Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00070210 ID=TCONS_00070210|Name=TCONS_00070210|organism=Clytia hemisphaerica|type=transcript|length=1368bpRun BLAST on NCBI transcript from alignment at scaffold_516:231870..236221+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00070210 ID=TCONS_00070210|Name=TCONS_00070210|organism=Clytia hemisphaerica|type=transcript|length=4352bp|location=Sequence derived from alignment at scaffold_516:231870..236221+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00070210 vs. Swiss-Prot (Human)
Match: ZMIZ1 (Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens GN=ZMIZ1 PE=1 SV=3) HSP 1 Score: 99.3673 bits (246), Expect = 4.457e-22 Identity = 52/83 (62.65%), Postives = 66/83 (79.52%), Query Frame = 2 Query: 2 DWCGDARAFQQSYEPNLMNCLTVVSKVASMQGYDLRLGYRLLAVCSAHKEKLSQKSSTILTQWSEELGRLLLLRHQNESNGKP 250 DWCGD RAFQ+ +E +LM CLTVVS+VA+ QG+DL LGYRLLAVC+A+++K + KS+ +L+ W EELGRLLLLRHQ P Sbjct: 37 DWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGYRLLAVCAANRDKFTPKSAALLSSWCEELGRLLLLRHQKSRQSDP 119 The following BLAST results are available for this feature:
BLAST of TCONS_00070210 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|