Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001943 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001943
Unique NameTCONS_00001943
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2480

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001943 ID=TCONS_00001943|Name=TCONS_00001943|organism=Clytia hemisphaerica|type=transcript|length=2480bp
atAGAAATAAATAATAGAAAAGTAATAGAGAGTACAAACTGTGGTTAATA
TTGCATTCAAAACTGCTCGGTTAATATTGCACCATGACTGTCTTTCCATC
AATGGGTGGTCGTGATGTGGAAGATCGGAATTTCTTAACATTCACCATGC
CTTCGAACATGCAATTAGAAGACAAAGGAGAGTTTAGCACGTGGTGTGAG
AGGATGATCTTCATCTTCGAAGATTTAAAATGGCTTCTTGCACTCCCTGT
CAATGAATTCTGGAATCAGGTCCTACATGATACAACCTTGACATCGAGTC
TTGAATCGTTTCTTCAAAATTCACCGAGATTTTATGATTTGAAGAATATC
CCAGAGACATGTAAGACAGCATTGGGTCGAGTCAGCAAATTATACCTTTT
GGTCATTCAGCGGATGAGTTTACATGATGAAGATCAGAACCAACCGATGC
CAACTGAAGTATTCGGTGATATGATTTACGAGAATTACATTTTCGATGCT
GCCAAATTGATAGACATTTGCGCCATCTTTCAACGGCCAAACAATGATGA
GATGCAAACGTTACTGGGTACTATTATGGAAAATGTTTTCGCATGCCAAC
CTAACTACTACAATGACTTATCAAGCGCTTTTGAAAGTATCATAGTGACC
ATTTCTAACATGGAAGAGAGGCTGCAACCACCAAAAGGAGGCAAACCTGT
CAATGGAAGAGAAGCAGTAGACATGTTGATGTTTTTATATGACATGACTT
GCTCACTATCTgcatttttgaatgttttcccTAAAGCTTCTTCATTGCTC
TTTCGTACTGATCTCATTTCAAGATTGGCGACTATTTACGAGACAATGGT
GCCCATGTTGATGAAATTAATTGAaatcaatcaaaagaaattcaaataTG
TTTGCGCATGTGTACAAAAAGAACTTCTTCAAATTGTCACCTTTTCCATC
AAAAACGGTTTTGTTGCAAGAACTAAAGATTTgtctaaagatgaaaatga
agaaaaaacagCATCATATATTTCGATCATGGATTCGTTGTCTCAGTACA
AACGATTTTTCGCCAGGTACTGCATGACCAGTAATGTTAGTGAAGACTTG
GAACAAATCAAGAAACTGGATGTCATTGATATCTCCAATTTACAATATTT
GAGTAACATGGCAGGTGTCGTCGTCCACGAAACTGATACTGATGACACTT
TGAAGCAACTTCGTGAATTACTGCCCAACAAATCCGAAGAATTCATTCGT
AACTGCATGTCTCAGTATGGTTCCAACGTTGAGGTCATTCTCAATAACGT
GATGGAAGGTAACATTGTCGACGAGACGCTCCAAAAACCTGTCAAGAAGA
AACCACAAAAACTAATTCCTGATAAGGAGTTTCTTGAAGACAATAAAGAA
CACGTGGAACGTGTTAAACTATCATTCTATAACCAATCAGAGGAAGGCAA
TGATTATGATGACTATGGTGCTAATTATGTTAATTATGATAATGTATACG
ATGACGAGTATGACGATACGTATGACTCACAAGACGTCGGCGCCGCTGAC
ACGGATAACGTAGATGAATTGTATAAAAGGAAATTCACGGTACCTCGTGT
TCTTCAACAAATGAATCGAAAATCAAGAAGAGGAGAACAAGAAGATGACG
AAGAAGAGAGTGAAGAAAGTGACGAAGAAGGGAGTGAAAATGATAACGAA
GATGGTGgcgaacaacaacaacaacaacaacaacaacaacagaatcAATA
CAAGGGTAATAACAATAGAAGAGGAGAATGGAAAGGTGGTGAAGTTTCAA
ATAATCGTGGTGGTGGCGCACGGGGAGGGCGTGGAGGTCAAGGCGGAAAC
AAACGAGGCGGTGGACGCGGAGGAAATAAAGGAAACAAGCAACAAAATAA
TGATAAATCGCAAGGAGGACAAAAAGAAGGAAGTAATCCTTCACAACGTG
GTGGCCAACGTGGCGGGAGAGGAGGTCGTGGTGGGCGTGGAAGAGGCGGG
AAACGTAATCATCGAGCCTTGGCTGATAAAAAGATGTCGAAGggaatgtt
ttgaaatcatcACCCATCGTCACTTATTATTGGAAAGCTAGTTATTATGA
ACAGAAATACTTGCTTGCATCAAATCTCTTCGATTAACATTAAGTCCAAT
AGATTCAGGTTACTATCTTGAAATATTATCTTGAAAAATAACACTTTACG
TACTAAGTATACATACATTAACATTATATTTTCCATTACCGTCTTTGTAA
AACAAACCAATAGATTTCGGAGATTaagataaaaattataaaaaacgaaT
CCTGGAAATTCCTTTTAAAACGAGAaacggaaaattttggaaagtgCATC
