Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073316 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073316
Unique NameTCONS_00073316
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1122

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073316 ID=TCONS_00073316|Name=TCONS_00073316|organism=Clytia hemisphaerica|type=transcript|length=1122bp
TTCATAGAGTTATGCAAAATGAAAtaacagaaaaaattaatgagaaATGG
AGACACAACAATACAAGGTAACTTTAAAAGATGTCACCTCCTTTCTATcc
aaaaatgatgaaaagatAGAAGAAAGAACAAATTATGCTATCACATTGTT
ACAGTCTCTACCTTGTGCACGGTATGCTGTGCTTGAAAAGATCGGTGAAG
TATTTTTTGATGAGGCACAAAGGTATATAGTGGAGCTTGAAAGACAACAT
TTGGAAGACGgtgGGACATTAATAAGTGAAACAGCAACACTTAATCATGA
TATACAAATAAAGAAGATAAAGCATGTTTTGATCTCATCAATTGAGTCAA
ACTCGAAAGCTTGGGCTCCCCTTATATTTCAGTGGGCAGTGCAAACTTGT
AGCCAGATATGTTCTCAATATGGCACCAGTAGACattTTAGTATTATGCC
TTTGGAAGAGCGGCTCCAAATGTGGTTGGCATGCTCAGCTACAAACAGTC
TTATGGAGATTACAATAACCTGCATGAAGAAATTAATTGACAAGAACGAG
GAAAGTTGTGTGAAATCTTTGCTTGGAGCCACATTAAGCTGTTCACCCTT
CTTTGATTGGGCTTTGGCACATTTAAGCTGTGCATTTCCGTCTATAGTAC
CAAATAGACTTTTATGGCACGCCCTAGATGCGTTCAGTAAACAGTCAAGA
AAAGCAGAGGTCATCAAGGAAACCATATTGAGCATATTTGATTTGATGAT
GCCGAAAATTGAAAACCATATTCAAAATTGTATTCAGGAGATGTTCATGT
CCAGTCTTGTTGAAGTGAAATCAGATGAAGATGAGAAGAGCCACACCCTA
TTATGTATCATCCCCTTTTTGTTGCACCTTGGAGTGGCCAAAATCGAACT
CTTCACTCCTATCGTTGGTACAATTTTGGATCAAAGTAAGTTTTATTGTG
TTTACCGACAATTTACAACAGTAGGTGTCTGGACTGTCCTGGTTCATATT
TTAATTAGGTTTGTTGATAACATCAATCAACAAATGTGATCTAGTTTAAG
GGCGTTACCCTCCTTGGAATGTCTTTGCCCAATTATTTATTCATGTATGA
AGGGTCTGAGTCTGacggtttt
Run BLAST on NCBI

protein sequence of TCONS_00073316-protein

>TCONS_00073316-protein ID=TCONS_00073316-protein|Name=TCONS_00073316-protein|organism=Clytia hemisphaerica|type=polypeptide|length=330bp
METQQYKVTLKDVTSFLSKNDEKIEERTNYAITLLQSLPCARYAVLEKIG
EVFFDEAQRYIVELERQHLEDGGTLISETATLNHDIQIKKIKHVLISSIE
SNSKAWAPLIFQWAVQTCSQICSQYGTSRHFSIMPLEERLQMWLACSATN
SLMEITITCMKKLIDKNEESCVKSLLGATLSCSPFFDWALAHLSCAFPSI
VPNRLLWHALDAFSKQSRKAEVIKETILSIFDLMMPKIENHIQNCIQEMF
MSSLVEVKSDEDEKSHTLLCIIPFLLHLGVAKIELFTPIVGTILDQSKFY
CVYRQFTTVGVWTVLVHILIRFVDNINQQM
Run BLAST on NCBI

transcript from alignment at scaffold_9:178423..192491-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073316 ID=TCONS_00073316|Name=TCONS_00073316|organism=Clytia hemisphaerica|type=transcript|length=14069bp|location=Sequence derived from alignment at scaffold_9:178423..192491- (Clytia hemisphaerica)
TTCATAGAGTTATGCAAAATGAAATAACAGAAAAAATTAATGAGAAATGG AGACACAACAATACAAGGTAATGATTGCAGCTATGCTGAAATCCTTGTGA AGTCAATTAGAAATCTTTCCTTGACAAGTTAAGGTTATCTTCCTTTTTAA CTTTTGATATAGCTAAACTAAGACTCGAAATTTGGCTCATGTACATTAAA ATCTAATGTTACAATACATTATAATTGTAGGCATTTGCTTAGGCCCAGCT ATTTCTTAGAGTTTAATCAACTCTTTATAAACCTCAAATGCAATCGAGTT TTTCTATAAAGAATAGTTGTATAATATAATGATGATTACAAACTTTTGTT TCAGGTAACTTTAAAAGATGTCACCTCCTTTCTATCCAAAAATGATGAAA AGATAGAAGAAAGAACAAATTATGCTATCACATTGTTACAGTCTCTACCT TGTGCACGGTATGCTGTGCTTGAAAAGATCGGTGAAGTATTTTTTGATGA GGCACAAAGGTATATAGTGGAGCTTGAAAGACAACATTTGGAAGACGGTA TATTCTGTTTCAATATTTTCTTCTTTTTTTTTTAAAGCAAAGCTCTACTA CAGCTATTTATAAGTATAGTTTAAGTTAGAACTTTCTATCCGACATTTTA TGTTCAAAACAGATTCAGTTATGGCCATTTTCTCTGATTTTTATTTTTTT AATTTGATGGTTTTCATTCTTTTAACTTTTTAAATATATCTTTGTTTTTT TTAGGTGGGACATTAATAAGTGAAACAGCAACACTTAATCATGATATACA AATAAAGAAGATAAAGCATGTTTTGATCTCATCAATTGAGTCAAACTCGA AAGCTTGGGCTCCCCTTATATTTCAGGTTTGTTTTGCAGGGAAATACTTT GATATTTATTATCCAAATACAGGAGTTCTTTTTTTCTTTTTTTTTCTTTT CATTATTTTTTTACTGGAATTCAGTATGTTATAATTCCCACTATATTTTT CGATCTTTATGATGAAAGGGATTACACAATGTGATGTTTTGTTTAAGTAC TACACAATCTTTATAAGAAAAAACTATATAAGAACATAAGGCCTCAATGG CCAAAATATTAAGAATAAGTTAGGATTTCATTTTAAGGCTTTGCAGACTG TTGCAGACCCTAAGACACCTATTTACTAAGAAAATAGACAAAATTACTCA CAAAACTGTGAACAGAAGAACACTTTTTAGGCTTAAAATTCAAAAAGTTA AGAGCATCCGAAGGCTTAGAAAATTTTTAATGAATAAAGAAAAACATGTA TACGAATGCTTATTCACTCACTGATGTTTCTCTTTATCTTTAGTGGGCAG TGCAAACTTGTAGCCAGATATGTTCTCAATATGGCACCAGTAGACGTAAG ATGATTCTCCTCATTAATTCAATTTTCACCTTGTTTACAAAATTAGAATA TCCTCTTTCAATTCATCATCTTGATAAAAGACAATAATTATTTAAATTTT TTCTTAATTTGATATTTTCTAACTTTTCTTCGTTCAATTCATATCTTTTG