Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073304 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073304
Unique NameTCONS_00073304
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1487

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073304 ID=TCONS_00073304|Name=TCONS_00073304|organism=Clytia hemisphaerica|type=transcript|length=1487bp
TGGTcatttactttcactttcgttttcgttttagTATGAACGGCAACTTT
GATCGCACAGCAGgtactttttgatttctgaataAGAAACATAGCACAGA
GCGGCTTGTAAACGAACTTATGAAAACTCTCTACAGCTTCTTCAAAGGTG
TTTCCTCACACTCTGTATAATATCTTTTGCAACAAGCTTCAAAACCGAAA
GTGGATTTCTACACACCTGACCGCAAATAAATGATAATTTTTGTAAAGAT
ACACCAAGATTTTTCATATCGCAGCATTATGTAGAGTTATGAACGTTGAA
TATTGATGGAAATAAATTTTACGAGGAGAGCCATCAACTGCTTCATGCCA
GGTGGATGCCGTAAATCCACCGTAAAATGTCTCGAAACCGTGACTATTTG
AGTCGTAAACACCGAAGCAATAAACAACCTTCAAACTCCACTAACCATCG
ACATGACATTTTCGAAGAACGACAAAACCACCACGACCTTCAACAACTTG
AAAACGAGGTTCTTCCACTTGGAGCCGAGGCAGATGACAACGAAAGGAGA
CAGGTATTAGTGGATATGATATATGAGAGACATTTGAGCGGAGAAAAGAC
TGGGGAGAATGACTCAACCTCTTCTGACGAAGAACAGATCAATGAACAag
ATTATTGTTGGTTCTGGGACGAGTCAAAAAAgtcagatgacgtcatcgta
cAAAACTGTGGAACAGAAGCTTATTTTCATCCGGACTACAGCTGCGGGAC
GGCTGCGATCCGGGGCAACCGACAATTTCGTGAAGGCGAGGAACATTACT
GGGAAGTTCAAATGTCGAGTGCCGTGTATGGTACAGATATGATGATCGGT
ATCGGTGCCAGCAACGTCAACTTGGATCGCTACAAATCGCAATTCTGTTC
GCTCATCGGAAAAGATATCGACAGTTGGGGAATAAGTTACTTCGGAACAT
TACATCATAAcggaaaaactaaaaacttctGCAAAAAATTCGAAAGAGGG
GCTACTATAGGCTGTCACCTCGATCTTTGGAAAGGCACTTTATCCTTCTA
TAGGAACGGAGAACCTTTAGGAATAGCTTTCGATGGATTACTTGAAACTC
TACCTCTGCCCAATGGATTGAAAAAATACATCGGCTGGAGAATGGATTGG
GTATTCACATTAAACAACCCTCGAaaactttcttcttcttctgcgCCAAC
AAGTTCAACGAACtcaaacaaaatgaaagaaattgccGGTCCACAAAGAA
AGCGCATCCGAAGCAAACACAAAGACAAAGAGACTCCACTCACCGATGAA
GCAGACACCATctaacaaattttcatttctcactatttttacttttttta
cgaatctcaattttgtaaatttgatttttggatactaacaacattttttt
tctcatgattaacaaaattgattattttggtCTTCTGAGTACTTtccaaa
ccaaacaaaactaaacatagCAACATGTCATTTTCAT
Run BLAST on NCBI

protein sequence of TCONS_00073304-protein

>TCONS_00073304-protein ID=TCONS_00073304-protein|Name=TCONS_00073304-protein|organism=Clytia hemisphaerica|type=polypeptide|length=312bp
MSRNRDYLSRKHRSNKQPSNSTNHRHDIFEERQNHHDLQQLENEVLPLGA
EADDNERRQVLVDMIYERHLSGEKTGENDSTSSDEEQINEQDYCWFWDES
KKSDDVIVQNCGTEAYFHPDYSCGTAAIRGNRQFREGEEHYWEVQMSSAV
YGTDMMIGIGASNVNLDRYKSQFCSLIGKDIDSWGISYFGTLHHNGKTKN
