Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073363 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073363
Unique NameTCONS_00073363
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1421

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073363 ID=TCONS_00073363|Name=TCONS_00073363|organism=Clytia hemisphaerica|type=transcript|length=1421bp
GTTAGTTCTTGCGCGTGCGATGTTTCCATTTATATTGTATTATATTATTG
TCGTATACTATTTAAACGATTCTGGTGGCATCATTCCTTAATCATTTTCA
TTCCAAACGTCGAAATGGAATCACCTACAAGATCAATCACGCCCTCTTGT
ACGCCACCGCCATCTCTAGCGACGTTGAAGCGCCCTGACAGTTGTTACTC
AAGTGGTGGCGAGACGCCACCTTCAACTGATAGACATTGCAGTCCAACTT
TCTTCACAACAGATGACCAAGACGTCACTTTGGTTTGTGAAAATCTGATA
AATGCTGCTAAATTTGATCGCCTTGAACGTTTCATATGGGCTGTTCCAGC
TACTGAGAAATCCCGTAATGCGGAAATTATATTGATCGCTAAAAGTTATT
TAGCGTTTCGTAGTGGACAGTTCGAATTGCTGTACGAGCTTCTACAAAGA
CGACCTTTCGCCAAAAAGTATCACCGGCAACTGCAATATCTATGGCGGAC
CGCCCGCTACATTGAAGCCGAACGTGCACGAGGACGCGCGCTCGGTAGCG
TGGGAAAGTATCGGATTCGCAGGAAATTCCCGTTACCTTACACCATCTGG
GACGGAGAATGCATGTCTTATTGTTTCCGTGAAGAAGCTCGTGAAATTTT
GAACGCCATGTATAAAAGAACGCCTTATCCGACCGCCCAAGAGAAATATA
GCATCGCTCAACGTGCTAACCTGAGTGTAATGCAAGTCAGCAACTGGTTC
AAGAATAAACGACAGCGTGCTCGAGCAAAGAAAGCTGAAGCTAAAGACAG
taCCGAAACCAGCATCAATGAAGATGCCAGTATCACCAGAACCAAATTAG
ATGacaattatcatcatcatcctcaCACTATCAAAATGGAAGATAACCTT
CCTTCTCCTACGATCCCCAAAAGATGTTCTTCTCCACAACAACTTTTAAA
ACCGATGATAAAAATGGAGTATCAGAAACCAACATCATCGTTCAAACCTA
TTCCTCATTTACCAGCAATGACGCAGGACCTGCTTCACCATTCAAAATCA
CCAAAGCGAAGACTATTCATGACTCCGACACCGTATCATCCATATCTAGC
CTCACTTCATCATCTCCCACGTACAGAATACAGGCTAATGCCACCAGCAT
TGACGTCATCATATTATAAACTTAGTCGTGGTCACATCCAACCTTACGTT
GTTGTGCCAAGAAAACGAATTTTAGTCGATAGACCTCGTTTGGTACCAGA
CTTCTATAGAACACCTCTGGATTATCGGCATCATGCGATTTCTGATCGAC
ATTGTGAACAATGCAACAAAGACCTACATTAAATTATGATGGATTTTTGA
AAGCATGTCGTTTAAAACGATCCTTGtcatatttattaaaatataattta
tttCCATTTTTAGGACTTTAG
Run BLAST on NCBI

protein sequence of TCONS_00073363-protein

>TCONS_00073363-protein ID=TCONS_00073363-protein|Name=TCONS_00073363-protein|organism=Clytia hemisphaerica|type=polypeptide|length=443bp
VSSCACDVSIYIVLYYCRILFKRFWWHHSLIIFIPNVEMESPTRSITPSC
TPPPSLATLKRPDSCYSSGGETPPSTDRHCSPTFFTTDDQDVTLVCENLI
NAAKFDRLERFIWAVPATEKSRNAEIILIAKSYLAFRSGQFELLYELLQR
RPFAKKYHRQLQYLWRTARYIEAERARGRALGSVGKYRIRRKFPLPYTIW
DGECMSYCFREEAREILNAMYKRTPYPTAQEKYSIAQRANLSVMQVSNWF
KNKRQRARAKKAEAKDSTETSINEDASITRTKLDDNYHHHPHTIKMEDNL
PSPTIPKRCSSPQQLLKPMIKMEYQKPTSSFKPIPHLPAMTQDLLHHSKS
PKRRLFMTPTPYHPYLASLHHLPRTEYRLMPPALTSSYYKLSRGHIQPYV
VVPRKRILVDRPRLVPDFYRTPLDYRHHAISDRHCEQCNKDLH
Run BLAST on NCBI