CTGTTAACCTTTGCTCATTCCTTTGATAGCTGAAGATGTTATTAATAAAC TTGGATTTTGAACTATTATGCATTAAATTTGCTTCGGTCACAAAGGTCAT AAAAAGATGTTTTTTTTTCTTCTTTAGATTTTAGTATTATGCCTTTGGAA GAGCGGCTCCAAATGTGGTTGGCATGCTCAGGTATCTTTTGAAGCCACTG CACATTTTTTTATAAGCAACCAAGCTGCTAAGGTTTGAGCCCTCAAATTT GGCAATCTCGTAAAGTAAAAGCTTTTTGGACCTACCCCGGTGGAGGTCCT ATAAATTAACCTCTGTTCGTCCGTTCGTTCGTTCGTTTGTTCGTTCGTTA CCAACTTTTCTCGAGATTGGCTCATTAGTTTTTTCTGATTTTTTGCACAA AGATGTGTAGCTATAAACCGTCGAATGTGACGGAGCCCGATTTTCGAAAA AAAAAAATTTTGGGCAAATTTGGGCCAAAAAACGGCTAAAAAATGGGTAT TTGTGAAAAATTGAATCATTAATTTTTTCTGATTTTTTGCATGAAAGTAG GGTACCATCATAGGTAAAAGATGGCTCAAGCAGATTTTCGCAAAAAAATT TTGTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTGGCTCAAAAAACGCATG TTTATCTATAAGAATCACTATTAATAAGCATACATCAATGTTCTTAGTCA AATTACTCAATTTTTTTTATGAGGTAGATGTATTTTTTGCTCATGAGGAC TTACTTGTAAAGAATATGTGTGTTTAGACAGGAAATTTTGTTTGCTTGGC GTGTTTTTATGGAAAAACTGGCCAAATTTGATATTTCTTTATAAGCACAT TATCAATTACTTAGGTATTAGCTTTTCTCGAGATAGGATTTTTCATTGTT TATGATTTTTTGCACAAAGATGCATAACTATAAACCCTCGAATGTGACGG AGCCCGAATTTCGAAAAAAAATGTTTTTGAGCAAATTTGGGCTAAAAAAC GGCTAAAAAACGGGTTTTTTGGACTTTGTAAAAAATTGCATCATTAATTT TTTCTGATTTTTTGTATGAAAGTAGGGTACTNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNCTATAAGAATCACTATTAATAAGCATACATCAA TGTTCTTAGTCAAATTACTCAATTTTTTATGAGATAGATGTTTTTTTTGC TCATGAGGGCTTACTTTTAAAGAATATGTGTGTTTAGACATAAAATTTTG GTTGCTTGGCGTGATTCTGCGTGATTTTATAGAAAAACTGGCCAAATTCG AAATTTTTTTATAAGCACATTATCAATAACTTAGGTATTAGCTTTTCTCG AGATTGGCTGTTTTATTCTTTATGATTTTTTTGCACAAAGATGCATAACT ATAAATCCTCGAATGTGACGGAGCTCGATTTTTGAGAAAAAATTTTTGGG GTAAATTTCAGCTAAAAAACGGCCAAAAAAAGAGTTTTTTGGACTTTGTG ATTTTTTGCATGAAATTAGGTAAAAGATGGCTCAAGCAGATTTTTGTAAA AAAAGAATTTTTCAGCTCAAAAAACGCATCTTTATCCATAAGAATCACTA TTAATAAGCATAAATTAATGTTCTTAGCCAAATTGGTCAATTTTTTGACG AGATGGATGTTTTTTTGCTCACGAAGTCTTCGATATGAAAGAATATTTCA AGAGCATGAAATTTTAGTTTCTAAATGTTTTTTTTATAAGAAACAAATGA CTAATTTTAATAGATCGTCAATATTTGTGTTCTGAATGATTGTTTAATGG TCACGTCACGTAGATATCAATTATAAATGTGTTAAATGCATAACCACGTA GGTCCATAAAAGTATCACTTGTTAGATATTATGATCATGGCAAACGAAAG CCCTTGATCCAATAAACATGAATATGGTATAATATCAGGGGTGGTCAAAG CAAATTTTTTATAAAATGAGCTAGAATGCAAAGCAACCCCAGCCCTGACC CGAAAATAGGAGAGTTGCTAGTAAAAAAAGATATGTAGATGTGTTATTAA ACCAAGAATTGCTATTACTATTAGTTAACTTAATAAGAGAGGCCTGGAAA AGGCAAAGTCGTGCAGTCTTGTCGTGTACTATTCTTTCCATACTTCTTTA TGGTGAAATAAATGTTTTCATCAATTTTATTATTATTTTATTATTATTTT CTTAAAGTCTCACTCGTTAACAAATTTGGCCTCGTCTAATCGAAAATTCT TATAATCTTCTTTTTAGCTACAAACAGTCTTATGGAGATTACAATAACCT GCATGAAGAAATTGTAAGGAATTACACTTGTACATAGATTTAGGGATTGT TGGTAATTAGAATTGTTAGAGTCACTTTCAAATTTATGGCGTTTTGTTGA TGATCTTTTCACCTAAAAATGTTCAAAATTTTAATTTCAAGAAACATATA ACAAAAAGAATTCTTACCTTTTATAGAATTGACAAGAACGAGGAAAGTTG TGTGAAATCTTTGCTTGGAGCCACATTAAGCTGTTCACCCTTCTTTGATT GGGCTTTGGCACATTTAAGGTAAGTTTGACTATGTGCATGGATTCAAAAA GTTCATATTTGACAGACTTGATGGGATTTTTCGTGACTTGAATTTCTTTA AAGAGGAGTCTGGATACTAGGTTATGTACGTATTAAAACCTTGAAATAAA ACTTTGTGCACAATTTAAACATGTAATAGAAAACAAGTGGACAAGAATTG CGCTATGTTTTAAAAACTATACTCTTATGACCTCTCGTTTTTTAGCTGTG CATTTCCGTCTATAGTACCAAATAGACTTTTATGGCACGCCCTAGATGCG TTCAGTAAACAGTCAAGAAAAGCAGAGGTCATCAAGGAAACCATATTGAG CATATTTGATTTGATGATGCCGAAAATTGAAAACCATATTCAAAATTGTA TTCAGGAGATGTTCATGGTATGTCAAATTTTATAATCCACATTCTATCAA CCTATCTAGCTAGAAAGAAAGATCTAAAATTTATGTATGGCTCTGTGTCT CGTACACAGCGAAGTTTAGGAAAGCATAAGGGCGTTATTTCTTATTGATC TATGGAGCTATAAAATTTATGGTGCAGAATTGACGTTGTGTTTTCTGTCA TGCGTTGAAATTCTGGGGCTTGACGTCACTTTTAAGTCAAAAAGAGAACC TTTTTAAAAATTTAAATGTTTTATAGCACTTTACAGTCTTTCAGGGGACT TAGTTTGGTATTTTTGAAACACCAAACTCTTTTTCTTTCGATTGATATCA AAATTTCCTTAATTATGAGTTATGACTCAGCACTTAGGATGATTCAATGA TTCAAAATTCTTCTTATTTTATGATTAATAAATGGTGTTTGCGTTGTTGT TTACATACCTTCGCCTATCTGGTCAAAACCAACATATGGGAAATTTTTGT AAAGTTTCATCATCTTTGCGGAGATCTTTTTATCTCATACACTGGTCTGA TTCCCAGTAATTATTATCTCTTTCACAACTCCAAAGATTGTTTTTTTCTT ATCCCTGAATCCGAATGTTTTTACTCTTGAGAATTAGATCCTAATCATTT TTTAAGGCTTCTCTTTCGCAAAGGAGCAAATCGGATCTTTTTGCGTGAAT GATAAAGGAATAAAGTATGCACGATGAATAAAGAGGGGATCATAATTGTG AAGCAATCTTCATAAGTTTAACAATAGATCGTAGTTATCAACATAGGCGT TGATTTTGATGTACAGTTGTCGCTTTCTATTTCGACGTTCTATGTTCGAC TCATTAGACGCACGCACGTTAAATGCATGCATTTAGTGTTAAACGCCCGT