FCKKFERGATIGCHLDLWKGTLSFYRNGEPLGIAFDGLLETLPLPNGLKK
YIGWRMDWVFTLNNPRKLSSSSAPTSSTNSNKMKEIAGPQRKRIRSKHKD
KETPLTDEADTI
Run BLAST on NCBI

transcript from alignment at scaffold_9:134961..139181+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073304 ID=TCONS_00073304|Name=TCONS_00073304|organism=Clytia hemisphaerica|type=transcript|length=4221bp|location=Sequence derived from alignment at scaffold_9:134961..139181+ (Clytia hemisphaerica)
TGGTcatttactttcactttcgttttcgttttagTATGAACGGCAACTTT GATCGCACAGCAGgtactttttgatttctgaataAGAAACATAGCACAGA GCGGCTTGTAAACGAACTTATGAAAACTCTCTACAGCTTCTTCAAAGGTG TTTCCTCACACTCTGTATAATATCTTTTGCAACAAGCTTCAAAACCGAAA GTGGATTTCTACACACCTGACCGCAAATAAATGATAATTTTTGTAAAGAT ACACCAAGATTTTTCATATCGCAGCATTATGTAGAGTTATGAACGTTGAA TATTGATGGAAATAAATTTTACGAGGAGAGCCATCAACTGCTTCATGCCA GGTGGATGCCGTAAATCCACCGTAAAATGTCTCGAAACCGTGACTATTTG AGTCGTAAACACCGAAGCAATAAACAACCTTCAAACTCCACTAACCATCG ACATGACATTTTCGAAGAACGACAAAACCACCACGACCTTCAACAACTTG AAAACGAGGTTCTTCCACTTGGAGCCGAGGCAGATGACAACGAAAGGAGA CAGGTATTAGTGGATATGATATATGAGAGACATTTGAGCGGAGAAAAGAC TGGGGAGAATGACTCAACCTCTTCTGACGAAGAACAGATCAATGAACAag gtttgttatttttcttccctaaaaaccaattttcttcCTCTCGTTTTCTC ATTTCAGATTTTGAACTTCTTTAGCATAAGGGAGGTTGTTGTCCGGTCTA TACGGAAAGCCAATACTTGTGTTCTATAGTATAATATTAAATCTGCCTAT CATTTCTGGTCATGTTCCAAACGATGCTTCAAATTTTGTGAGAAATTTTA TCTTCAATACTAAAACTTCTTTATTGACAGTAAATATAGAATTATTACAT GAAAGTTATATTTCTTAGAGCGTTGCCCGTTGGAgtaaaaaacagcaaaa aaacatgttttttgaCTCCAACGAGCTATCTTCTAGAGGATGTAATTTTC GATCTAAGGACTTTAAGggaaaaataattatatataaTAGCTGAAATCAG GCTAAAAGTatctttgtaccaaaaataaAGATgctcaaaaagtttgtttt tttttctttgtgtttcatcttattttaaatatttttgagttacttttcca aaaaaattatagtgctctgaatatttttcaactggTATATCCAAAAATGT TAGAATTAAGTATTTGTTGAAAATTGGCAAACAAAAAATCCCGAAATTTG ACCGGGTTTTGAGTTTTAGAAATTGTGGAAGGGAGTTTCGGATCAATCAT TTTTGGCCGAAAGTTTATCACTTTTCCCAGAGAACGTCAGTGTATGTGTT GTtcaagataaaataaaataaagagcCCTCTCTTTCAGATTATTGTTGGT TCTGGGACGAGTCAAAAAAgtcagatgacgtcatcgtacAAAACTGTGGA ACAGAAGCTTATTTTCATCCGGACTACAGCTGCGGGACGGCTGCGATCCG GGGCAACCGACAATTTCGTGAAGGCGAGGAACATTACTGGGAAGTTCAAA TGTCGAGTGCCGTGTATGGTACAGATATGGTATGAGTGGTTTTTGTTGGA cctctttaaatgttcttagttATTAAGGATGAAAACAACAAATTCTCAGT TGTTAGAAAAAGAGGTTTGTTTCTCAGAGCAGCGTGTTGCTTAGCTAAGA GTTTTGAAACTATTCTTCCTTTGAATTCGAGCTTTTTTATGAATGATaag cttttttgaatttctttattaCAAAATGATCCATAATTTCTTGGTTTGAA