CCTTTTAACTGCAAAACTATACAAATTTGACGATTTATAAAAGGTATTTT
GAACTATTCTGATTCTAAATTTTGGCTCCTTGATGTTTTACAAACGGTCT
TCCATAAGAATTCTTTTGTATGTTCTTTAC
Run BLAST on NCBI

protein sequence of TCONS_00001943-protein

>TCONS_00001943-protein ID=TCONS_00001943-protein|Name=TCONS_00001943-protein|organism=Clytia hemisphaerica|type=polypeptide|length=656bp
MTVFPSMGGRDVEDRNFLTFTMPSNMQLEDKGEFSTWCERMIFIFEDLKW
LLALPVNEFWNQVLHDTTLTSSLESFLQNSPRFYDLKNIPETCKTALGRV
SKLYLLVIQRMSLHDEDQNQPMPTEVFGDMIYENYIFDAAKLIDICAIFQ
RPNNDEMQTLLGTIMENVFACQPNYYNDLSSAFESIIVTISNMEERLQPP
KGGKPVNGREAVDMLMFLYDMTCSLSAFLNVFPKASSLLFRTDLISRLAT
IYETMVPMLMKLIEINQKKFKYVCACVQKELLQIVTFSIKNGFVARTKDL
SKDENEEKTASYISIMDSLSQYKRFFARYCMTSNVSEDLEQIKKLDVIDI
SNLQYLSNMAGVVVHETDTDDTLKQLRELLPNKSEEFIRNCMSQYGSNVE
VILNNVMEGNIVDETLQKPVKKKPQKLIPDKEFLEDNKEHVERVKLSFYN
QSEEGNDYDDYGANYVNYDNVYDDEYDDTYDSQDVGAADTDNVDELYKRK
FTVPRVLQQMNRKSRRGEQEDDEEESEESDEEGSENDNEDGGEQQQQQQQ
QQQNQYKGNNNRRGEWKGGEVSNNRGGGARGGRGGQGGNKRGGGRGGNKG
NKQQNNDKSQGGQKEGSNPSQRGGQRGGRGGRGGRGRGGKRNHRALADKK
MSKGMF
Run BLAST on NCBI

transcript from alignment at sc0000012:581544..589069-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001943 ID=TCONS_00001943|Name=TCONS_00001943|organism=Clytia hemisphaerica|type=transcript|length=7526bp|location=Sequence derived from alignment at sc0000012:581544..589069- (Clytia hemisphaerica)
ATAGAAATAAATAATAGAAAAGTAATAGAGAGTACAAACTGTGGTTAATA TTGCATTCAAAACTGCTCGGTTAATATTGCACCATGACTGTCTTTCCATC AATGGTAAGATTTTTGGGTTTATGGTTTTATGTCGTGAACATATGTGAAC ATTGTGAACATTTTAGAAATATTCATAGGCTTAAAGTTCAAAAAGTAAAG AACCTTCGAAGGCTTACAAAAATTTGGATGTTCTTCATAAAAAACATGTA TTATTGTGTTTGTTAAATAACGCCCTGAAAATCATTTTATCCCATCATTT TCCAGGGTGGTCGTGATGTGGAAGATCGGAATTTCTTAACATTCACCATG CCTTCGAACATGCAATTAGAAGACAAAGGAGAGTTTAGCACGTGGTGTGA GAGGATGATCTTCATCTTCGAAGATTTAAAATGGCTTCTTGCACTCCCTG TCAATGAATTCTGGAATCAGGTTAGTCTTTCGGAATAGAAATTCTAATTT CATTAATAATCTACATAACGATTTTTAGGTCTAATACCATTTCAACAGCC TTGTGGTCTGGATGAAATATTTCATCCAAAAAGGCTACTTTTCCTTGATT TTCTATCCTTCTTGTTTCCTTTCTATTCTCCACATTATTACTTTTAGAGA ACTAATTTTGGCAATCATCACCAAAATCAAAATAATTGTTGCCTCACCAA AGTACTCCCCAAAATAAACTTTTTTGATTTAGTTGTAATATTTGAAATTT AATTCCTAATTTTTGCGAAAATGCTCATATTTTAGGCAAAAAAAGTTATT CGCCAAAATTAGTGCAAAACAAAAAAATGTCCTACAAACGTTTAAATAAA GTTTCATTCAGCAAGAGTATTCGCACATATTTTGCGACTTATTTAAATTC TATTCTTCTTCAGGTCCTACATGATACAACCTTGACATCGAGTCTTGAAT CGTTTCTTCAAAATTCACCGAGGTATAAAGAAGCTCTCGTTTACTAATAG ATAAACACCATAGAAGTACTGTAGTGTAGATTTCCTTATATTTTGACAAA CGTTTATTGGAGTTTCATGCTATATTATGGGAATCCCAAAGATTTTATTT AGATATTTAGTCTGAACAGTTGCGACTTGACCGTGGGATAAGTTTGGCGG TTCGTACCGACTATTTGATTAATTATTGAACTATATTTCTAGCAGACACA GAACGTTTTTCAAACGGTCATCTGACGCTTTGCTATCTCACCACTCTCTC TATACTAGATTTTATGATTTGAAGAATATCCCAGAGACATGTAAGACAGC ATTGGGTCGAGTCAGCAAATTATACCTTTTGGTCATTCAGCGGATGAGTT TACATGATGAAGATCAGGTTTGTCGATCGTTTTGAAGATTATCCCTTGAA