGATGTCAAGAA
GTTGGAGTCTTTTCCACTCTTAAAACGTCTCAAAATGCTCATCTGTAACA
ATAATAGAATCTGATGGTGAAATTAACAGCAGATTTAATTGAGATTGCTC
CACAGTATACCAACCCTTTGAGAGATCGTGAAATTGATTTACGTGGGAAC
AAAATATCTGTCATTGAAAATCTTGGCGCAACTCTTGAAGCCATTTCTAA
AGCCACCACACTGGAAGAAGTTCGGAAATTGGAATTACTTTTACAGCAGG
GCCACGTCCCCGGTAAAACAGGTGATGGAGATAACCAAAATGAAGACGAG
GAAGAAATGGAAACAGCATGAATTTGAAGTCAAAGATATCCAACCAACGC
AAGAAGACGTTGAATTTCTGGCCCAAAAATATAAAGACCAAGAAGCTATC
AAGGAGAGGTCGGCAGCTAACAGACTCTTCAAGAGCAAGAAAGGGGAGAT
TTTACAAAAAGATATCGCTGCTAAGCGTAGTAAAACCTTCCTTCGGAATC
CAGTTGCAAATAAACAAAACTACCGGCTATATTTGATCTTCAAAATCCCT
CAACTTCGCGTTGTCGACTTCAAAAGAATAAAAGATAAAATCGATTTAGA
CCCATTGTCAACGATAAAAAGTTTACGTTCAGTATGTCGTTTTGAAGAGA
ACTTGGAGGAATCATTACCAGCTCTGGAAGATTTGGTGTTGTCAAATAAC
AATGTGCAAGAATTGGATCAATTTGATTGCATAGATATATCAGACAATGA
TGTCAAGAAGTTGGAGTCTTTTCCACTCTTAAAACGTCTCAAAATGCTCA
TCTGTAACAATAATAGAATCTGATGGTGAAATTAACAGCAGATTTAATTG
AGATTGCTCCACAGTATACCAACCCTTTGAGAGATCGTGAAATTGATTTA
CGTGGGAACAAAATATCTGTCATTGAAAATCTTGGCGCAACTCTTGAAGC
CATTTCTAAAGCCACCACACTGGAAGAAGTTCGGAAATTGGAATTACTTT
TACAGCAGGGCCACGTCCCCGGTAAAACAGGTGATGGAGATAACCAAAAT
GAAGACGAGGAAGAAATGGAAACAGCATGAATTTGAAGTCAAAGATATCC
AACCAACGCAAGAAGACGTTGAATTTCTGGCCCAAAAATATAAAGACCAA
GAAGCTATCAAGGAGAGGTCGGCAGCTAACAGACTCTTCAAGAGCAAGAA
AGGGGAGATTTTACAAAAAGATATCGCTGCTAAGCGTAGTAAAACCTTCC
TTCGGAATCCAGTTGCAAATAAACAAAACTACCGGCTATATTTGATCTTC
AAAATCCCTCAACTTCGCGTTGTCGACTTCAAAAGAATAAAAGATAAAAT
CGATTTAGACCCATTGTCAACGATAAAAAGTTTACGTTCAGTATGTCGTT
TTGAAGAGAACTTGGAGGAATCATTACCAGCTCTGGAAGATTTGGTGTTG
TCAAATAACAATGTGCAAGAATTGGATCAATTTGATTGCATAGATATATC
AGACAATGATGTCAAGAAGTTGGAGTCTTTTCCACTCTTAAAACGTCTCA
AAATGCTCATCTGTAACAATAATAGAATCTGATGGTGAAATTAACAGCAG
ATTTAATTGAGATTGCTCCACAGTATACCAACCCTTTGAGAGATCGTGAA
ATTGATTTACGTGGGAACAAAATATCTGTCATTGAAAATCTTGGCGCAAC
TCTTGAAGCCATTTCTAAAGCCACCACACTGGAAGAAGTTCGGAAATTGG
AATTACTTTTACAGCAGGGCCACGTCCCCGGTAAAACAGGTGATGGAGAT
AACCAAAATGAAGACGAGGAAGAAATGGAAACAGCATGAATTTGAAGTCA
AAGATATCCAACCAACGCAAGAAGACGTTGAATTTCTGGCCCAAAAATAT
AAAGACCAAGAAGCTATCAAGGAGAGGTCGGCAGCTAACAGACTCTTCAA
GAGCAAGAAAGGGGAGATTTTACAAAAAGATATCGCTGCTAAGCGTAGTA
AAACCTTCCTTCGGAATCCAGTTGCAAATAAACAAAACTACCGGCTATAT
TTGATCTTCAAAATCCCTCAACTTCGCGTTGTCGACTTCAAAAGAATAAA
AGATAAAATCGATTTAGACCCATTGTCAACGATAAAAAGTTTACGTTCAG
TATGTCGTTTTGAAGAGAACTTGGAGGAATCATTACCAGCTCTGGAAGAT
TTGGTGTTGTCAAATAACAATGTGCAAGAATTGGATCAATTTGATTGCAT
AGATATATCAGACAATGATGTCAAGAAGTTGGAGTCTTTTCCACTCTTAA
AACGTCTCAAAATGCTCATCTGTAACAATAATAGAATCTGATGGTGAAAT
TAACAGCAGATTTAATTGAGATTGCTCCACAGTATACCAACCCTTTGAGA
GATCGTGAAATTGATTTACGTGGGAACAAAATATCTGTCATTGAAAATCT
TGGCGCAACTCTTGAAGCCATTTCTAAAGCCACCACACTGGAAGAAGTTC
GGAAATTGGAATTACTTTTACAGCAGGGCCACGTCCCCGGTAAAACAGGT
GATGGAGATAACCAAAATGAAGACGAGGAAGAAATGGAAACAGCATGAAT
TTGAAGTCAAAGATATCCAACCAACGCAAGAAGACGTTGAATTTCTGGCC
CAAAAATATAAAGACCAAGAAGCTATCAAGGAGAGGTCGGCAGCTAACAG
ACTCTTCAAGAGCAAGAAAGGGGAGATTTTACAAAAAGATATCGCTGCTA