TGCGGTTTGCAATTTCAGACATTACATGCAGAGTTTCGTTTCAGTTTCTT CCAGACAATGTCCATCCCAACAAAGAGTAAGCAAAAAATCTACGCATGCG TATTGAACTGAGCTTTTTTGAATGCATGTTCGCATGAATTTTCACATTCT TGttttaaaggggaattaacgtATCCATTTTACCCTTTCAAAATGCATTC acacaaaaaaaataatcattgaaaaaacttttttattcgcTGAATTAAat aagatgaaaataaaaaaatttgtataatttAGTCTGCCGATAAAATTTTC ACGTAAATGTATTTTCCTGAACAAGGCAtagattcaaaagaaagaaatgc gaaaattgaattatttgcGAAATTAATCCGATTAGATACATTCCcaataa ataaatcaatttcaaaattctggaaagcaaaaaaaattgtagcTTCCTTC AACGTGAAATTGACAAAACTTGATCTATTGTTTGCCCTGTATAAATTAGA TAATGTTGCTCACCAAATGGGAGGATTTAAACCGCACAGGCATGAATGAA TAAGCATTAACTAACGATTTTTAGTCATTCCCTTTCTTGATCACTCTTGC TTTTCAGATGATCGGTATCGGTGCCAGCAACGTCAACTTGGATCGCTACA AATCGCAATTCTGTTCGCTCATCGGAAAAGATATCGACAGTTGGGGAATA AGTTACTTCGGAACATTACATCATAAcggaaaaactaaaaacttctGCAA AAAATTCGAAAGAGGGGCTACTATAGGCTGTCACCTCGATCTTTGGAAAG GCACTTTATCCTTCTATAGGAACGGAGAACCTTTAGGAATAGCTTTCGAT GGATTACTTGGTAAAGAGCTTTATCCAATGATCTCCTCAACCGCAGCAAG AACGAAAATGAGACTTTTGTGTAGCCGAAAGACGAATTTTTCTTTACAAT ATTTATGTTGCAAAGAGATCAGTAAGAATATCCCTTCATCGAGGAACAAC AACGTTTTAGAAACTCTACCTCTGCCCAATGGATTGAAAAAATACATCGG CTGGAGAATGGATTGGGTATTCACATTAAACAACCCTCGAaaactttctt cttcttctgcgCCAACAAGTTCAACGAACtcaaacaaaatgaaagaaatt gccGGTCCACAAAGAAAGCGCATCCGAAGGTATTGACTTTATTTACATTA CCATGACAACGACGACATTACCATGACAACCGACCGACATCACCTTGACA ACCGACCGACAAAAACAATGATTGACGAACGACAAAATTTGTCCGAAAAA TTAGAgagtatattttttttaagaaacggAGTAGATAACTGATGATTTTT TATGTaaattgttttatgtttttgtatattttttgacGAAAGAATTTCTA TTGCACTGGTTGCAACTACACAGGAGACCCAACTCGACATCTTACATGGA CGGTACTTTTATGACGAATTGACAATGGCACCAATTCGAAGATTTCAATG GACTTTTTCATTAATTACATCACGagcgttttcaaaatattgctatggtt attgattcccagaggagtCCACTTTATTCaaaaagtactttaggcgtaca aactttcgcgagatcgtaaaatcgcgaaattcacgacatttactttcgcg aatttcaggaaaaaatatttttcgcgagcacaaactttcgcgaatcgttg gatgaaaatgaaaatttataaacgaaaatttgataaaaagtgATGCTCCT TGAATCCGATAAAAACGGTTATACTTTGACTTTAAAAAGGCGTCAAAGGc aataaatatgctgaaaattgTATATTCATTacgatttcaaagttttttag attttcaattttttaaagaaaatttcgcgagcataaactttcgcgaatca ccCTGTTAAGAAATttcacgagcataaactttcgcgaaaaaggccaaaat tcgcgaaaatcgcgaaagtttctgcttgcgaaagtttgtacgtctaAAGT AACATCATCTTTTGAAAGTCTGAAAATTTGCGAATTTTAGTTAATGTGTG GGGCTCCGTTTATTCtaacctgttcttattttctaaAATCACTGAAATGA ATCCAACCCTCGAATGTCATTTTCTGAATGTTGATTAACCGAACAAGTCC TGAATGTGTGAAAAGTTTCTGTTGAActattccttttctttttccagCAA ACACAAAGACAAAGAGACTCCACTCACCGATGAAGCAGACACCATctaac aaattttcatttctcactatttttactttttttacgaatctcaattttgt aaatttgatttttggatactaacaacattttttttctcatgattaacaaa attgattattttggtCTTCTGAGTACTTtccaaaccaaacaaaactaaac atagCAACATGTCATTTTCAT