AATGTTGATAAATTATAATAATATTTCCAATTTCGATTTTCAAGGGGAAT TGTCTTTTTATCGAATAAGAGAACATTGAATTAGAGAGCGACAACTGTAT TTTATAAAGCTTTAGTTTGTATCATCATTAAATACAAGGATCATTCCTGG ACCTGGAACAAACTCATTTATTGTTTTATGAATTTTTTTTGTAAGACCTT TAACGAATTTCGTGTTTATAGGTAAGTGGCACCTTTGACTAATAATAGAA TTTATTGGAGTTCAGGATATTAAAACTCTCATTTTTTCTAACTGTGCACT CTTTTTTGCTACAGTGTGGAATCCATGTTGGTTTAATGTAAGTAATTCCT TTGAGAGTGGTTTCTACACGATAGCAAAGTAGATTGCGAATGGATATATA TTTATTTTGTTTGAAATATTCATTTTCTGATTNTAGCAAAGTAGATTGCG AATGGATATATATTTATTTTGTTTGAAATATTTATTTTCTGATTAGAACC AACCGATGCCAACTGAAGTATTCGGTGATATGATTTACGAGAATTACATT TTCGATGCTGCCAAATTGATAGACATTTGCGCCATCTTTCAACGGCCAAA CAATGATGAGATGCAAACGTTCCTGGGTACTANTGATAGACATTTGCGCC ATCTTTCAACGGCCAAACAATGATGAGATGCAAACGTTACTGGGTACTAT TATGGAAAATGTTTTCGCATGCCAACCTAAGTATGTATTGTTAATTCGGA ATCTTTAGATTACGATAGTGGTGGTAGCATGAAGGTAAAGCTTCAAGCTA CAACGCGCAAGGTTGTGGTTTCGAACCCTATGTACCGGGTCATATCAAAG ATTCCCTAAATTGTACTCGATGTCTCTCTGCTTGATCCACAACAACTAAA GAGAAGATTAAGTAAGCTGAGAAATCCAAGGAAAGGAGTGGCGTCCTCCC CTACCTCCGGGTAAACAGCTGAAGAGAAACGGGAGCAATTTCGGCCCTCG ACTGTGGTCGCGAACAATACAACTTTAAACCGGAACCATTTTGCCCGGTT TCTTTTGCAGTTTCATAGAAAGGTAATAAGAAAGGTAATACTATATATTT TACCACAACCATATTTCAATTTTATAATTTCAGCTACTACAATGACTTAT CAAGCGCTTTTGAAAGTATCATAGTGACCATTTCTAACATGGAAGAGAGG CTGCAACCACCAAAAGGAGGCAAACCTGTCAATGGAAGAGAAGCAGTAGA CATGTTGATGTTTTTATATGACATGACTTGCTCACTATCTGCATTTTTGA ATGTTTTCCCTAAAGCTTCTTCATTGCTCTTTCGTACTGATCTCATTTCA AGGTAGGTATTTCCCATATTAGTCATATTGTATCGTACATACTACGCTTC TCTATGAATTGAACATTCACAGCGAACGCAAATTTGTTCGAGTTATGGAG AGTTTGGAGGACAGAGAGTCGTTCGAAGATTTATGAGCTGAAAAAAGACT GAAATAGTGCGTGTTTTCATTTAGATCTCAAGCCAAATGATACCGTTGCA GAATTTTAATTCTGATTTATCTATTCTGTTTCACCTTATAAAAGATTGGC GACTATTTACGAGACAATGGTGCCCATGTTGATGAAATTAATTGAAATCA ATCAAAAGAAATTCAAATATGTTTGCGCATGTGTACAAAAAGAACTTCTT CAAATTGTCACCTTTTCCATCAAAAACGGTTTTGTTGCAAGAACTAAAGA TTTGTAAGTCAGAATCTATTTACTTTTCATTTATGTCCACAAAATACAAG TTGTTTCGTTTTTTAACATTGATTTGTAGATGGACTGTCTTAAGAACTTT CTCCCCCGCTGGAAGATTTTCCCAAAAGTCATCTCTTAGACAGGTTACGG TAAAATCGAATCCGCATTTGGAAGTTTCACAGCAATTGCATCCCCATCGC AAACAAAACATTCAAAAACATCCCACCGTTAGTTTTGAGTTGAAAACATA GAATTTATATCAATTTCCATTGAAGTTTTAATCCCCACTAAATGAGAAAT ATCCACCGGGACACTGAGAAAACGATGGCAAATATCATTATATGTCATCT GATATCTGGATTAGTGTCCACTCACGCTAAAGCTTTAAAGAAGCGCTCGA TTTACCATTCAAGAGCAATGGCAGTCGATCTTTGGCGTGCCGCATCCTCA GTCGGGTTCAACTGTACTTGCATGTAAGCCTAAAATATTTCGGTTGGACC CGCGAATCCCCGAAAATGAGCGCTGGGGGTTCAGGGCTCCCGCTGCAAAT TTTGTGACGCGCTCTGGCGACTCTCTCTCCGACTTTCAAAGCTTAAGCGT TTCGGAAGAAAATTTCCACATCGGTTGCCAATCAAATGACAATGCAAAAA AGTAAAAACTAAGTATCATTATCGTTTACTATTAACCACAAATTTCATAC TTTATATTTTATTGTTTTGTTTCAAGGTCTAAAGATGAAAATGAAGAAAA AACAGCATCATATATTTCGATCATGGATTCGTTGTCTCAGTACAAACGGT AAGTCAATAGTCTCTAAGTATGATAATGCGTGCACAAATTTAACTCAGCT TTTGCTTGAAAAAAATAATTTTTGTCTTTCTTCATCAGATTTTTCGCCAG GTACTGCATGACCAGTAATGTTAGTGAAGACTTGGAACAAATCAAGAAAC