ACTTAGTGAAAAATTTTTTTTGGTATGTGCGGCTAAGGTTTAAAGGCACC GCAATGTAAACAAGATTAATTCTTTCATTTGTAATATTTGGTTTTTACTT TCGCTTTCGTTTCACTTTTCCCCTAGTTGGTTATTGAGATTTATTAACCC GAGGTGATATTCAAATAACAATAACGAAAAGCTATTGAATAAATGTTTTA TTATATACCTAGAGCCAAAAACAAAACATAAATTATGTAAATAGTCGAAC GATTCACATAAGACACTTCCATAATCGAACGTTCGAATGTTTTTCTTATT TAATGATTTTCTTAAATTACTGTGAGTCATAAAATTTGTTCATGAAATCG ACAATATATTTATTTTGACCAATTTCTTTGAAAAACAACAAAAGCGACAC AAAAAATCAAACTTTGAAAGCAAACTTTGAAAAGCTAAATTATATCGGGA ATTATTCAATGGCTGTTTTTGCCTACGGGTATATAATAATACGAATTAAC CTTTGGTTACGAAACTCTGTATTGGAAAGGATTTAAAGAAATTTAACGTC TGCTCAACAAAAAAAACAACTATAAAGCCTACATTTTTAAACCACATTTT AACGGTGAAGAAATCCCTCTTTTTATTTGAGTAGTATTCATAAATCACAG AAATCAAATGTCATTTTTCGTAAAATGTTAGCGTTGCATATTCTCCTAAG AGCATAGAGATAAAATATTGGTATGTCAAAATATAGGTCAAAGCTCTTGT GTTTAACATGAGTGGGATGTTTGTTTCCAACGGGGAAAGCAATGAGAAAT TTTTGTTTATCTTCTACTGGGTCCAGCCCATGCTATATTGAAATATTCTT TCACTATTCAAAAAATAAATAAATTTACAACAGTTTTGTATTTAAAATGT TTAAAAATAAGATTAGATTTACTAGGAAAAGAATTCTATTTGTCCAAGAT CGCTAGAAAAGACTAAGTCGAGACGAGCATCTTTTTAGCCATTAGAAACT TCAAAAACGAGCGGTTGACATCGAGACAACAATTATTACCGTTTTCTCCA AGGCTAAGTGGTTTATTCAATTCTCCACGTAGAGATTAGATTTTGTCCTG GTTTTTCATTAAAGAAAGGTTTATACTTGAATAAATTTTCTCCATGTCTC ATGACATGTGTCCTAAATTCATATAAATTGACTTGTATACAGAATCATTG AATTCGGTAATGTTTGGTAATCCTTCTCGTAAAATCAAGATTCAGCCCAT TTCTTATGTTCTTAACCACGTCTTTTCCTCCAATTACCAAAAACTGTCAC TACAAAAGAATTCACATTTCATAATCCAACATGTATTCGTTGTGTTGATG TCTTTGTAAACATAATCCAAGACCAATCCGCTCTTCCATGCTCTGTTCAC AAACAGCGTTCCTTCTTCGATTCAATAGTAAACCCTTATTTTGTTCAACC GTGCACTTTTTCTTTTCATATTCTCTGGCGTAGAATCTCATAATCTGTAT TTCCATTTTCGAAAGCTTCCTTCCATGAATTTTATCCATTTTTAATTGCT CACTGTGTTCTGTGTCCTTTGAGACTTGACGCATGCATCTTTCAATAAAA AGTTCTCCTTGTTTGTAAAGTGTATCGTCTTCGATATCCAGTGATTGATA GCTATCACTCTCTTGTAAGAATCGCTTTTCCTTTCGTTTAAGTATCTTTT TGGCTGTGTTACTTAAAAAGGCTTTTTGGAAACCCATTTCGTTACTGTTT AGGTAACCAGCCTTCTATGCTCTTTAAGTTGTGTTTTATTCATCTTTATA TATGATATGTTTCGCCTAAGTCACTGTGTTGGACACCCACTTTAAAGATA ACATTATGTGGGAGTTTGTTTAGTATCACATAGGAGTATATCCTCTTTGC NACCCACTTTAAAGATAACATTATGTGGGAGTTTGTTTAGTATCACACAG GAGTATATCCTCTTTGCTGATTTGTGTGTAAAAAAAAAGACAAAATAAAC CTTTGTTTACACATTTCAAGTGTGCATATTTTTTCCCTGATTGTCAAATG TTGGTTTTGTGTGACGTTCTATTATTTTGTTTACTTAGCTTAGTGTCTTC CTCTACCGAACGAGTTTATCATCATCGTGATAAACAATGCCTGCACCCTA TTCTTTGACAACTTCCGAGACTTAATTTTTGTCACTACAGATCCCACGCA AGTAATACTCTTTTTTATAAGAATAGTAGATTTTTGATGAGACTCAGCTG TTCTTGTTTTTTTTTTGGCACTTTGAGCCTCAAGTTCTTATTTTGAAGAG TGAAATTGAGGTATTTTAGGCTTTATACCCAATTTTTACTGCTTTGACCC CTAAATTGCTTGAAGTTGAGTAATTCCAGGCTCGGCATAGTTCTTAAATT GTTCTTATCTTTTGGCGATTTTGAGCCTCGTTGTTCTTTTAAAACAAAAA GAGTGTACTCGTGAAGGCAAGTCTACGCAATTTTTTTTCAAATTTTCGGC TTATTTATCTTTAAAATCTTTTTTTTAGCATTTTTAGCATTCTTTTACCA TGAAAATCCTTATAACACTCATTAAAATTCAACACTCATTAAAAAAATTG CCCACTGTCGAGCTACCTAAGAAATAGTAGAAAGAATACGTACGATTTAG TAACACCTTAGCTCAAAATCTTCAAATATTTCCCGTTTAGACCTGCGCAT TGTTTTTTGTTTGTTTTGGCTTCGTGAGTGAAATATATGTCAGTTAGGAA CAGGCAGCTTGAGATAGAAAGTCCCTCTACTGGATTTTATTGAATCGGTC TATATAGTAGGGGGCCAAGCCTGGTTTATTCCAAAGGACAGTATAATAGA AGCTATTTTTGAGAGGGAGGACGCTGATTAAGCCCGGGAAAACTTTTTAT GACTAAAATAGTGACGCCATAGGCGGGACTGCAAGGGAAAATAAGGGGTA AGAAAAAAGCTGATTTTCAAAAGTCAAAAATAAACGAAAATGATTGGTAC AATCCGAAAAAGCATGAAATTCTGAGCAAAAAAATTTATTACAACAACTC TCTGACTAAAACATACAAATAAACACAGCCGCTTTAAGACCAACTAACTG TCAGCTCTACAGTGATTCGACGTCAAATCTTGTCTTGATCGTACTGACGT CGGTATGTTTTTGAACTTCAATCTTGTAGTATATGCTGTTCTTTGGAATA AACTATAAATGGTTCAGAATGGTTAGGTCGTAAAAAAGATGTCACGGGAC CCCAAGCTTGGCCCCCTATTAACTAGGTATACTAGGTATACTGAAAATTG TTATGGAGATATTCTCCTTATTTTTTTGGAAAAACGTCAAAATACCTCTC TTTGGTAATGGGTGATACCTGTAACATACGTCATTTAGAGAAAGTGAAAG TGAAAAACAAACTTTGTGGTCAAAAAAAAAAAAAATTTTCACCGCTACCC TTTTAACACGAGGCTTTTTTCCATTATAATCTTCAAAACAAATTTCTTAC TCCAGGTTTAAAAACAAGAACATTATTTACTACTTTTTGTGATTGGCAAG AATGATATGATATGGTCGTATAAAAAATACTTGCTCATTATAAGGTTATT TCGATTATTTCGTTATTTCGTCCCCGGTAGGAAGATAACCGAGAATTTCA GCCCCACTTGGAAATTGACTTAGATTGAATCCCCATCTGAAAATCAATGT TTACAAACTGCGCTCCAAAACCATTTGAATTTCGATAGGAATCTTTATCA TCACCAAGGAAACGGAAAAAAGTTCCAACCGGGCTGTGAGACAGGGGTGA AGTAATGAACTATAACAATACAAGTACAGTGTAGGCAATTTGTGGCCAAC AAAAAGTCAAATAATTATTTTACGATATGTCTTTCGAATATTCGATGATG