transcript from alignment at scaffold_90:214411..216082-

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073363 ID=TCONS_00073363|Name=TCONS_00073363|organism=Clytia hemisphaerica|type=transcript|length=1672bp|location=Sequence derived from alignment at scaffold_90:214411..216082- (Clytia hemisphaerica)
GTTAGTTCTTGCGCGTGCGATGTTTCCATTTATATTGTATTATATTATTG TCGTATACTATTTAAACGATTCTGGTGGCATCATTCCTTAATCATTTTCA TTCCAAACGTCGAAATGGAATCACCTACAAGATCAATCACGCCCTCTTGT ACGCCACCGCCATCTCTAGCGACGTTGAAGCGCCCTGACAGTTGTTACTC AAGTGGTGGCGAGACGCCACCTTCAACTGATAGACATTGCAGTCCAACTT TCTTCACAACAGATGACCAAGACGTCACTTTGGTTTGTGAAAATCTGATA AATGCTGCTAAATTTGATCGCCTTGAACGTTTCATATGGGCTGTTCCAGC TACTGAGAAATCCCGTAATGCGGAAATTATATTGATCGCTAAAAGTTATT TAGCGTTTCGTAGTGGACAGTTCGAATTGCTGTACGAGCTTCTACAAAGA CGACCTTTCGCCAAAAAGTATCACCGGCAACTGCAATATCTATGGCGGAC CGCCCGCTACATTGAAGCCGAACGTGCACGAGGACGCGCGCTCGGTAGCG TGGGAAAGTATCGGATTCGCAGGAAATTCCCGTTACCTTACACCATCTGG GACGGAGAATGCATGTCTTATTGTTTCCGTGAAGAAGCTCGTGAAATTTT GAACGCCATGTATAAAAGAACGCCTTATCCGACCGCCCAAGAGAAATATA GCATCGCTCAACGTGCTAACCTGAGTGTAATGCAAGTCAGCAACTGGTTC AAGAATAAACGACAGCGTGCTCGAGCAAAGAAAGCTGAAGCTAAAGACAG GTAATTGACGGATATATTCTGACTTTGATACTTTTAAAATCTTTGCGTTA AGGTGGTCGAACATTTCTGATTAATTTTTATTTCACAGAACTGCCTTCCC TATGTCTTGGTAACTATTTTAAAAAACTTTTTGTATCAAAAATTATAATN TAATTTTTATTTCACAGAACTGCCTTCCCTATGTCTTGGTAACTATTTTA AAAAACTTTTTGTATCCAAAATTATAATCTGTGTATTTTTATTATATTTA GTACCGAAACCAGCATCAATGAAGATGCCAGTATCACCAGAACCAAATTA GATGACAATTATCATCATCATCCTCACACTATCAAAATGGAAGATAACCT TCCTTCTCCTACGATCCCCAAAAGATGTTCTTCTCCACAACAACTTTTAA AACCGATGATAAAAATGGAGTATCAGAAACCAACATCATCGTTCAAACCT ATTCCTCATTTACCAGCAATGACGCAGGACCTGCTTCACCATTCAAAATC ACCAAAGCGAAGACTATTCATGACTCCGACACCGTATCATCCATATCTAG CCTCACTTCATCATCTCCCACGTACAGAATACAGGCTAATGCCACCAGCA TTGACGTCATCATATTATAAACTTAGTCGTGGTCACATCCAACCTTACGT TGTTGTGCCAAGAAAACGAATTTTAGTCGATAGACCTCGTTTGGTACCAG ACTTCTATAGAACACCTCTGGATTATCGGCATCATGCGATTTCTGATCGA CATTGTGAACAATGCAACAAAGACCTACATTAAATTATGATGGATTTTTG AAAGCATGTCGTTTAAAACGATCCTTGTCATATTTATTAAAATATAATTT ATTTCCATTTTTAGGACTTTAG

