Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073318 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073318
Unique NameTCONS_00073318
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1013

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073318 ID=TCONS_00073318|Name=TCONS_00073318|organism=Clytia hemisphaerica|type=transcript|length=1013bp
ACCTCAACGCACTTACAGTTTTTGCGAATAAGattcaataattgaaaaat
gagTGGAGGTCTTGCCCCCAGCAAAAGTACAGTTTATGTTGGTAATCTAC
CTTTCTCCCTTACTAATAATGATTTACAcaaggtttttgaaaaattcgga
CGGATAGCTAAAGTTACAATCTTAAGAGATAAAGTAACACGAACCAGTAA
AGGCGTTGCTTTCGTTCAATTCATCGAGAGAGATTCTGCTATCACATGTT
GTAAATCAGTTAatgaaaaaacgttgtttgaacgGAAAATAAAATGTGTC
ATTGCAAAAGACAATGGGAGAGCTTCAGAGTTCATTCGAAAAAAGGATTA
TCCAGATAAATCTAGTTGTTATGAATGTGGAGAGACTGGACATCTTAGCT
ATGCTTGCCCAAAAAATTTACTTGGGAGCCGAGAGCCACCacctaaaaaa
gagaaaaaaactaagaaaGAGAAAGCAGAGGAGAAAGAACATTCAAAGAA
tttaatcaagagttattaTGATGCTGATGAGGCAAATGATGGTGTTAATG
AAGAAGAACAAGGGGAAGACCCTTATGAATCAAGTCTCAGTTATGCAATT
GCTCTTGATTCTAGTCaacaaaaaagacatttttcCTCTATAGTTGTCCA
ACCTTCAACATCAAGGACTTCAACAGATTACGATGGTTACAAGGATAATA
ATGATAGGGAAGAAGAGAGTTatgtcaaaagaaaaaagtataaacCGTCA
TCATATTTCAGTGACGAGGAGGAAGAAGATGAATCTTAGGATAACAATTT
GTGAACTTCTTCTTTGTTCATTTAGtatcactaaatttgcaataaaaata
tttggctgATTTATAAATTATTATGTAAGCCAAATGccttttttaaatca
atgacatcttagaataaaaataaaatgcttCTGATTATTCGAACAATATG
AAGGAATGGTTTGATAAgaacactttttaaatttagcaACTTGATTTCTG
TGCTTCTAAaaac
Run BLAST on NCBI

protein sequence of TCONS_00073318-protein

>TCONS_00073318-protein ID=TCONS_00073318-protein|Name=TCONS_00073318-protein|organism=Clytia hemisphaerica|type=polypeptide|length=246bp
MSGGLAPSKSTVYVGNLPFSLTNNDLHKVFEKFGRIAKVTILRDKVTRTS
KGVAFVQFIERDSAITCCKSVNEKTLFERKIKCVIAKDNGRASEFIRKKD
YPDKSSCYECGETGHLSYACPKNLLGSREPPPKKEKKTKKEKAEEKEHSK
NLIKSYYDADEANDGVNEEEQGEDPYESSLSYAIALDSSQQKRHFSSIVV
QPSTSRTSTDYDGYKDNNDREEESYVKRKKYKPSSYFSDEEEEDES
Run BLAST on NCBI