TGGATGTCATTGATATCTCCAATTTACAATATTTGAGTAACATGGCAGGT GTCGTCGTCCACGAAACTGATACTGATGACGTAAGAATCTTTGATCTCGC GCAATAAAGTGTAAATAGCCGTAGTCATTCATCTCCGATGTAGGATTTAT AGCTACTTAATACTTACATATATGTCGCGCGGTCCGCGTAGTTTTCACAC AAACGGGGTTGTGATAAAAAAAGATGTCTCATCAATGAAAATACCTTAAA AAGGTGAAATGTTATCAACTTGTTTTGCATCATTGCTTTGCCAAATACAT GTCAGGTATTCGACTGTAGTAGACTGGAGGTTGATAGATGTGTTAAAGCA GTTAAGCTCTAGTTTAAACCGTCGAATTTCTGCCTTGCCTGCCTTCTTAG AGTAGGCGAAAAGTGGACAGAAGGTTGGCAGTTAAAATCTTTGCTTGGAA AAGATAAAAGAATTACATTGACGTCAAAAGAGGGCATTGCATTGTCTTTA AACAGCCAAATTTCTGTCTGTTTAACTCACAACTTAACCAGAGTTAACTT TTTACCCTGCATCTTTAGACTTTGAAGCAACTTCGTGAATTACTGCCCAA CAAATCCGAAGAATTCATTCGTAACTGCATGTCTCAGTATGGTTCCAACG TTGAGGTCATTCTCAATAACGTGATGGAAGGTAACATTGTCGACGAGACG CTCCAAAAACCTGTCAAGAAGAAACCACAAAAACTAATTCCTGATAAGGA GTTTCTTGAAGACAATAAAGAACACGTGGAACGTGTTAAACTATCATTCT ATAACCAATCAGAGGAAGGCAATGATTATGATGACTATGGTGCTAATTAT GTTAATTATGATAATGTATACGATGACGAGTATGACGATACGTATGACTC ACAAGACGTCGGCGCCGCTGACACGGATAACGTAGATGAATTGTATAAAA GGTATAGCATTTTTTTAAATCAGTCCAACGAGCAAGTATCTCAAGGGAAT CTCGAGACTAATTTGTTTGATCTACGGTTGTACTAAACGGTTTTTTTTCC ATTTCATCAAGATATTAACTTTTTGGGAACATTCTTACAGAATTCTTACT TTAGCATGCAAACCCAGTGTAAATCTACATTATTATCCATATAGCGGTCA TTAAGTAAGCCATTAAAGGTTCAATCGGCGGGCGGTATTGAAAGGTTCTG TGATTCAAATTGTCATACCCGCGCTGAGGAAACTAAAGCGCCAGGCTTCA GAGGTCTAAAATATCATTAACGGCCCGGGTATAGGGCTATAACATCATTT GCGGCCCGCTCGGAATTGGATTGAAGTCGTTGCATTGAAGCGAAGAGACT AAACTAACGTCAGAAAAAAACACTTTTTGGTCATTTGCGGCCCGCTCGGA ATTGGATTGAAGTCGTTGCATTGAAGCGAAGAGACTAAACTAACGTCAGA AAAAAACACTTTTTGGTCATTTGCGGCCCGCTCGCAAGGTGCTAAAAATT TGTTGAAGACATTGCATTGAAGCGAAAAAAAATCGGTTGACGCTAGAAAA AAATGTTGTTTGAATGTCCGATATGGATAATAATAGTAATAGTGTTAAGT TTTCGTTCGTTGATGTCATTAATTCTGCCCTTGCAATTTGATTATTAGCC CTCTAGTGCCATTTGCGCCCTCCGCTTCGCGTTGGGCCCAAATGACACTA TCGGGCGAATAATCAAACTACGCGAGCAGAAAATAACAACAACGACCTCA AATTGAACGCTTTTGTTATATTTAATTTATACGTCAACCAAGAATTTGGC ATTTTTGTAATACTTCTTAGCATTGCTGGGGAATTGCCAATTTACAGCTT AAAGCACCTTTAGTTGGCTTAGTCCAAAACATCGTAAGAGATTGAGTACA AAAATATAACGGTCGTAATGTAAAGGTTAAGCATTCGGCTATAGGGCGCA AAGTCATTGGTTCAATGCTGGTAGAATAATTGGAAAAGCAACCAATGGTT TTTGATGCTTCTGCAAGGGTAAGCAGAACGATCTAGGGTGTGAAAGAGTG GCGCCTTCGAGTAGCTAGTTATCAAGAAAATGGCTTCGGACATCGCCGAC TGCTGTCGCAAGTCTTACTTAAAATGATACGTTAATATTCTTTTCTCTTC ATTAATGACATCAGGAAATTCACGGTACCTCGTGTTCTTCAACAAATGAA TCGAAAATCAAGAAGAGGAGAACAAGAAGATGACGAAGAAGAGAGTGAAG AAAGTGACGAAGAAGGGAGTGAAAATGATAACGAAGATGGTGGCGAACAA CAACAACAACAACAACAACAACAACAGAATCAATACAAGGTTTGTCTTAC TTTACCGGGTGGTCCAAAAAAAAGTTTCCATGAATTTCAAATTTTGACGT AGAGTGCTCTAATTGTGCTATCGACTTTAATGGGTAGAACTGGACTTTTA CACCTATCAACCTATCTTACATCACAAGGGAAACGGGTTTAAGTTTATCA TGGTTCTTCTTGCAAAAATGTTTTAATGGTGGTCCAGAAATCGATACTTG GTTCTTTCGTACCTTTCTTTAATGTACGAACGCCGGTGCTATTGGCTAAT TTAGAAGTTTGCCGAATCTAATACAGTGTTTAAAATTAAAACTATTTCGT CCTGTTACTATCATTCATTTACATACAATTAATTTATGTATTTTTTTCAG