Coding sequence (CDS) from alignment at scaffold_90:214411..216082-

>TCONS_00073363 ID=TCONS_00073363|Name=TCONS_00073363|organism=Clytia hemisphaerica|type=CDS|length=2664bp|location=Sequence derived from alignment at scaffold_90:214411..216082- (Clytia hemisphaerica)
TACCGAAACCAGCATCAATGAAGATGCCAGTATCACCAGAACCAAATTAG
ATGACAATTATCATCATCATCCTCACACTATCAAAATGGAAGATAACCTT
CCTTCTCCTACGATCCCCAAAAGATGTTCTTCTCCACAACAACTTTTAAA
ACCGATGATAAAAATGGAGTATCAGAAACCAACATCATCGTTCAAACCTA
TTCCTCATTTACCAGCAATGACGCAGGACCTGCTTCACCATTCAAAATCA
CCAAAGCGAAGACTATTCATGACTCCGACACCGTATCATCCATATCTAGC
CTCACTTCATCATCTCCCACGTACAGAATACAGGCTAATGCCACCAGCAT
TGACGTCATCATATTATAAACTTAGTCGTGGTCACATCCAACCTTACGTT
GTTGTGCCAAGAAAACGAATTTTAGTCGATAGACCTCGTTTGGTACCAGA
CTTCTATAGAACACCTCTGGATTATCGGCATCATGCGATTTCTGATCGAC
ATTGTGAACAATGCAACAAAGACCTACATTAAGTTAGTTCTTGCGCGTGC
GATGTTTCCATTTATATTGTATTATATTATTGTCGTATACTATTTAAACG
ATTCTGGTGGCATCATTCCTTAATCATTTTCATTCCAAACGTCGAAATGG
AATCACCTACAAGATCAATCACGCCCTCTTGTACGCCACCGCCATCTCTA
GCGACGTTGAAGCGCCCTGACAGTTGTTACTCAAGTGGTGGCGAGACGCC
ACCTTCAACTGATAGACATTGCAGTCCAACTTTCTTCACAACAGATGACC
AAGACGTCACTTTGGTTTGTGAAAATCTGATAAATGCTGCTAAATTTGAT
CGCCTTGAACGTTTCATATGGGCTGTTCCAGCTACTGAGAAATCCCGTAA
TGCGGAAATTATATTGATCGCTAAAAGTTATTTAGCGTTTCGTAGTGGAC
AGTTCGAATTGCTGTACGAGCTTCTACAAAGACGACCTTTCGCCAAAAAG
TATCACCGGCAACTGCAATATCTATGGCGGACCGCCCGCTACATTGAAGC
CGAACGTGCACGAGGACGCGCGCTCGGTAGCGTGGGAAAGTATCGGATTC
GCAGGAAATTCCCGTTACCTTACACCATCTGGGACGGAGAATGCATGTCT
TATTGTTTCCGTGAAGAAGCTCGTGAAATTTTGAACGCCATGTATAAAAG
AACGCCTTATCCGACCGCCCAAGAGAAATATAGCATCGCTCAACGTGCTA
ACCTGAGTGTAATGCAAGTCAGCAACTGGTTCAAGAATAAACGACAGCGT
GCTCGAGCAAAGAAAGCTGAAGCTAAAGACAGTACCGAAACCAGCATCAA
TGAAGATGCCAGTATCACCAGAACCAAATTAGATGACAATTATCATCATC
ATCCTCACACTATCAAAATGGAAGATAACCTTCCTTCTCCTACGATCCCC
AAAAGATGTTCTTCTCCACAACAACTTTTAAAACCGATGATAAAAATGGA
GTATCAGAAACCAACATCATCGTTCAAACCTATTCCTCATTTACCAGCAA
TGACGCAGGACCTGCTTCACCATTCAAAATCACCAAAGCGAAGACTATTC
ATGACTCCGACACCGTATCATCCATATCTAGCCTCACTTCATCATCTCCC
ACGTACAGAATACAGGCTAATGCCACCAGCATTGACGTCATCATATTATA
AACTTAGTCGTGGTCACATCCAACCTTACGTTGTTGTGCCAAGAAAACGA
ATTTTAGTCGATAGACCTCGTTTGGTACCAGACTTCTATAGAACACCTCT
GGATTATCGGCATCATGCGATTTCTGATCGACATTGTGAACAATGCAACA
AAGACCTACATTAAGTTAGTTCTTGCGCGTGCGATGTTTCCATTTATATT
GTATTATATTATTGTCGTATACTATTTAAACGATTCTGGTGGCATCATTC
CTTAATCATTTTCATTCCAAACGTCGAAATGGAATCACCTACAAGATCAA
TCACGCCCTCTTGTACGCCACCGCCATCTCTAGCGACGTTGAAGCGCCCT
GACAGTTGTTACTCAAGTGGTGGCGAGACGCCACCTTCAACTGATAGACA
TTGCAGTCCAACTTTCTTCACAACAGATGACCAAGACGTCACTTTGGTTT
GTGAAAATCTGATAAATGCTGCTAAATTTGATCGCCTTGAACGTTTCATA
TGGGCTGTTCCAGCTACTGAGAAATCCCGTAATGCGGAAATTATATTGAT
CGCTAAAAGTTATTTAGCGTTTCGTAGTGGACAGTTCGAATTGCTGTACG
AGCTTCTACAAAGACGACCTTTCGCCAAAAAGTATCACCGGCAACTGCAA
TATCTATGGCGGACCGCCCGCTACATTGAAGCCGAACGTGCACGAGGACG
CGCGCTCGGTAGCGTGGGAAAGTATCGGATTCGCAGGAAATTCCCGTTAC