AGCGTAGTAAAACCTTCCTTCGGAATCCAGTTGCAAATAAACAAAACTAC
CGGCTATATTTGATCTTCAAAATCCCTCAACTTCGCGTTGTCGACTTCAA
AAGAATAAAAGATAAAATCGATTTAGACCCATTGTCAACGATAAAAAGTT
TACGTTCAGTATGTCGTTTTGAAGAGAACTTGGAGGAATCATTACCAGCT
CTGGAAGATTTGGTGTTGTCAAATAACAATGTGCAAGAATTGGATCAATT
TGATTGCATAGATATATCAGACAATGATGTCAAGAAGTTGGAGTCTTTTC
CACTCTTAAAACGTCTCAAAATGCTCATCTGTAACAATAATAGAATCTGA
TGGTGAAATTAACAGCAGATTTAATTGAGATTGCTCCACAGTATACCAAC
CCTTTGAGAGATCGTGAAATTGATTTACGTGGGAACAAAATATCTGTCAT
TGAAAATCTTGGCGCAACTCTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045559XLOC_045559Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073414-exon-scaffold_91-1575043694:403572..403754TCONS_00073414-exon-scaffold_91-1575043694:403572..403754Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1575043694:403202..403308TCONS_00073414-exon-scaffold_91-1575043694:403202..403308Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1575043694:402179..402257TCONS_00073414-exon-scaffold_91-1575043694:402179..402257Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1575043694:401722..401768TCONS_00073414-exon-scaffold_91-1575043694:401722..401768Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1575043694:401073..401175TCONS_00073414-exon-scaffold_91-1575043694:401073..401175Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1575043694:400418..400500TCONS_00073414-exon-scaffold_91-1575043694:400418..400500Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1575043694:399940..400021TCONS_00073414-exon-scaffold_91-1575043694:399940..400021Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1575043694:397367..399412TCONS_00073414-exon-scaffold_91-1575043694:397367..399412Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1510915933:403572..403754TCONS_00073414-exon-scaffold_91-1510915933:403572..403754Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1510915933:403202..403308TCONS_00073414-exon-scaffold_91-1510915933:403202..403308Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1510915933:402179..402257TCONS_00073414-exon-scaffold_91-1510915933:402179..402257Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1510915933:401722..401768TCONS_00073414-exon-scaffold_91-1510915933:401722..401768Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1510915933:401073..401175TCONS_00073414-exon-scaffold_91-1510915933:401073..401175Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1510915933:400418..400500TCONS_00073414-exon-scaffold_91-1510915933:400418..400500Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1510915933:399940..400021TCONS_00073414-exon-scaffold_91-1510915933:399940..400021Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1510915933:397367..399412TCONS_00073414-exon-scaffold_91-1510915933:397367..399412Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