Coding sequence (CDS) from alignment at scaffold_9:134961..139181+

>TCONS_00073304 ID=TCONS_00073304|Name=TCONS_00073304|organism=Clytia hemisphaerica|type=CDS|length=4695bp|location=Sequence derived from alignment at scaffold_9:134961..139181+ (Clytia hemisphaerica)
ATGTCTCGAAACCGTGACTATTTGAGTCGTAAACACCGAAGCAATAAACA
ACCTTCAAACTCCACTAACCATCGACATGACATTTTCGAAGAACGACAAA
ACCACCACGACCTTCAACAACTTGAAAACGAGGTTCTTCCACTTGGAGCC
GAGGCAGATGACAACGAAAGGAGACAGGTATTAGTGGATATGATATATGA
GAGACATTTGAGCGGAGAAAAGACTGGGGAGAATGACTCAACCTCTTCTG
ACGAAGAACAGATCAATGAACAagATTATTGTTGGTTCTGGGACGAGTCA
AAAAAgtcagatgacgtcatcgtacAAAACTGTGGAACAGAAGCTTATTT
TCATCCGGACTACAGCTGCGGGACGGCTGCGATCCGGGGCAACCGACAAT
TTCGTGAAGGCGAGGAACATTACTGGGAAGTTCAAATGTCGAGTGCCGTG
TATGGTACAGATATGATGATCGGTATCGGTGCCAGCAACGTCAACTTGGA
TCGCTACAAATCGCAATTCTGTTCGCTCATCGGAAAAGATATCGACAGTT
GGGGAATAAGTTACTTCGGAACATTACATCATAAcggaaaaactaaaaac
ttctGCAAAAAATTCGAAAGAGGGGCTACTATAGGCTGTCACCTCGATCT
TTGGAAAGGCACTTTATCCTTCTATAGGAACGGAGAACCTTTAGGAATAG
CTTTCGATGGATTACTTGAAACTCTACCTCTGCCCAATGGATTGAAAAAA
TACATCGGCTGGAGAATGGATTGGGTATTCACATTAAACAACCCTCGAaa
actttcttcttcttctgcgCCAACAAGTTCAACGAACtcaaacaaaatga
aagaaattgccGGTCCACAAAGAAAGCGCATCCGAAGCAAACACAAAGAC
AAAGAGACTCCACTCACCGATGAAGCAGACACCATctaaATGTCTCGAAA
CCGTGACTATTTGAGTCGTAAACACCGAAGCAATAAACAACCTTCAAACT
CCACTAACCATCGACATGACATTTTCGAAGAACGACAAAACCACCACGAC
CTTCAACAACTTGAAAACGAGGTTCTTCCACTTGGAGCCGAGGCAGATGA
CAACGAAAGGAGACAGGTATTAGTGGATATGATATATGAGAGACATTTGA
GCGGAGAAAAGACTGGGGAGAATGACTCAACCTCTTCTGACGAAGAACAG
ATCAATGAACAagATTATTGTTGGTTCTGGGACGAGTCAAAAAAgtcaga
tgacgtcatcgtacAAAACTGTGGAACAGAAGCTTATTTTCATCCGGACT
ACAGCTGCGGGACGGCTGCGATCCGGGGCAACCGACAATTTCGTGAAGGC
GAGGAACATTACTGGGAAGTTCAAATGTCGAGTGCCGTGTATGGTACAGA
TATGATGATCGGTATCGGTGCCAGCAACGTCAACTTGGATCGCTACAAAT
CGCAATTCTGTTCGCTCATCGGAAAAGATATCGACAGTTGGGGAATAAGT
TACTTCGGAACATTACATCATAAcggaaaaactaaaaacttctGCAAAAA
ATTCGAAAGAGGGGCTACTATAGGCTGTCACCTCGATCTTTGGAAAGGCA
CTTTATCCTTCTATAGGAACGGAGAACCTTTAGGAATAGCTTTCGATGGA
TTACTTGAAACTCTACCTCTGCCCAATGGATTGAAAAAATACATCGGCTG
GAGAATGGATTGGGTATTCACATTAAACAACCCTCGAaaactttcttctt
cttctgcgCCAACAAGTTCAACGAACtcaaacaaaatgaaagaaattgcc
GGTCCACAAAGAAAGCGCATCCGAAGCAAACACAAAGACAAAGAGACTCC