CTTACACCATCTGGGACGGAGAATGCATGTCTTATTGTTTCCGTGAAGAA
GCTCGTGAAATTTTGAACGCCATGTATAAAAGAACGCCTTATCCGACCGC
CCAAGAGAAATATAGCATCGCTCAACGTGCTAACCTGAGTGTAATGCAAG
TCAGCAACTGGTTCAAGAATAAACGACAGCGTGCTCGAGCAAAGAAAGCT
GAAGCTAAAGACAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045518XLOC_045518Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073363-proteinTCONS_00073363-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073363-exon-scaffold_90-1575043694:215283..216082TCONS_00073363-exon-scaffold_90-1575043694:215283..216082Clytia hemisphaericaexon
TCONS_00073363-exon-scaffold_90-1575043694:214411..215031TCONS_00073363-exon-scaffold_90-1575043694:214411..215031Clytia hemisphaericaexon
TCONS_00073363-exon-scaffold_90-1510915933:215283..216082TCONS_00073363-exon-scaffold_90-1510915933:215283..216082Clytia hemisphaericaexon
TCONS_00073363-exon-scaffold_90-1510915933:214411..215031TCONS_00073363-exon-scaffold_90-1510915933:214411..215031Clytia hemisphaericaexon
TCONS_00073363-exon-scaffold_90-1491911889:215283..216082TCONS_00073363-exon-scaffold_90-1491911889:215283..216082Clytia hemisphaericaexon
TCONS_00073363-exon-scaffold_90-1491911889:214411..215031TCONS_00073363-exon-scaffold_90-1491911889:214411..215031Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:214411..216082 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0878162 0.313994 0.662867 0.713363 0.750025 0.155968 0.338705 0.317091 0.222003 0.244433 0.266909 0.701821 3.5821 3.03265 0.0997299 0.0891879 3.80158 4.05415 6.81459 6.12157 4.35849 7.66159 2.68502 2.13594 5.05993 8.4988 0.160551 0 0.162449 0.0662037
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR031701SIX1_SD
IPR017970Homeobox_CS
IPR009057Homeobox-like
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
molecular_function GO:0003677 DNA binding
molecular_function GO:0043565 sequence-specific DNA binding
Blast
BLAST of TCONS_00073363 vs. Swiss-Prot (Human)
Match: SIX2 (Homeobox protein SIX2 OS=Homo sapiens GN=SIX2 PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 8.353e-53
Identity = 86/171 (50.29%), Postives = 112/171 (65.50%), Query Frame = 1
Query:  244 PTFFTTDDQDVTLVCENLINAAKFDRLERFIWAVPATEKSRNAEIILIAKSYLAFRSGQFELLYELLQRRPFAKKYHRQLQYLWRTARYIEAERARGRALGSVGKYRIRRKFPLPYTIWDGECMSYCFREEAREILNAMYKRTPYPTAQEKYSIAQRANLSVMQVSNWFKN 756
            PTF  T +Q V  VCE L      +RL RF+W++PA E     E +L AK+ +AF  G F  LY++L+   F+   H +LQ LW  A YIEAE+ RGR LG+VGKYR+RRKFPLP +IWDGE  SYCF+E++R +L   Y   PYP+ +EK  +A+   L+  QVSNWFKN
Sbjct:    5 PTFGFTQEQ-VACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKN 174          
The following BLAST results are available for this feature:
BLAST of TCONS_00073363 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SIX28.353e-5350.29Homeobox protein SIX2 OS=Homo sapiens GN=SIX2 PE=1... [more]
back to top