CCATTAATCGACTTTAAAGTGATAACCTTGTTTTCAGGAATTAATATTTG AAATTCATGAGACTATCAGACTATTGCCCTTTGAACGTTTTGGATACTCT TTAAAATTGCTTTAAGAAAATTTTATTCTCAAGAAATTTACCTTGATTTA CGACTTATCTCGACGACTTGCCCCAGTGGCCGATTTCTATTTGGGTGCCG AAAGGCATAATGACTGGTTACTAATTTCAGCGTCCTTTGCTTTTTTACAC CATAGAATCGGCAAGTTTCAGCCAAAAAAAAGAAAAAGATACCAAAAAAT ATTCGTGCTAGCTTCTCTCGCGTTATTTTTATAAAGAAATTTCACTTTTT GTAGGGGTCACCAAAATTATAAATTTAAGCCTTCTGACGTCAATCTTGTC ATTTTTTATGACGTCAATCACATTTAACAGCGTCATCAAACTCTGACAGC GACAAAAACAGGACCCTTACATATTTTCCCACTTGGCTCAATCCTGAAAA CCGAGGGTGGGGTGGGAGCGAAGTGCTCTCAGAATATGAAACATGGAAAG GATCCTTAAGTTAAGGTACCAATTCCAGCTGGTACACAACGTTGCTTCGA CATTCATCTAGCGTTATATGGACGTTGTGTGCCATCTGGGATAGTAATAC TAATGAAGTAATGATGATGTGTACCTACTGTTTCCATTCTTCCCATTATA AAAAAAATTATTGAAAAACTACAACAAAGAAATTGATAATAAAATTGATT AAATAATATTACAAGTTAACTCTATGACTCACTTGGTAATGTATAAATTT AGAAGTTTTCGCTTTTGCTACAAGTTATTAAACAATTTTCACTGTTCCCT CGACATCATTCAGTAGTAATATCTATTAATGATTTTCCGTTTAATATAAG TCTCAGTAAACATAGTTAGCCCGTACTGTTCCTCAATCTTGATCTCATAT ACGGCATGTCGCCTGTAATTCAACCTGTCCTGTAATATGTTCTTACACGT GCATTTAGTCATCGCATTCGTGCATACATTTTCATAATTCAAATGCAAAG AATCTGTTGAGATAGATTTCAAAATGGCCGTCCGTACTGGATCGATTTTG AGATTAGGAGTTTTTATTTTCTTCTTTTGTTCTTTTCTTTGTTGGGTTTT GGTGTTGTCATCAGATTGATCTGAAGATGAGTTCTGTCTCTTTGCATCTC GCATTGATTTGGCGTATTTGTATTCTGTTTTGGCTTGCAACATTATACAT TGACAACGGCCAATGAAATTCTCGCCGGCTTTTAAATGGTCTATCTCGTC ATCAATCTTCTGGTAGACATCACGCCGCACTTTCTTTTCTTTCTTCCGTT TGAAGAATTTAATCATGCTGATGGTTGATGTCTTTCTCATTAAGATGATT TAGGGAGATAAAATGCCAGATTTTGAATTGATTGCCTCAAGTTGCGATCC CTTGTTGATTTTATTGTATTTTTGAACGAAGATTTGTGAATCAGTCACTC CTCTACGTTGTTAATATCTGTTTTCTTCTAGAGGACGTTTCGGTAACTTT TCCTTGAGGTTTTCTTCACTTCCTCTTGTCTTTCTATATCCTTTTGTTTG CAACCTTTTCTTCTTTCGGTTCGACTCTCAATTTTATATAATCACCTTTT AGTTTCTTGTTATACCTCCTACACGCACAATTCAAGAAGCTCTCTGTGTC TTCACACTAAATCACAAACTGTTGTCTTTCTCTCTTCTGCATCTCGTATT TAAAGGGTTTTTAACTGAAGTCTAAAGAAGAAAAAGGCAGGGATAAGCAG TCGCATTAAAACAATACTTTTTGTGCAGTGTTCTCTCTGTCATCAATAAT TGATTATGAAATTCACAAAGAAGTTTTTCTTTTTCTCCGTAGAGAAGCAA AACAAGAAACCATCTTGTTTCAACAAGCACGCATATGGTATTTTGTTTTA ACTCCATTGCATGAAATTTCTGCCTGCCTTCAAATTTTCTATTAGAACAC ACACACGTACAGTTTTTTTTATTTTTTTTTATGAGTAATATGTATGCGTG CAGTTTGACCTACAATCTTAGAGAAGAAAATTATGTCACCTACCCTACCA CGTGACCTTTCCGGGCGAGTGACAGACCGAGCAGCCCGTATAGATTGGCC CAAACTCAAAGGTCGTATGTCAAAAATAAAGCTTTTTGAAGACTACTTTT CAGATAAGCCATTTCACAGTCGAAATGACTCATAGGTAATCATGACCACT GCGCTGTGATAACGACTTTATGAAGCTTTTGCGTCTAACCAACGGGAAGC CGTTTACGAGGCGCAATCAGGTCTGATAATTCATGATTCATTTCGACCGT GAAATGGTCTAAACACACTAGTGCACCGTGGTAATTCTCAAGGAGATAAG TCACAACCCAATTCATTTCAACGAATTCGGTCAAACTTATGCTAACTAAA GTAATTTTATCGACTCTTAAATATCTCTTAAATATCTCTTAAATATCTCT TAAATATCTCTTAAATATCTCTTTCAATATAAGACTGGACTCTATTTCAA CATGTTGGCCATAATGATTTGTTTGACTCCGTTCTATACCGTTCCTATGG AAAAAACCCTCAAGAGCAAAGCTTGGCTGTTATTGAAAAATACTTATAGC GTGTAATTTACAGACCAAAATATAAACCCTATCGGGCCACCTTCAGCCCT GCCAGCTTTGCTCCAACCCTGACCCCAACTGATAATGATCAGCAAACCCT TTGAACTCTAAAATGGTGGAATGAGAATTAGACAGTAGTTTTTTTACGTC TATTGATAATGAAGATGGTAGGGAAGAAACCTTTTGAATTATTCATATCT GCAACATACACATGCACGTCTTTAACGTAAGGAAAACGAAAAATTTGACC ATGATTACCACAGAGGTTGTATATCCACGTTATGTAACGTAATATTGCTT CAAGTGTAAAGAAATTGAGAGATTATCTCTTCTCAGGCCAATAGAAGTTA AGAGGTGTGATTGCTATTGAACACGAAAGTTTCGACATGGAATCTTGTTT TGAGCCCCTCTTCTTCTTTCACGCCCTTCTCATCGAAAGCCGAGGTGGTA TGCCATTGACCACTAACAAAACAGTTATCTAGATTTGACATAACAGTGGG TGGGTGAGTGAATGTGGGTGGTTGAGTGGGTGAGTGAGTGAGTGGGTGGG TGAGTCGGTGGGTGAGTGAGTGAGTCGGTGGGTGAGTGGGCGGGTGAGTG GGCGGGTGAGTGGGTGAGTGATAAAAAAAAAGAAAACAGACGCTCATGTT CTTATAGAATTGTTCTTAAATAAAACTTGTTTTTTTGGACCTACCGGGAG GTCCTTTAATTTGACCGTTGTCCGTTCGTCTGTTACAAGCTTTTCTCGGG ATTGGCTCATTAGTTTTTTTTAATTTTTTACACAATAATACAAAATAGCA ATGCCTAAAAAGTGATGGAGCCCGATTTTTGAAAAAAAAATTTGGGGGGC AAATTTGGGCCAAAAACTACCTAAAAANCAATGCCTAAAAAGTGACGGAG CCCGATTTTTGAAAAAAAAATTTGGGGGGCAAATTTGGGCCAAAAACTAC CTAAAAAAAAGGTTTTTTGGACTTGGTGCAAAATTGCTTCATTAGTTTTT CCTGACTTTTGGCAGAAAGATGGAGTGCAAGGCACCTTAAAATGTGGCTG AAGTAATTTTTCTCGGAAAATTTTTTTTCGTCGTAAAATACGAATTTTCT TTTTTGGGGAAATTCTGTTTTACCATTTTCCTGTTAGCAGCTTTTCTCGG GATCGGCTTATTATTTTTTTTTCTTTTTTTTGCACAATGATACAAAATAG TAATTGTCTAAAAAGTGACGGAGCCCGATTTTGAAAAAAAAGGTTTTTTG