ACTCACCGATGAAGCAGACACCATctaaATGTCTCGAAACCGTGACTATT
TGAGTCGTAAACACCGAAGCAATAAACAACCTTCAAACTCCACTAACCAT
CGACATGACATTTTCGAAGAACGACAAAACCACCACGACCTTCAACAACT
TGAAAACGAGGTTCTTCCACTTGGAGCCGAGGCAGATGACAACGAAAGGA
GACAGGTATTAGTGGATATGATATATGAGAGACATTTGAGCGGAGAAAAG
ACTGGGGAGAATGACTCAACCTCTTCTGACGAAGAACAGATCAATGAACA
agATTATTGTTGGTTCTGGGACGAGTCAAAAAAgtcagatgacgtcatcg
tacAAAACTGTGGAACAGAAGCTTATTTTCATCCGGACTACAGCTGCGGG
ACGGCTGCGATCCGGGGCAACCGACAATTTCGTGAAGGCGAGGAACATTA
CTGGGAAGTTCAAATGTCGAGTGCCGTGTATGGTACAGATATGATGATCG
GTATCGGTGCCAGCAACGTCAACTTGGATCGCTACAAATCGCAATTCTGT
TCGCTCATCGGAAAAGATATCGACAGTTGGGGAATAAGTTACTTCGGAAC
ATTACATCATAAcggaaaaactaaaaacttctGCAAAAAATTCGAAAGAG
GGGCTACTATAGGCTGTCACCTCGATCTTTGGAAAGGCACTTTATCCTTC
TATAGGAACGGAGAACCTTTAGGAATAGCTTTCGATGGATTACTTGAAAC
TCTACCTCTGCCCAATGGATTGAAAAAATACATCGGCTGGAGAATGGATT
GGGTATTCACATTAAACAACCCTCGAaaactttcttcttcttctgcgCCA
ACAAGTTCAACGAACtcaaacaaaatgaaagaaattgccGGTCCACAAAG
AAAGCGCATCCGAAGCAAACACAAAGACAAAGAGACTCCACTCACCGATG
AAGCAGACACCATctaaATGTCTCGAAACCGTGACTATTTGAGTCGTAAA
CACCGAAGCAATAAACAACCTTCAAACTCCACTAACCATCGACATGACAT
TTTCGAAGAACGACAAAACCACCACGACCTTCAACAACTTGAAAACGAGG
TTCTTCCACTTGGAGCCGAGGCAGATGACAACGAAAGGAGACAGGTATTA
GTGGATATGATATATGAGAGACATTTGAGCGGAGAAAAGACTGGGGAGAA
TGACTCAACCTCTTCTGACGAAGAACAGATCAATGAACAagATTATTGTT
GGTTCTGGGACGAGTCAAAAAAgtcagatgacgtcatcgtacAAAACTGT
GGAACAGAAGCTTATTTTCATCCGGACTACAGCTGCGGGACGGCTGCGAT
CCGGGGCAACCGACAATTTCGTGAAGGCGAGGAACATTACTGGGAAGTTC
AAATGTCGAGTGCCGTGTATGGTACAGATATGATGATCGGTATCGGTGCC
AGCAACGTCAACTTGGATCGCTACAAATCGCAATTCTGTTCGCTCATCGG
AAAAGATATCGACAGTTGGGGAATAAGTTACTTCGGAACATTACATCATA
AcggaaaaactaaaaacttctGCAAAAAATTCGAAAGAGGGGCTACTATA
GGCTGTCACCTCGATCTTTGGAAAGGCACTTTATCCTTCTATAGGAACGG
AGAACCTTTAGGAATAGCTTTCGATGGATTACTTGAAACTCTACCTCTGC
CCAATGGATTGAAAAAATACATCGGCTGGAGAATGGATTGGGTATTCACA
TTAAACAACCCTCGAaaactttcttcttcttctgcgCCAACAAGTTCAAC
GAACtcaaacaaaatgaaagaaattgccGGTCCACAAAGAAAGCGCATCC
GAAGCAAACACAAAGACAAAGAGACTCCACTCACCGATGAAGCAGACACC
ATctaaATGTCTCGAAACCGTGACTATTTGAGTCGTAAACACCGAAGCAA
TAAACAACCTTCAAACTCCACTAACCATCGACATGACATTTTCGAAGAAC
GACAAAACCACCACGACCTTCAACAACTTGAAAACGAGGTTCTTCCACTT
GGAGCCGAGGCAGATGACAACGAAAGGAGACAGGTATTAGTGGATATGAT
ATATGAGAGACATTTGAGCGGAGAAAAGACTGGGGAGAATGACTCAACCT
CTTCTGACGAAGAACAGATCAATGAACAagATTATTGTTGGTTCTGGGAC
GAGTCAAAAAAgtcagatgacgtcatcgtacAAAACTGTGGAACAGAAGC