GGTAATAACAATAGAAGAGGAGAATGGAAAGGTGGTGAAGTTTCAAATAA TCGTGGTGGTGGCGCACGGGGAGGGCGTGGAGGTCAAGGCGGAAACAAAC GAGGCGGTGGACGCGGAGGAAATAAAGGAAACAAGCAACAAAATAATGAT AAATCGCAAGGAGGACAAAAAGAAGGAAGTAATCCTTCACAACGTGGTGG CCAACGTGGCGGGAGAGGAGGTCGTGGTGGGCGTGGAAGAGGCGGGAAAC GTAATCATCGAGCCTTGGCTGATAAAAAGATGTCGAAGGGAATGTTTTGA AATCATCACCCATCGTCACTTATTATTGGAAAGCTAGTTATTATGAACAG AAATACTTGCTTGCATCAAATCTCTTCGATTAACATTAAGTCCAATAGAT TCAGGTTACTATCTTGAAATATTATCTTGAAAAATAACACTTTACGTACT AAGTATACATACATTAACATTATATTTTCCATTACCGTCTTTGTAAAACA AACCAATAGATTTCGGAGATTAAGATAAAAATTATAAAAAACGAATCCTG GAAATTCCTTTTAAAACGAGAAACGGAAAATTTTGGAAAGTGCATCCCTT TTAACTGCAAAACTATACAAATTTGACGATTTATAAAAGGTATTTTGAAC TATTCTGATTCTAAATTTTGGCTCCTTGATGTTTTACAAACGGTCTTCCA TAAGAATTCTTTTGTATGTTCTTTAC

Coding sequence (CDS) from alignment at sc0000012:581544..589069-

>TCONS_00001943 ID=TCONS_00001943|Name=TCONS_00001943|organism=Clytia hemisphaerica|type=CDS|length=25623bp|location=Sequence derived from alignment at sc0000012:581544..589069- (Clytia hemisphaerica)
GGTAATAACAATAGAAGAGGAGAATGGAAAGGTGGTGAAGTTTCAAATAA
TCGTGGTGGTGGCGCACGGGGAGGGCGTGGAGGTCAAGGCGGAAACAAAC
GAGGCGGTGGACGCGGAGGAAATAAAGGAAACAAGCAACAAAATAATGAT
AAATCGCAAGGAGGACAAAAAGAAGGAAGTAATCCTTCACAACGTGGTGG
CCAACGTGGCGGGAGAGGAGGTCGTGGTGGGCGTGGAAGAGGCGGGAAAC
GTAATCATCGAGCCTTGGCTGATAAAAAGATGTCGAAGGGAATGTTTTGA
GAAATTCACGGTACCTCGTGTTCTTCAACAAATGAATCGAAAATCAAGAA
GAGGAGAACAAGAAGATGACGAAGAAGAGAGTGAAGAAAGTGACGAAGAA
GGGAGTGAAAATGATAACGAAGATGGTGGCGAACAACAACAACAACAACA
ACAACAACAACAGAATCAATACAAGACTTTGAAGCAACTTCGTGAATTAC
TGCCCAACAAATCCGAAGAATTCATTCGTAACTGCATGTCTCAGTATGGT
TCCAACGTTGAGGTCATTCTCAATAACGTGATGGAAGGTAACATTGTCGA
CGAGACGCTCCAAAAACCTGTCAAGAAGAAACCACAAAAACTAATTCCTG
ATAAGGAGTTTCTTGAAGACAATAAAGAACACGTGGAACGTGTTAAACTA
TCATTCTATAACCAATCAGAGGAAGGCAATGATTATGATGACTATGGTGC
TAATTATGTTAATTATGATAATGTATACGATGACGAGTATGACGATACGT
ATGACTCACAAGACGTCGGCGCCGCTGACACGGATAACGTAGATGAATTG
TATAAAAGATTTTTCGCCAGGTACTGCATGACCAGTAATGTTAGTGAAGA
CTTGGAACAAATCAAGAAACTGGATGTCATTGATATCTCCAATTTACAAT
ATTTGAGTAACATGGCAGGTGTCGTCGTCCACGAAACTGATACTGATGAC
GTCTAAAGATGAAAATGAAGAAAAAACAGCATCATATATTTCGATCATGG
ATTCGTTGTCTCAGTACAAACGATTGGCGACTATTTACGAGACAATGGTG
CCCATGTTGATGAAATTAATTGAAATCAATCAAAAGAAATTCAAATATGT
TTGCGCATGTGTACAAAAAGAACTTCTTCAAATTGTCACCTTTTCCATCA
AAAACGGTTTTGTTGCAAGAACTAAAGATTTCTACTACAATGACTTATCA
AGCGCTTTTGAAAGTATCATAGTGACCATTTCTAACATGGAAGAGAGGCT
GCAACCACCAAAAGGAGGCAAACCTGTCAATGGAAGAGAAGCAGTAGACA
TGTTGATGTTTTTATATGACATGACTTGCTCACTATCTGCATTTTTGAAT
GTTTTCCCTAAAGCTTCTTCATTGCTCTTTCGTACTGATCTCATTTCAAG
ATTTGCGCCATCTTTCAACGGCCAAACAATGATGAGATGCAAACGTTACT
GGGTACTATTATGGAAAATGTTTTCGCATGCCAACCTAAAACCAACCGAT
GCCAACTGAAGTATTCGGTGATATGATTTACGAGAATTACATTTTCGATG
CTGCCAAATTGATAGACATTTTATGATTTGAAGAATATCCCAGAGACATG
TAAGACAGCATTGGGTCGAGTCAGCAAATTATACCTTTTGGTCATTCAGC
