Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00044515 ID=TCONS_00044515|Name=TCONS_00044515|organism=Clytia hemisphaerica|type=transcript|length=419bpRun BLAST on NCBI transcript from alignment at sc0005703:24..442 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00044515 ID=TCONS_00044515|Name=TCONS_00044515|organism=Clytia hemisphaerica|type=transcript|length=419bp|location=Sequence derived from alignment at sc0005703:24..442 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00044515 vs. Swiss-Prot (Human)
Match: MMSA (Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens GN=ALDH6A1 PE=1 SV=2) HSP 1 Score: 108.227 bits (269), Expect = 5.928e-28 Identity = 50/65 (76.92%), Postives = 59/65 (90.77%), Query Frame = -2 Query: 116 GAKNHGVVLSDANKESSLNQLVGAAFGAAGQRCMALSTAVFVGEAQKWIPDLVERTEKLVVNSGN 310 GAKNHGVV+ DANKE++LNQLVGAAFGAAGQRCMALSTAV VGEA+KW+P+LVE + L VN+G+ Sbjct: 285 GAKNHGVVMPDANKENTLNQLVGAAFGAAGQRCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGD 349 The following BLAST results are available for this feature:
BLAST of TCONS_00044515 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|