Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00048342 ID=TCONS_00048342|Name=TCONS_00048342|organism=Clytia hemisphaerica|type=transcript|length=831bpRun BLAST on NCBI transcript from alignment at scaffold_142:67010..72942- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00048342 ID=TCONS_00048342|Name=TCONS_00048342|organism=Clytia hemisphaerica|type=transcript|length=5933bp|location=Sequence derived from alignment at scaffold_142:67010..72942- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00048342 vs. Swiss-Prot (Human)
Match: MTG1 (Mitochondrial ribosome-associated GTPase 1 OS=Homo sapiens GN=MTG1 PE=1 SV=2) HSP 1 Score: 105.145 bits (261), Expect = 6.696e-26 Identity = 50/96 (52.08%), Postives = 74/96 (77.08%), Query Frame = 2 Query: 542 DDSSFKALVCGVPNVGKSSFINAARQRYLRKGGKATPVGRKPGVTRSVLTKIVISRNPKISILDTPGIISPYLKDPMTGIKLALTGTFPDHVIGEE 829 ++ + +V GVPNVGKSS IN+ R+++LRKG KAT VG +PG+TR+V++KI +S P + +LDTPG+++P ++ TG+KLAL GT DH++GEE Sbjct: 140 ENLEYCIMVIGVPNVGKSSLINSLRRQHLRKG-KATRVGGEPGITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEE 234 The following BLAST results are available for this feature:
BLAST of TCONS_00048342 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|