GGATGAGTTTACATGATGAAGATCAGGTCCTACATGATACAACCTTGACA
TCGAGTCTTGAATCGTTTCTTCAAAATTCACCGAGGGTGGTCGTGATGTG
GAAGATCGGAATTTCTTAACATTCACCATGCCTTCGAACATGCAATTAGA
AGACAAAGGAGAGTTTAGCACGTGGTGTGAGAGGATGATCTTCATCTTCG
AAGATTTAAAATGGCTTCTTGCACTCCCTGTCAATGAATTCTGGAATCAG
ATGACTGTCTTTCCATCAATGGGTAATAACAATAGAAGAGGAGAATGGAA
AGGTGGTGAAGTTTCAAATAATCGTGGTGGTGGCGCACGGGGAGGGCGTG
GAGGTCAAGGCGGAAACAAACGAGGCGGTGGACGCGGAGGAAATAAAGGA
AACAAGCAACAAAATAATGATAAATCGCAAGGAGGACAAAAAGAAGGAAG
TAATCCTTCACAACGTGGTGGCCAACGTGGCGGGAGAGGAGGTCGTGGTG
GGCGTGGAAGAGGCGGGAAACGTAATCATCGAGCCTTGGCTGATAAAAAG
ATGTCGAAGGGAATGTTTTGAGAAATTCACGGTACCTCGTGTTCTTCAAC
AAATGAATCGAAAATCAAGAAGAGGAGAACAAGAAGATGACGAAGAAGAG
AGTGAAGAAAGTGACGAAGAAGGGAGTGAAAATGATAACGAAGATGGTGG
CGAACAACAACAACAACAACAACAACAACAACAGAATCAATACAAGACTT
TGAAGCAACTTCGTGAATTACTGCCCAACAAATCCGAAGAATTCATTCGT
AACTGCATGTCTCAGTATGGTTCCAACGTTGAGGTCATTCTCAATAACGT
GATGGAAGGTAACATTGTCGACGAGACGCTCCAAAAACCTGTCAAGAAGA
AACCACAAAAACTAATTCCTGATAAGGAGTTTCTTGAAGACAATAAAGAA
CACGTGGAACGTGTTAAACTATCATTCTATAACCAATCAGAGGAAGGCAA
TGATTATGATGACTATGGTGCTAATTATGTTAATTATGATAATGTATACG
ATGACGAGTATGACGATACGTATGACTCACAAGACGTCGGCGCCGCTGAC
ACGGATAACGTAGATGAATTGTATAAAAGATTTTTCGCCAGGTACTGCAT
GACCAGTAATGTTAGTGAAGACTTGGAACAAATCAAGAAACTGGATGTCA
TTGATATCTCCAATTTACAATATTTGAGTAACATGGCAGGTGTCGTCGTC
CACGAAACTGATACTGATGACGTCTAAAGATGAAAATGAAGAAAAAACAG
CATCATATATTTCGATCATGGATTCGTTGTCTCAGTACAAACGATTGGCG
ACTATTTACGAGACAATGGTGCCCATGTTGATGAAATTAATTGAAATCAA
TCAAAAGAAATTCAAATATGTTTGCGCATGTGTACAAAAAGAACTTCTTC
AAATTGTCACCTTTTCCATCAAAAACGGTTTTGTTGCAAGAACTAAAGAT
TTCTACTACAATGACTTATCAAGCGCTTTTGAAAGTATCATAGTGACCAT
TTCTAACATGGAAGAGAGGCTGCAACCACCAAAAGGAGGCAAACCTGTCA
ATGGAAGAGAAGCAGTAGACATGTTGATGTTTTTATATGACATGACTTGC
TCACTATCTGCATTTTTGAATGTTTTCCCTAAAGCTTCTTCATTGCTCTT
TCGTACTGATCTCATTTCAAGATTTGCGCCATCTTTCAACGGCCAAACAA
TGATGAGATGCAAACGTTACTGGGTACTATTATGGAAAATGTTTTCGCAT
GCCAACCTAAAACCAACCGATGCCAACTGAAGTATTCGGTGATATGATTT
ACGAGAATTACATTTTCGATGCTGCCAAATTGATAGACATTTTATGATTT
GAAGAATATCCCAGAGACATGTAAGACAGCATTGGGTCGAGTCAGCAAAT
TATACCTTTTGGTCATTCAGCGGATGAGTTTACATGATGAAGATCAGGTC
CTACATGATACAACCTTGACATCGAGTCTTGAATCGTTTCTTCAAAATTC
ACCGAGGGTGGTCGTGATGTGGAAGATCGGAATTTCTTAACATTCACCAT
GCCTTCGAACATGCAATTAGAAGACAAAGGAGAGTTTAGCACGTGGTGTG
AGAGGATGATCTTCATCTTCGAAGATTTAAAATGGCTTCTTGCACTCCCT
GTCAATGAATTCTGGAATCAGATGACTGTCTTTCCATCAATGGGTAATAA
CAATAGAAGAGGAGAATGGAAAGGTGGTGAAGTTTCAAATAATCGTGGTG
GTGGCGCACGGGGAGGGCGTGGAGGTCAAGGCGGAAACAAACGAGGCGGT
GGACGCGGAGGAAATAAAGGAAACAAGCAACAAAATAATGATAAATCGCA
AGGAGGACAAAAAGAAGGAAGTAATCCTTCACAACGTGGTGGCCAACGTG
GCGGGAGAGGAGGTCGTGGTGGGCGTGGAAGAGGCGGGAAACGTAATCAT
CGAGCCTTGGCTGATAAAAAGATGTCGAAGGGAATGTTTTGAGAAATTCA
CGGTACCTCGTGTTCTTCAACAAATGAATCGAAAATCAAGAAGAGGAGAA
CAAGAAGATGACGAAGAAGAGAGTGAAGAAAGTGACGAAGAAGGGAGTGA
AAATGATAACGAAGATGGTGGCGAACAACAACAACAACAACAACAACAAC