TTATTTTCATCCGGACTACAGCTGCGGGACGGCTGCGATCCGGGGCAACC
GACAATTTCGTGAAGGCGAGGAACATTACTGGGAAGTTCAAATGTCGAGT
GCCGTGTATGGTACAGATATGATGATCGGTATCGGTGCCAGCAACGTCAA
CTTGGATCGCTACAAATCGCAATTCTGTTCGCTCATCGGAAAAGATATCG
ACAGTTGGGGAATAAGTTACTTCGGAACATTACATCATAAcggaaaaact
aaaaacttctGCAAAAAATTCGAAAGAGGGGCTACTATAGGCTGTCACCT
CGATCTTTGGAAAGGCACTTTATCCTTCTATAGGAACGGAGAACCTTTAG
GAATAGCTTTCGATGGATTACTTGAAACTCTACCTCTGCCCAATGGATTG
AAAAAATACATCGGCTGGAGAATGGATTGGGTATTCACATTAAACAACCC
TCGAaaactttcttcttcttctgcgCCAACAAGTTCAACGAACtcaaaca
aaatgaaagaaattgccGGTCCACAAAGAAAGCGCATCCGAAGCAAACAC
AAAGACAAAGAGACTCCACTCACCGATGAAGCAGACACCATctaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045474XLOC_045474Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073304-exon-scaffold_9-1491911889:134961..135610TCONS_00073304-exon-scaffold_9-1491911889:134961..135610Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1510915933:134961..135610TCONS_00073304-exon-scaffold_9-1510915933:134961..135610Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1575043694:134961..135610TCONS_00073304-exon-scaffold_9-1575043694:134961..135610Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1491911889:136349..136539TCONS_00073304-exon-scaffold_9-1491911889:136349..136539Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1510915933:136349..136539TCONS_00073304-exon-scaffold_9-1510915933:136349..136539Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1575043694:136349..136539TCONS_00073304-exon-scaffold_9-1575043694:136349..136539Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1491911889:137368..137620TCONS_00073304-exon-scaffold_9-1491911889:137368..137620Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1510915933:137368..137620TCONS_00073304-exon-scaffold_9-1510915933:137368..137620Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1575043694:137368..137620TCONS_00073304-exon-scaffold_9-1575043694:137368..137620Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1491911889:137771..137939TCONS_00073304-exon-scaffold_9-1491911889:137771..137939Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1510915933:137771..137939TCONS_00073304-exon-scaffold_9-1510915933:137771..137939Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1575043694:137771..137939TCONS_00073304-exon-scaffold_9-1575043694:137771..137939Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1491911889:138958..139181TCONS_00073304-exon-scaffold_9-1491911889:138958..139181Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1510915933:138958..139181TCONS_00073304-exon-scaffold_9-1510915933:138958..139181Clytia hemisphaericaexon