transcript from alignment at scaffold_9:192786..194434-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073318 ID=TCONS_00073318|Name=TCONS_00073318|organism=Clytia hemisphaerica|type=transcript|length=1649bp|location=Sequence derived from alignment at scaffold_9:192786..194434- (Clytia hemisphaerica)
ACCTCAACGCACTTACAGTTTTTGCGAATAAGGTAGTTACTTTGTATTTA AAAAATATGTATGCTCCCCTAAAATGTATGTAAGATATTTGCCAGCTGGA AATATTTTCAATTTTTAAACAAAGGATAGCCTTATTTACTGCAACTTTTA CCACAGTATTGCTGGGTGCTGTGGCCAATTGCCAGGACTGCAAACATCAG AATTCCACAGAACAGATCTGAATTTCAAGGTAGGTAGATTTTGCCTAAGA ATAGATCCACGTTTTCCAGGTATCCAAGCAGATTTTCTTAGAAAAGATCG CTGCTGGTTCAGAACAGATGATTTCAAAGAACCTCTCTGTGGATGCTTTC AAGTACAGAGAGGCTTTTCATGTCCAAGATTTAACTCATTACATTTTTGA ATTTCAGTCCCATTCAGGGTCACTTTTTTCGCAAATTTCGAGTCCCACGT AGGGTCCATTTTTCGAACCTCAGCGGAGCACCCCTGTCGGTCGACAAGGG TAGTCCCCCCCCCCCGGGTCCAATATTTAACTCATTATTTAGCAACAGGT GACAAGAGATTGTGACAAATAAATCTTTACTATTAGCACAACAGCTTTTT TTGTTTTCATTCAAAGGATAACAAAAAACACTATATACCTTTTTTAATTT CTTATTGATATTTTGTAGATTCAATAATTGAAAAATGAGTGGAGGTCTTG CCCCCAGCAAAAGTACAGTTTATGTTGGTAATCTACCTTTCTCCCTTACT AATAATGATTTACACAAGGTTTTTGAAAAATTCGGACGGATAGCTAAAGT TACAATCTTAAGAGATAAAGTAACACGAACCAGTAAAGGCGTTGCTTTCG TTCAATTCATCGAGAGAGATTCTGCTATCACATGTTGTAAATCAGTTAAT GAAAAAACGTTGTTTGAACGGAAAATAAAATGTGTCATTGCAAAAGACAA TGGGAGAGCTTCAGAGTTCATTCGAAAAAAGGATTATCCAGATAAATCTA GTTGTTATGAATGTGGAGAGACTGGACATCTTAGCTATGCTTGCCCAAAA AATTTACTTGGGAGCCGAGAGCCACCACCTAAAAAAGAGAAAAAAACTAA GAAAGAGAAAGCAGAGGAGAAAGAACATTCAAAGAATTTAATCAAGAGTT ATTATGATGCTGATGAGGCAAATGATGGTGTTAATGAAGAAGAACAAGGG GAAGACCCTTATGAATCAAGTCTCAGTTATGCAATTGCTCTTGATTCTAG TCAACAAAAAAGACATTTTTCCTCTATAGTTGTCCAACCTTCAACATCAA GGACTTCAACAGATTACGATGGTTACAAGGATAATAATGATAGGGAAGAA GAGAGTTATGTCAAAAGAAAAAAGTATAAACCGTCATCATATTTCAGTGA CGAGGAGGAAGAAGATGAATCTTAGGATAACAATTTGTGAACTTCTTCTT TGTTCATTTAGTATCACTAAATTTGCAATAAAAATATTTGGCTGATTTAT AAATTATTATGTAAGCCAAATGCCTTTTTTAAATCAATGACATCTTAGAA TAAAAATAAAATGCTTCTGATTATTCGAACAATATGAAGGAATGGTTTGA TAAGAACACTTTTTAAATTTAGCAACTTGATTTCTGTGCTTCTAAAAAC