AACAGAATCAATACAAGACTTTGAAGCAACTTCGTGAATTACTGCCCAAC
AAATCCGAAGAATTCATTCGTAACTGCATGTCTCAGTATGGTTCCAACGT
TGAGGTCATTCTCAATAACGTGATGGAAGGTAACATTGTCGACGAGACGC
TCCAAAAACCTGTCAAGAAGAAACCACAAAAACTAATTCCTGATAAGGAG
TTTCTTGAAGACAATAAAGAACACGTGGAACGTGTTAAACTATCATTCTA
TAACCAATCAGAGGAAGGCAATGATTATGATGACTATGGTGCTAATTATG
TTAATTATGATAATGTATACGATGACGAGTATGACGATACGTATGACTCA
CAAGACGTCGGCGCCGCTGACACGGATAACGTAGATGAATTGTATAAAAG
ATTTTTCGCCAGGTACTGCATGACCAGTAATGTTAGTGAAGACTTGGAAC
AAATCAAGAAACTGGATGTCATTGATATCTCCAATTTACAATATTTGAGT
AACATGGCAGGTGTCGTCGTCCACGAAACTGATACTGATGACGTCTAAAG
ATGAAAATGAAGAAAAAACAGCATCATATATTTCGATCATGGATTCGTTG
TCTCAGTACAAACGATTGGCGACTATTTACGAGACAATGGTGCCCATGTT
GATGAAATTAATTGAAATCAATCAAAAGAAATTCAAATATGTTTGCGCAT
GTGTACAAAAAGAACTTCTTCAAATTGTCACCTTTTCCATCAAAAACGGT
TTTGTTGCAAGAACTAAAGATTTCTACTACAATGACTTATCAAGCGCTTT
TGAAAGTATCATAGTGACCATTTCTAACATGGAAGAGAGGCTGCAACCAC
CAAAAGGAGGCAAACCTGTCAATGGAAGAGAAGCAGTAGACATGTTGATG
TTTTTATATGACATGACTTGCTCACTATCTGCATTTTTGAATGTTTTCCC
TAAAGCTTCTTCATTGCTCTTTCGTACTGATCTCATTTCAAGATTTGCGC
CATCTTTCAACGGCCAAACAATGATGAGATGCAAACGTTACTGGGTACTA
TTATGGAAAATGTTTTCGCATGCCAACCTAAAACCAACCGATGCCAACTG
AAGTATTCGGTGATATGATTTACGAGAATTACATTTTCGATGCTGCCAAA
TTGATAGACATTTTATGATTTGAAGAATATCCCAGAGACATGTAAGACAG
CATTGGGTCGAGTCAGCAAATTATACCTTTTGGTCATTCAGCGGATGAGT
TTACATGATGAAGATCAGGTCCTACATGATACAACCTTGACATCGAGTCT
TGAATCGTTTCTTCAAAATTCACCGAGGGTGGTCGTGATGTGGAAGATCG
GAATTTCTTAACATTCACCATGCCTTCGAACATGCAATTAGAAGACAAAG
GAGAGTTTAGCACGTGGTGTGAGAGGATGATCTTCATCTTCGAAGATTTA
AAATGGCTTCTTGCACTCCCTGTCAATGAATTCTGGAATCAGATGACTGT
CTTTCCATCAATGGGTAATAACAATAGAAGAGGAGAATGGAAAGGTGGTG
AAGTTTCAAATAATCGTGGTGGTGGCGCACGGGGAGGGCGTGGAGGTCAA
GGCGGAAACAAACGAGGCGGTGGACGCGGAGGAAATAAAGGAAACAAGCA
ACAAAATAATGATAAATCGCAAGGAGGACAAAAAGAAGGAAGTAATCCTT
CACAACGTGGTGGCCAACGTGGCGGGAGAGGAGGTCGTGGTGGGCGTGGA
AGAGGCGGGAAACGTAATCATCGAGCCTTGGCTGATAAAAAGATGTCGAA
GGGAATGTTTTGAGAAATTCACGGTACCTCGTGTTCTTCAACAAATGAAT
CGAAAATCAAGAAGAGGAGAACAAGAAGATGACGAAGAAGAGAGTGAAGA
AAGTGACGAAGAAGGGAGTGAAAATGATAACGAAGATGGTGGCGAACAAC
AACAACAACAACAACAACAACAACAGAATCAATACAAGACTTTGAAGCAA
CTTCGTGAATTACTGCCCAACAAATCCGAAGAATTCATTCGTAACTGCAT
GTCTCAGTATGGTTCCAACGTTGAGGTCATTCTCAATAACGTGATGGAAG
GTAACATTGTCGACGAGACGCTCCAAAAACCTGTCAAGAAGAAACCACAA
AAACTAATTCCTGATAAGGAGTTTCTTGAAGACAATAAAGAACACGTGGA
ACGTGTTAAACTATCATTCTATAACCAATCAGAGGAAGGCAATGATTATG
ATGACTATGGTGCTAATTATGTTAATTATGATAATGTATACGATGACGAG
TATGACGATACGTATGACTCACAAGACGTCGGCGCCGCTGACACGGATAA
CGTAGATGAATTGTATAAAAGATTTTTCGCCAGGTACTGCATGACCAGTA
ATGTTAGTGAAGACTTGGAACAAATCAAGAAACTGGATGTCATTGATATC
TCCAATTTACAATATTTGAGTAACATGGCAGGTGTCGTCGTCCACGAAAC
TGATACTGATGACGTCTAAAGATGAAAATGAAGAAAAAACAGCATCATAT
ATTTCGATCATGGATTCGTTGTCTCAGTACAAACGATTGGCGACTATTTA
CGAGACAATGGTGCCCATGTTGATGAAATTAATTGAAATCAATCAAAAGA
AATTCAAATATGTTTGCGCATGTGTACAAAAAGAACTTCTTCAAATTGTC