GACTTGGTGCAAAATTGCTTCATTAGTTTTTCCTGATTTTTGTCAGAAAG ATAGAGTGCAAGGTACCTTAAAATGTGGCTGAAGTAATTTTTCTCGGAAA ATTTTATTTCGTCATAAAATTTTCAAAAAAGACGACCAAGTTACACAATG ATAAAAGAAAATAAATCAGACGTTTTTGCATTGTTCTAAAACTAATTGTG TTTGCTCAATACCAATAGTAAAATGTAGAACGCCTACTTTTATCTGATTT TGATCAACAGGTAGGTCCATTCAGCATGTTGCTTGTTTTATTTCAGTCCA GTCTTGTTGAAGTGAAATCAGATGAAGATGAGAAGAGCCACACCCTATTA TGTATCATCCCCTTTTTGTTGCACCTTGGAGTGGCCAAAATCGAACTCTT CACTCCTATCGTTGGTACAATTTTGGATCAAAGTAAGTTTTATTGTGTTT ACCGACAATTTACAACAGTAGGTGTCTGGACTGTCCTGGTTCATATTTTA ATTAGGTTTGTTGATAACATCAATCAACAAATGTGATCTAGTTTAAGGGC GTTACCCTCCTTGGAATGTCTTTGCCCAATTATTTATTCATGTATGAAGG GTCTGAGTCTGACGGTTTT

Coding sequence (CDS) from alignment at scaffold_9:178423..192491-

>TCONS_00073316 ID=TCONS_00073316|Name=TCONS_00073316|organism=Clytia hemisphaerica|type=CDS|length=8937bp|location=Sequence derived from alignment at scaffold_9:178423..192491- (Clytia hemisphaerica)
TCCAGTCTTGTTGAAGTGAAATCAGATGAAGATGAGAAGAGCCACACCCT
ATTATGTATCATCCCCTTTTTGTTGCACCTTGGAGTGGCCAAAATCGAAC
TCTTCACTCCTATCGTTGGTACAATTTTGGATCAAAGTAAGTTTTATTGT
GTTTACCGACAATTTACAACAGTAGGTGTCTGGACTGTCCTGGTTCATAT
TTTAATTAGGTTTGTTGATAACATCAATCAACAAATGTGACTGTGCATTT
CCGTCTATAGTACCAAATAGACTTTTATGGCACGCCCTAGATGCGTTCAG
TAAACAGTCAAGAAAAGCAGAGGTCATCAAGGAAACCATATTGAGCATAT
TTGATTTGATGATGCCGAAAATTGAAAACCATATTCAAAATTGTATTCAG
GAGATGTTCATGAATTGACAAGAACGAGGAAAGTTGTGTGAAATCTTTGC
TTGGAGCCACATTAAGCTGTTCACCCTTCTTTGATTGGGCTTTGGCACAT
TTAAGCTACAAACAGTCTTATGGAGATTACAATAACCTGCATGAAGAAAT
TATTTTAGTATTATGCCTTTGGAAGAGCGGCTCCAAATGTGGTTGGCATG
CTCAGTGGGCAGTGCAAACTTGTAGCCAGATATGTTCTCAATATGGCACC
AGTAGACGTGGGACATTAATAAGTGAAACAGCAACACTTAATCATGATAT
ACAAATAAAGAAGATAAAGCATGTTTTGATCTCATCAATTGAGTCAAACT
CGAAAGCTTGGGCTCCCCTTATATTTCAGGTAACTTTAAAAGATGTCACC
TCCTTTCTATCCAAAAATGATGAAAAGATAGAAGAAAGAACAAATTATGC
TATCACATTGTTACAGTCTCTACCTTGTGCACGGTATGCTGTGCTTGAAA
AGATCGGTGAAGTATTTTTTGATGAGGCACAAAGGTATATAGTGGAGCTT
GAAAGACAACATTTGGAAGACGATGGAGACACAACAATACAAGTCCAGTC
TTGTTGAAGTGAAATCAGATGAAGATGAGAAGAGCCACACCCTATTATGT
ATCATCCCCTTTTTGTTGCACCTTGGAGTGGCCAAAATCGAACTCTTCAC
TCCTATCGTTGGTACAATTTTGGATCAAAGTAAGTTTTATTGTGTTTACC
GACAATTTACAACAGTAGGTGTCTGGACTGTCCTGGTTCATATTTTAATT
AGGTTTGTTGATAACATCAATCAACAAATGTGACTGTGCATTTCCGTCTA
TAGTACCAAATAGACTTTTATGGCACGCCCTAGATGCGTTCAGTAAACAG
TCAAGAAAAGCAGAGGTCATCAAGGAAACCATATTGAGCATATTTGATTT
GATGATGCCGAAAATTGAAAACCATATTCAAAATTGTATTCAGGAGATGT
TCATGAATTGACAAGAACGAGGAAAGTTGTGTGAAATCTTTGCTTGGAGC
CACATTAAGCTGTTCACCCTTCTTTGATTGGGCTTTGGCACATTTAAGCT
ACAAACAGTCTTATGGAGATTACAATAACCTGCATGAAGAAATTATTTTA
GTATTATGCCTTTGGAAGAGCGGCTCCAAATGTGGTTGGCATGCTCAGTG
GGCAGTGCAAACTTGTAGCCAGATATGTTCTCAATATGGCACCAGTAGAC
GTGGGACATTAATAAGTGAAACAGCAACACTTAATCATGATATACAAATA
AAGAAGATAAAGCATGTTTTGATCTCATCAATTGAGTCAAACTCGAAAGC
TTGGGCTCCCCTTATATTTCAGGTAACTTTAAAAGATGTCACCTCCTTTC
TATCCAAAAATGATGAAAAGATAGAAGAAAGAACAAATTATGCTATCACA
TTGTTACAGTCTCTACCTTGTGCACGGTATGCTGTGCTTGAAAAGATCGG
TGAAGTATTTTTTGATGAGGCACAAAGGTATATAGTGGAGCTTGAAAGAC
AACATTTGGAAGACGATGGAGACACAACAATACAAGTCCAGTCTTGTTGA
AGTGAAATCAGATGAAGATGAGAAGAGCCACACCCTATTATGTATCATCC
CCTTTTTGTTGCACCTTGGAGTGGCCAAAATCGAACTCTTCACTCCTATC
GTTGGTACAATTTTGGATCAAAGTAAGTTTTATTGTGTTTACCGACAATT
TACAACAGTAGGTGTCTGGACTGTCCTGGTTCATATTTTAATTAGGTTTG
TTGATAACATCAATCAACAAATGTGACTGTGCATTTCCGTCTATAGTACC
AAATAGACTTTTATGGCACGCCCTAGATGCGTTCAGTAAACAGTCAAGAA
AAGCAGAGGTCATCAAGGAAACCATATTGAGCATATTTGATTTGATGATG
CCGAAAATTGAAAACCATATTCAAAATTGTATTCAGGAGATGTTCATGAA
TTGACAAGAACGAGGAAAGTTGTGTGAAATCTTTGCTTGGAGCCACATTA
AGCTGTTCACCCTTCTTTGATTGGGCTTTGGCACATTTAAGCTACAAACA
GTCTTATGGAGATTACAATAACCTGCATGAAGAAATTATTTTAGTATTAT
GCCTTTGGAAGAGCGGCTCCAAATGTGGTTGGCATGCTCAGTGGGCAGTG
CAAACTTGTAGCCAGATATGTTCTCAATATGGCACCAGTAGACGTGGGAC
ATTAATAAGTGAAACAGCAACACTTAATCATGATATACAAATAAAGAAGA
TAAAGCATGTTTTGATCTCATCAATTGAGTCAAACTCGAAAGCTTGGGCT
CCCCTTATATTTCAGGTAACTTTAAAAGATGTCACCTCCTTTCTATCCAA
AAATGATGAAAAGATAGAAGAAAGAACAAATTATGCTATCACATTGTTAC
AGTCTCTACCTTGTGCACGGTATGCTGTGCTTGAAAAGATCGGTGAAGTA
TTTTTTGATGAGGCACAAAGGTATATAGTGGAGCTTGAAAGACAACATTT
GGAAGACGATGGAGACACAACAATACAAGTCCAGTCTTGTTGAAGTGAAA