1491911889:403572..403754TCONS_00073414-exon-scaffold_91-1491911889:403572..403754Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1491911889:403202..403308TCONS_00073414-exon-scaffold_91-1491911889:403202..403308Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1491911889:402179..402257TCONS_00073414-exon-scaffold_91-1491911889:402179..402257Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1491911889:401722..401768TCONS_00073414-exon-scaffold_91-1491911889:401722..401768Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1491911889:401073..401175TCONS_00073414-exon-scaffold_91-1491911889:401073..401175Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1491911889:400418..400500TCONS_00073414-exon-scaffold_91-1491911889:400418..400500Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1491911889:399940..400021TCONS_00073414-exon-scaffold_91-1491911889:399940..400021Clytia hemisphaericaexon
TCONS_00073414-exon-scaffold_91-1491911889:397367..399412TCONS_00073414-exon-scaffold_91-1491911889:397367..399412Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073414-proteinTCONS_00073414-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_91supercontigscaffold_91:397367..403754 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
54.5457 54.1595 96.8584 102.28 57.6893 44.8535 35.4961 36.91 28.1536 26.902 24.3043 23.5988 18.447 21.8718 24.7179 26.5587 24.7285 30.349 14.5033 15.9598 27.6209 27.1661 44.0718 39.0496 31.3771 35.8681 21.5765 23.4511 22.6577 23.7951
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR032675L_dom-like
IPR001611Leu-rich_rpt
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00073414 vs. Swiss-Prot (Human)
Match: RU2A (U2 small nuclear ribonucleoprotein A' OS=Homo sapiens GN=SNRPA1 PE=1 SV=2)

HSP 1 Score: 273.478 bits (698), Expect = 3.979e-84
Identity = 138/235 (58.72%), Postives = 180/235 (76.60%), Query Frame = 1
Query:   61 MVKLTADLIEIAPQYTNPLRDREIDLRGNKISVIENLGATLDQFDCIDISDNDVKKLESFPLLKRLKMLICNNNRICRFEENLEESLPALEDLVLSNNNVQELIDLDPLSTIKSLRSVCFLRNPVANKQNYRLYLIFKIPQLRVVDFKRIKDKERSAANRLFKSKKGEILQKDIAAKRSKTFEVKDIQPTQEDVEFLAQKYKDQEAIKEAISKATTLEEVRKLELLLQQGHVPGK 765
            MVKLTA+LIE A QYTN +RDRE+DLRG KI VIENLGATLDQFD ID SDN+++KL+ FPLL+RLK L+ NNNRICR  E L+++LP L +L+L+NN++ EL DLDPL+++KSL  +  LRNPV NK++YRLY+I+K+PQ+RV+DF+++K KER  A ++FK K+G  L KDI A+RSKTF      PT  D +       D EAIK AI+ A+TL EV +L+ LLQ G +PG+
Sbjct:    1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDI-ARRSKTFNPGAGLPT--DKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGR 232          
The following BLAST results are available for this feature:
BLAST of TCONS_00073414 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RU2A3.979e-8458.72U2 small nuclear ribonucleoprotein A' OS=Homo sapi... [more]
back to top