Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00044764 ID=TCONS_00044764|Name=TCONS_00044764|organism=Clytia hemisphaerica|type=transcript|length=622bpRun BLAST on NCBI transcript from alignment at sc0006173:345..966 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00044764 ID=TCONS_00044764|Name=TCONS_00044764|organism=Clytia hemisphaerica|type=transcript|length=622bp|location=Sequence derived from alignment at sc0006173:345..966 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00044764 vs. Swiss-Prot (Human)
Match: DYH8 (Dynein heavy chain 8, axonemal OS=Homo sapiens GN=DNAH8 PE=1 SV=2) HSP 1 Score: 98.5969 bits (244), Expect = 1.426e-30 Identity = 42/54 (77.78%), Postives = 49/54 (90.74%), Query Frame = -2 Query: 460 CRKLPRGLKDWQAYLDLKKQIDDFNESCPLLEMMANKAMKARHWKKIGEITRSP 621 CRKLP+GLKDWQA+LDLKK+IDDF+ESCPLLEMM NKAMK RHW +I E+T +P Sbjct: 1319 CRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTP 1372 HSP 2 Score: 51.6026 bits (122), Expect = 1.426e-30 Identity = 24/52 (46.15%), Postives = 36/52 (69.23%), Query Frame = -3 Query: 330 RLVRLPDHQFDVESETFLLKNIMEAPLLENKEDIEVSCVQGVQLRKL*GKLC 485 R+ L FDVES++F L+NIMEAPLL++K+DIE C+ ++ + + KL Sbjct: 1364 RISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLT 1415 The following BLAST results are available for this feature:
BLAST of TCONS_00044764 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|