TCAGATGAAGATGAGAAGAGCCACACCCTATTATGTATCATCCCCTTTTT
GTTGCACCTTGGAGTGGCCAAAATCGAACTCTTCACTCCTATCGTTGGTA
CAATTTTGGATCAAAGTAAGTTTTATTGTGTTTACCGACAATTTACAACA
GTAGGTGTCTGGACTGTCCTGGTTCATATTTTAATTAGGTTTGTTGATAA
CATCAATCAACAAATGTGACTGTGCATTTCCGTCTATAGTACCAAATAGA
CTTTTATGGCACGCCCTAGATGCGTTCAGTAAACAGTCAAGAAAAGCAGA
GGTCATCAAGGAAACCATATTGAGCATATTTGATTTGATGATGCCGAAAA
TTGAAAACCATATTCAAAATTGTATTCAGGAGATGTTCATGAATTGACAA
GAACGAGGAAAGTTGTGTGAAATCTTTGCTTGGAGCCACATTAAGCTGTT
CACCCTTCTTTGATTGGGCTTTGGCACATTTAAGCTACAAACAGTCTTAT
GGAGATTACAATAACCTGCATGAAGAAATTATTTTAGTATTATGCCTTTG
GAAGAGCGGCTCCAAATGTGGTTGGCATGCTCAGTGGGCAGTGCAAACTT
GTAGCCAGATATGTTCTCAATATGGCACCAGTAGACGTGGGACATTAATA
AGTGAAACAGCAACACTTAATCATGATATACAAATAAAGAAGATAAAGCA
TGTTTTGATCTCATCAATTGAGTCAAACTCGAAAGCTTGGGCTCCCCTTA
TATTTCAGGTAACTTTAAAAGATGTCACCTCCTTTCTATCCAAAAATGAT
GAAAAGATAGAAGAAAGAACAAATTATGCTATCACATTGTTACAGTCTCT
ACCTTGTGCACGGTATGCTGTGCTTGAAAAGATCGGTGAAGTATTTTTTG
ATGAGGCACAAAGGTATATAGTGGAGCTTGAAAGACAACATTTGGAAGAC
GATGGAGACACAACAATACAAGTCCAGTCTTGTTGAAGTGAAATCAGATG
AAGATGAGAAGAGCCACACCCTATTATGTATCATCCCCTTTTTGTTGCAC
CTTGGAGTGGCCAAAATCGAACTCTTCACTCCTATCGTTGGTACAATTTT
GGATCAAAGTAAGTTTTATTGTGTTTACCGACAATTTACAACAGTAGGTG
TCTGGACTGTCCTGGTTCATATTTTAATTAGGTTTGTTGATAACATCAAT
CAACAAATGTGACTGTGCATTTCCGTCTATAGTACCAAATAGACTTTTAT
GGCACGCCCTAGATGCGTTCAGTAAACAGTCAAGAAAAGCAGAGGTCATC
AAGGAAACCATATTGAGCATATTTGATTTGATGATGCCGAAAATTGAAAA
CCATATTCAAAATTGTATTCAGGAGATGTTCATGAATTGACAAGAACGAG
GAAAGTTGTGTGAAATCTTTGCTTGGAGCCACATTAAGCTGTTCACCCTT
CTTTGATTGGGCTTTGGCACATTTAAGCTACAAACAGTCTTATGGAGATT
ACAATAACCTGCATGAAGAAATTATTTTAGTATTATGCCTTTGGAAGAGC
GGCTCCAAATGTGGTTGGCATGCTCAGTGGGCAGTGCAAACTTGTAGCCA
GATATGTTCTCAATATGGCACCAGTAGACGTGGGACATTAATAAGTGAAA
CAGCAACACTTAATCATGATATACAAATAAAGAAGATAAAGCATGTTTTG
ATCTCATCAATTGAGTCAAACTCGAAAGCTTGGGCTCCCCTTATATTTCA
GGTAACTTTAAAAGATGTCACCTCCTTTCTATCCAAAAATGATGAAAAGA
TAGAAGAAAGAACAAATTATGCTATCACATTGTTACAGTCTCTACCTTGT
GCACGGTATGCTGTGCTTGAAAAGATCGGTGAAGTATTTTTTGATGAGGC
ACAAAGGTATATAGTGGAGCTTGAAAGACAACATTTGGAAGACGATGGAG
ACACAACAATACAAGTCCAGTCTTGTTGAAGTGAAATCAGATGAAGATGA
GAAGAGCCACACCCTATTATGTATCATCCCCTTTTTGTTGCACCTTGGAG
TGGCCAAAATCGAACTCTTCACTCCTATCGTTGGTACAATTTTGGATCAA
AGTAAGTTTTATTGTGTTTACCGACAATTTACAACAGTAGGTGTCTGGAC
TGTCCTGGTTCATATTTTAATTAGGTTTGTTGATAACATCAATCAACAAA
TGTGACTGTGCATTTCCGTCTATAGTACCAAATAGACTTTTATGGCACGC
CCTAGATGCGTTCAGTAAACAGTCAAGAAAAGCAGAGGTCATCAAGGAAA
CCATATTGAGCATATTTGATTTGATGATGCCGAAAATTGAAAACCATATT
CAAAATTGTATTCAGGAGATGTTCATGAATTGACAAGAACGAGGAAAGTT
GTGTGAAATCTTTGCTTGGAGCCACATTAAGCTGTTCACCCTTCTTTGAT
TGGGCTTTGGCACATTTAAGCTACAAACAGTCTTATGGAGATTACAATAA
CCTGCATGAAGAAATTATTTTAGTATTATGCCTTTGGAAGAGCGGCTCCA
AATGTGGTTGGCATGCTCAGTGGGCAGTGCAAACTTGTAGCCAGATATGT
TCTCAATATGGCACCAGTAGACGTGGGACATTAATAAGTGAAACAGCAAC
ACTTAATCATGATATACAAATAAAGAAGATAAAGCATGTTTTGATCTCAT
CAATTGAGTCAAACTCGAAAGCTTGGGCTCCCCTTATATTTCAGGTAACT
TTAAAAGATGTCACCTCCTTTCTATCCAAAAATGATGAAAAGATAGAAGA
AAGAACAAATTATGCTATCACATTGTTACAGTCTCTACCTTGTGCACGGT
ATGCTGTGCTTGAAAAGATCGGTGAAGTATTTTTTGATGAGGCACAAAGG
TATATAGTGGAGCTTGAAAGACAACATTTGGAAGACGATGGAGACACAAC
AATACAAGTCCAGTCTTGTTGAAGTGAAATCAGATGAAGATGAGAAGAGC
CACACCCTATTATGTATCATCCCCTTTTTGTTGCACCTTGGAGTGGCCAA
AATCGAACTCTTCACTCCTATCGTTGGTACAATTTTGGATCAAAGTAAGT
TTTATTGTGTTTACCGACAATTTACAACAGTAGGTGTCTGGACTGTCCTG
GTTCATATTTTAATTAGGTTTGTTGATAACATCAATCAACAAATGTGACT
GTGCATTTCCGTCTATAGTACCAAATAGACTTTTATGGCACGCCCTAGAT
GCGTTCAGTAAACAGTCAAGAAAAGCAGAGGTCATCAAGGAAACCATATT
GAGCATATTTGATTTGATGATGCCGAAAATTGAAAACCATATTCAAAATT
GTATTCAGGAGATGTTCATGAATTGACAAGAACGAGGAAAGTTGTGTGAA
ATCTTTGCTTGGAGCCACATTAAGCTGTTCACCCTTCTTTGATTGGGCTT
TGGCACATTTAAGCTACAAACAGTCTTATGGAGATTACAATAACCTGCAT
GAAGAAATTATTTTAGTATTATGCCTTTGGAAGAGCGGCTCCAAATGTGG
TTGGCATGCTCAGTGGGCAGTGCAAACTTGTAGCCAGATATGTTCTCAAT
ATGGCACCAGTAGACGTGGGACATTAATAAGTGAAACAGCAACACTTAAT
CATGATATACAAATAAAGAAGATAAAGCATGTTTTGATCTCATCAATTGA
GTCAAACTCGAAAGCTTGGGCTCCCCTTATATTTCAGGTAACTTTAAAAG
ATGTCACCTCCTTTCTATCCAAAAATGATGAAAAGATAGAAGAAAGAACA
AATTATGCTATCACATTGTTACAGTCTCTACCTTGTGCACGGTATGCTGT