Coding sequence (CDS) from alignment at scaffold_9:192786..194434-

>TCONS_00073318 ID=TCONS_00073318|Name=TCONS_00073318|organism=Clytia hemisphaerica|type=CDS|length=741bp|location=Sequence derived from alignment at scaffold_9:192786..194434- (Clytia hemisphaerica)
ATGAGTGGAGGTCTTGCCCCCAGCAAAAGTACAGTTTATGTTGGTAATCT
ACCTTTCTCCCTTACTAATAATGATTTACACAAGGTTTTTGAAAAATTCG
GACGGATAGCTAAAGTTACAATCTTAAGAGATAAAGTAACACGAACCAGT
AAAGGCGTTGCTTTCGTTCAATTCATCGAGAGAGATTCTGCTATCACATG
TTGTAAATCAGTTAATGAAAAAACGTTGTTTGAACGGAAAATAAAATGTG
TCATTGCAAAAGACAATGGGAGAGCTTCAGAGTTCATTCGAAAAAAGGAT
TATCCAGATAAATCTAGTTGTTATGAATGTGGAGAGACTGGACATCTTAG
CTATGCTTGCCCAAAAAATTTACTTGGGAGCCGAGAGCCACCACCTAAAA
AAGAGAAAAAAACTAAGAAAGAGAAAGCAGAGGAGAAAGAACATTCAAAG
AATTTAATCAAGAGTTATTATGATGCTGATGAGGCAAATGATGGTGTTAA
TGAAGAAGAACAAGGGGAAGACCCTTATGAATCAAGTCTCAGTTATGCAA
TTGCTCTTGATTCTAGTCAACAAAAAAGACATTTTTCCTCTATAGTTGTC
CAACCTTCAACATCAAGGACTTCAACAGATTACGATGGTTACAAGGATAA
TAATGATAGGGAAGAAGAGAGTTATGTCAAAAGAAAAAAGTATAAACCGT
CATCATATTTCAGTGACGAGGAGGAAGAAGATGAATCTTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045485XLOC_045485Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073318-proteinTCONS_00073318-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073318-exon-scaffold_9-1575043694:194403..194434TCONS_00073318-exon-scaffold_9-1575043694:194403..194434Clytia hemisphaericaexon
TCONS_00073318-exon-scaffold_9-1575043694:192786..193766TCONS_00073318-exon-scaffold_9-1575043694:192786..193766Clytia hemisphaericaexon
TCONS_00073318-exon-scaffold_9-1510915933:194403..194434TCONS_00073318-exon-scaffold_9-1510915933:194403..194434Clytia hemisphaericaexon
TCONS_00073318-exon-scaffold_9-1510915933:192786..193766TCONS_00073318-exon-scaffold_9-1510915933:192786..193766Clytia hemisphaericaexon
TCONS_00073318-exon-scaffold_9-1491911889:194403..194434TCONS_00073318-exon-scaffold_9-1491911889:194403..194434Clytia hemisphaericaexon
TCONS_00073318-exon-scaffold_9-1491911889:192786..193766TCONS_00073318-exon-scaffold_9-1491911889:192786..193766Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:192786..194434 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
40.7481 42.1906 19.1993 11.7293 0.000245292 7.71281e-05 0.000311806 5.80573e-05 6.42209 5.29243 3.78527 3.47713 2.92694 3.26079 5.22483 4.62933 6.05859 6.45346 1.36573 1.59785 5.56265 5.57829 41.1142 35.6775 6.08884e-05 6.81962e-05 4.96979 1.16142 21.3225 23.5845
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001878Znf_CCHC
IPR000504RRM_dom
IPR034219ZCRB1_RRM
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0008270 zinc ion binding
Blast
BLAST of TCONS_00073318 vs. Swiss-Prot (Human)
Match: ZCRB1 (Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Homo sapiens GN=ZCRB1 PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 3.447e-61
Identity = 88/128 (68.75%), Postives = 109/128 (85.16%), Query Frame = 1
Query:   49 MSGGLAPSKSTVYVGNLPFSLTNNDLHKVFEKFGRIAKVTILRDKVTRTSKGVAFVQFIERDSAITCCKSVNEKTLFERKIKCVIAKDNGRASEFIRKKDYPDKSSCYECGETGHLSYACPKNLLGSR 432
            MSGGLAPSKSTVYV NLPFSLTNNDL+++F K+G++ KVTI++DK TR SKGVAF+ F+++DSA  C +++N K LF R IK  IA DNGRA+EFIR+++Y DKS CYECGE+GHLSYACPKN+LG R
Sbjct:    1 MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYACPKNMLGER 128          
The following BLAST results are available for this feature:
BLAST of TCONS_00073318 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ZCRB13.447e-6168.75Zinc finger CCHC-type and RNA-binding motif-contai... [more]
back to top