TCONS_00073304-exon-scaffold_9-1575043694:138958..139181TCONS_00073304-exon-scaffold_9-1575043694:138958..139181Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073304-proteinTCONS_00073304-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:134961..139181 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0555207 0.0270707 0.125727 0.092253 0.299491 0.236662 29.2661 36.0859 21.3579 18.1681 16.2 12.3132 60.9633 61.9689 38.8564 58.1416 40.1162 40.947 9.82679 10.9933 39.4284 37.9006 24.2541 28.8508 38.5678 47.1358 5.93813 3.20929 0.123247 0.188354
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003877SPRY_dom
IPR001870B30.2/SPRY
IPR013320ConA-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00073304 vs. Swiss-Prot (Human)
Match: SPSB3 (SPRY domain-containing SOCS box protein 3 OS=Homo sapiens GN=SPSB3 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 2.997e-48
Identity = 93/250 (37.20%), Postives = 135/250 (54.00%), Query Frame = 2
Query:  659 WFWDESKKSDDVIVQNCGTEAYFHPDYSCGTAAIRGNRQFREGEEHYWEVQMSSAVYGTDMMIGIGASNVNLDRYKSQFCSLIGKDIDSWGISYFGTLHHNGKTKNFCKKFERGATIGCHLDLWKGTLSFYRNGEPLGIAFDGL------------------------------------------------LETLPLPNGLKKYIGWRMDWVFTLN-NPRKLXXXXXXXXXXXXXKMKEIAGPQRKRIR 1261
            W WD+  KS   ++     +  FH +YSCGTAAIRG ++  EG+ H+WE++M+S VYGTDMM+GIG S+V+LD+Y+  FCSL+G+D DSWG+SY G LHH G   +F  +F +G+ IG HLD W GTL+F++N + +G+A   L                                                LE LPLP GLK+ +  ++ WV +++ + RK   S    +++     +E    QRKR R
Sbjct:  105 WVWDDLNKSSATLLSCDNRKVSFHMEYSCGTAAIRGTKELGEGQ-HFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKRFYPMVCSTAARSSMKVTRSCASATSLQYLCCHRLRQLRPDSGDTLEGLPLPPGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRCR 353          
The following BLAST results are available for this feature:
BLAST of TCONS_00073304 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SPSB32.997e-4837.20SPRY domain-containing SOCS box protein 3 OS=Homo ... [more]
back to top