GCTTGAAAAGATCGGTGAAGTATTTTTTGATGAGGCACAAAGGTATATAG
TGGAGCTTGAAAGACAACATTTGGAAGACGATGGAGACACAACAATACAA
GTCCAGTCTTGTTGAAGTGAAATCAGATGAAGATGAGAAGAGCCACACCC
TATTATGTATCATCCCCTTTTTGTTGCACCTTGGAGTGGCCAAAATCGAA
CTCTTCACTCCTATCGTTGGTACAATTTTGGATCAAAGTAAGTTTTATTG
TGTTTACCGACAATTTACAACAGTAGGTGTCTGGACTGTCCTGGTTCATA
TTTTAATTAGGTTTGTTGATAACATCAATCAACAAATGTGACTGTGCATT
TCCGTCTATAGTACCAAATAGACTTTTATGGCACGCCCTAGATGCGTTCA
GTAAACAGTCAAGAAAAGCAGAGGTCATCAAGGAAACCATATTGAGCATA
TTTGATTTGATGATGCCGAAAATTGAAAACCATATTCAAAATTGTATTCA
GGAGATGTTCATGAATTGACAAGAACGAGGAAAGTTGTGTGAAATCTTTG
CTTGGAGCCACATTAAGCTGTTCACCCTTCTTTGATTGGGCTTTGGCACA
TTTAAGCTACAAACAGTCTTATGGAGATTACAATAACCTGCATGAAGAAA
TTATTTTAGTATTATGCCTTTGGAAGAGCGGCTCCAAATGTGGTTGGCAT
GCTCAGTGGGCAGTGCAAACTTGTAGCCAGATATGTTCTCAATATGGCAC
CAGTAGACGTGGGACATTAATAAGTGAAACAGCAACACTTAATCATGATA
TACAAATAAAGAAGATAAAGCATGTTTTGATCTCATCAATTGAGTCAAAC
TCGAAAGCTTGGGCTCCCCTTATATTTCAGGTAACTTTAAAAGATGTCAC
CTCCTTTCTATCCAAAAATGATGAAAAGATAGAAGAAAGAACAAATTATG
CTATCACATTGTTACAGTCTCTACCTTGTGCACGGTATGCTGTGCTTGAA
AAGATCGGTGAAGTATTTTTTGATGAGGCACAAAGGTATATAGTGGAGCT
TGAAAGACAACATTTGGAAGACGATGGAGACACAACAATACAAGTCCAGT
CTTGTTGAAGTGAAATCAGATGAAGATGAGAAGAGCCACACCCTATTATG
TATCATCCCCTTTTTGTTGCACCTTGGAGTGGCCAAAATCGAACTCTTCA
CTCCTATCGTTGGTACAATTTTGGATCAAAGTAAGTTTTATTGTGTTTAC
CGACAATTTACAACAGTAGGTGTCTGGACTGTCCTGGTTCATATTTTAAT
TAGGTTTGTTGATAACATCAATCAACAAATGTGACTGTGCATTTCCGTCT
ATAGTACCAAATAGACTTTTATGGCACGCCCTAGATGCGTTCAGTAAACA
GTCAAGAAAAGCAGAGGTCATCAAGGAAACCATATTGAGCATATTTGATT
TGATGATGCCGAAAATTGAAAACCATATTCAAAATTGTATTCAGGAGATG
TTCATGAATTGACAAGAACGAGGAAAGTTGTGTGAAATCTTTGCTTGGAG
CCACATTAAGCTGTTCACCCTTCTTTGATTGGGCTTTGGCACATTTAAGC
TACAAACAGTCTTATGGAGATTACAATAACCTGCATGAAGAAATTATTTT
AGTATTATGCCTTTGGAAGAGCGGCTCCAAATGTGGTTGGCATGCTCAGT
GGGCAGTGCAAACTTGTAGCCAGATATGTTCTCAATATGGCACCAGTAGA
CGTGGGACATTAATAAGTGAAACAGCAACACTTAATCATGATATACAAAT
AAAGAAGATAAAGCATGTTTTGATCTCATCAATTGAGTCAAACTCGAAAG
CTTGGGCTCCCCTTATATTTCAGGTAACTTTAAAAGATGTCACCTCCTTT
CTATCCAAAAATGATGAAAAGATAGAAGAAAGAACAAATTATGCTATCAC
ATTGTTACAGTCTCTACCTTGTGCACGGTATGCTGTGCTTGAAAAGATCG
GTGAAGTATTTTTTGATGAGGCACAAAGGTATATAGTGGAGCTTGAAAGA
CAACATTTGGAAGACGATGGAGACACAACAATACAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045484XLOC_045484Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073316-exon-scaffold_9-1575043694:192425..192491TCONS_00073316-exon-scaffold_9-1575043694:192425..192491Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1575043694:191945..192137TCONS_00073316-exon-scaffold_9-1575043694:191945..192137Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1575043694:191616..191737TCONS_00073316-exon-scaffold_9-1575043694:191616..191737Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1575043694:191097..191148TCONS_00073316-exon-scaffold_9-1575043694:191097..191148Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1575043694:190761..190814TCONS_00073316-exon-scaffold_9-1575043694:190761..190814Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1575043694:188379..188424TCONS_00073316-exon-scaffold_9-1575043694:188379..188424Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1575043694:188123..188215TCONS_00073316-exon-scaffold_9-1575043694:188123..188215Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1575043694:187725..187896TCONS_00073316-exon-scaffold_9-1575043694:187725..187896Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1575043694:178423..178745TCONS_00073316-exon-scaffold_9-1575043694:178423..178745Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1510915933:192425..192491TCONS_00073316-exon-scaffold_9-1510915933:192425..192491Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1510915933:191945..192137TCONS_00073316-exon-scaffold_9-1510915933:191945..192137Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1510915933:191616..191737TCONS_00073316-exon-scaffold_9-1510915933:191616..191737Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1510915933:191097..191148TCONS_00073316-exon-scaffold_9-1510915933:191097..191148Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1510915933:190761..190814TCONS_00073316-exon-scaffold_9-1510915933:190761..190814Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1510915933:188379..188424TCONS_00073316-exon-scaffold_9-1510915933:188379..188424Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1510915933:188123..188215TCONS_00073316-exon-scaffold_9-1510915933:188123..188215Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1510915933:187725..187896TCONS_00073316-exon-scaffold_9-1510915933:187725..187896Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1510915933:178423..178745TCONS_00073316-exon-scaffold_9-1510915933:178423..178745Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1491911889:192425..192491TCONS_00073316-exon-scaffold_9-1491911889:192425..192491Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1491911889:191945..192137TCONS_00073316-exon-scaffold_9-1491911889:191945..192137Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1491911889:191616..191737TCONS_00073316-exon-scaffold_9-1491911889:191616..191737Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1491911889:191097..191148TCONS_00073316-exon-scaffold_9-1491911889:191097..191148Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1491911889:190761..190814TCONS_00073316-exon-scaffold_9-1491911889:190761..190814Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1491911889:188379..188424TCONS_00073316-exon-scaffold_9-1491911889:188379..188424Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1491911889:188123..188215TCONS_00073316-exon-scaffold_9-1491911889:188123..188215Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1491911889:187725..187896TCONS_00073316-exon-scaffold_9-1491911889:187725..187896Clytia hemisphaericaexon
TCONS_00073316-exon-scaffold_9-1491911889:178423..178745TCONS_00073316-exon-scaffold_9-1491911889:178423..178745Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073316-proteinTCONS_00073316-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:178423..192491 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
25.8409 22.8116 7.39158 4.47665 12.5767 10.6422 13.3889 13.3296 11.3953 12.8982 9.25167 8.90255 8.08902 7.51485 10.1499 12.0054 16.4815 15.1589 3.59374 5.18702 9.65563 10.3356 20.4059 20.6582 13.1837 14.8194 6.4472 4.71977 14.0172 15.8193
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029445INTS5_N
Blast
BLAST of TCONS_00073316 vs. Swiss-Prot (Human)
Match: INT5 (Integrator complex subunit 5 OS=Homo sapiens GN=INTS5 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.316e-28
Identity = 92/352 (26.14%), Postives = 148/352 (42.05%), Query Frame = 2
Query:   53 TQQYKVTLKDVTSFLSKNDEKIEERTNYAITLLQSLPCARYAVLEKIGEVFFDEAQRYIVELER--------------QHLEDGGTLISETATLNHDIQIKKIKHVLISSIESNSKAWAPLIFQWAVQTCSQICSQYGTSRH----FSIMPLEERLQMWLACSATNSLMEITITCMKKLIDKNEESCVKSLLGATLSCSPFFDWALAHLSCAFPSIVPNRLLWHALDAF---------------------------SKQSRKAEVIKETILSIFDLMMPKIENH---IQNCIQEMFMSSLVEVKSDEDEKSHTLLCIIPFLLHLGVAKIELFTPIVGTILDQSKFYCVYRQF 964
            +Q+ K  L  V   L  +     E     + LL+SLP AR AVL+ +  VF +  + ++  L+                H+  GG  + +         +++++ VL   I +N KAWAP+I  W++    Q+ S Y + +H     +   L E LQ+W+ C AT +LM+I + C+  LI    ++CV +LL  ++  SP FDW +AH+  +FP  + +R+L   L  F                              +  AE     I S+  ++      H   I+  +  MF  SL    S       +L   +PFLL L V    L   + G ++D  K   V  Q 
Sbjct:   32 SQEIKAFLTGVDPILG-HQLSAREHARCGLLLLRSLPPARAAVLDHLRGVFDESVRAHLAALDETPVAGPPHLRPPPPSHVPAGGPGLEDV--------VQEVQQVLSEFIRANPKAWAPVISAWSIDLMGQLSSTY-SGQHQRVPHATGALNELLQLWMGCRATRTLMDIYVQCLSALIGSCPDACVDALLDTSVQHSPHFDWVVAHIGSSFPGTIISRVLSCGLKDFCVHGGAGGGAGSSGGSSSQTPSTDPFPGSPAIPAEKRVPKIASVVGILGHLASRHGDSIRRELLRMFHDSLAG-GSGGRSGDPSLQATVPFLLQLAVMSPALLGTVSGELVDCLKPPAVLSQL 372          
The following BLAST results are available for this feature:
BLAST of TCONS_00073316 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
INT51.316e-2826.14Integrator complex subunit 5 OS=Homo sapiens GN=IN... [more]
back to top