ACCTTTTCCATCAAAAACGGTTTTGTTGCAAGAACTAAAGATTTCTACTA
CAATGACTTATCAAGCGCTTTTGAAAGTATCATAGTGACCATTTCTAACA
TGGAAGAGAGGCTGCAACCACCAAAAGGAGGCAAACCTGTCAATGGAAGA
GAAGCAGTAGACATGTTGATGTTTTTATATGACATGACTTGCTCACTATC
TGCATTTTTGAATGTTTTCCCTAAAGCTTCTTCATTGCTCTTTCGTACTG
ATCTCATTTCAAGATTTGCGCCATCTTTCAACGGCCAAACAATGATGAGA
TGCAAACGTTACTGGGTACTATTATGGAAAATGTTTTCGCATGCCAACCT
AAAACCAACCGATGCCAACTGAAGTATTCGGTGATATGATTTACGAGAAT
TACATTTTCGATGCTGCCAAATTGATAGACATTTTATGATTTGAAGAATA
TCCCAGAGACATGTAAGACAGCATTGGGTCGAGTCAGCAAATTATACCTT
TTGGTCATTCAGCGGATGAGTTTACATGATGAAGATCAGGTCCTACATGA
TACAACCTTGACATCGAGTCTTGAATCGTTTCTTCAAAATTCACCGAGGG
TGGTCGTGATGTGGAAGATCGGAATTTCTTAACATTCACCATGCCTTCGA
ACATGCAATTAGAAGACAAAGGAGAGTTTAGCACGTGGTGTGAGAGGATG
ATCTTCATCTTCGAAGATTTAAAATGGCTTCTTGCACTCCCTGTCAATGA
ATTCTGGAATCAGATGACTGTCTTTCCATCAATGGGTAATAACAATAGAA
GAGGAGAATGGAAAGGTGGTGAAGTTTCAAATAATCGTGGTGGTGGCGCA
CGGGGAGGGCGTGGAGGTCAAGGCGGAAACAAACGAGGCGGTGGACGCGG
AGGAAATAAAGGAAACAAGCAACAAAATAATGATAAATCGCAAGGAGGAC
AAAAAGAAGGAAGTAATCCTTCACAACGTGGTGGCCAACGTGGCGGGAGA
GGAGGTCGTGGTGGGCGTGGAAGAGGCGGGAAACGTAATCATCGAGCCTT
GGCTGATAAAAAGATGTCGAAGGGAATGTTTTGAGAAATTCACGGTACCT
CGTGTTCTTCAACAAATGAATCGAAAATCAAGAAGAGGAGAACAAGAAGA
TGACGAAGAAGAGAGTGAAGAAAGTGACGAAGAAGGGAGTGAAAATGATA
ACGAAGATGGTGGCGAACAACAACAACAACAACAACAACAACAACAGAAT
CAATACAAGACTTTGAAGCAACTTCGTGAATTACTGCCCAACAAATCCGA
AGAATTCATTCGTAACTGCATGTCTCAGTATGGTTCCAACGTTGAGGTCA
TTCTCAATAACGTGATGGAAGGTAACATTGTCGACGAGACGCTCCAAAAA
CCTGTCAAGAAGAAACCACAAAAACTAATTCCTGATAAGGAGTTTCTTGA
AGACAATAAAGAACACGTGGAACGTGTTAAACTATCATTCTATAACCAAT
CAGAGGAAGGCAATGATTATGATGACTATGGTGCTAATTATGTTAATTAT
GATAATGTATACGATGACGAGTATGACGATACGTATGACTCACAAGACGT
CGGCGCCGCTGACACGGATAACGTAGATGAATTGTATAAAAGATTTTTCG
CCAGGTACTGCATGACCAGTAATGTTAGTGAAGACTTGGAACAAATCAAG
AAACTGGATGTCATTGATATCTCCAATTTACAATATTTGAGTAACATGGC
AGGTGTCGTCGTCCACGAAACTGATACTGATGACGTCTAAAGATGAAAAT
GAAGAAAAAACAGCATCATATATTTCGATCATGGATTCGTTGTCTCAGTA
CAAACGATTGGCGACTATTTACGAGACAATGGTGCCCATGTTGATGAAAT
TAATTGAAATCAATCAAAAGAAATTCAAATATGTTTGCGCATGTGTACAA
AAAGAACTTCTTCAAATTGTCACCTTTTCCATCAAAAACGGTTTTGTTGC
AAGAACTAAAGATTTCTACTACAATGACTTATCAAGCGCTTTTGAAAGTA
TCATAGTGACCATTTCTAACATGGAAGAGAGGCTGCAACCACCAAAAGGA
GGCAAACCTGTCAATGGAAGAGAAGCAGTAGACATGTTGATGTTTTTATA
TGACATGACTTGCTCACTATCTGCATTTTTGAATGTTTTCCCTAAAGCTT
CTTCATTGCTCTTTCGTACTGATCTCATTTCAAGATTTGCGCCATCTTTC
AACGGCCAAACAATGATGAGATGCAAACGTTACTGGGTACTATTATGGAA
AATGTTTTCGCATGCCAACCTAAAACCAACCGATGCCAACTGAAGTATTC
GGTGATATGATTTACGAGAATTACATTTTCGATGCTGCCAAATTGATAGA
CATTTTATGATTTGAAGAATATCCCAGAGACATGTAAGACAGCATTGGGT
CGAGTCAGCAAATTATACCTTTTGGTCATTCAGCGGATGAGTTTACATGA
TGAAGATCAGGTCCTACATGATACAACCTTGACATCGAGTCTTGAATCGT
TTCTTCAAAATTCACCGAGGGTGGTCGTGATGTGGAAGATCGGAATTTCT
TAACATTCACCATGCCTTCGAACATGCAATTAGAAGACAAAGGAGAGTTT
AGCACGTGGTGTGAGAGGATGATCTTCATCTTCGAAGATTTAAAATGGCT
TCTTGCACTCCCTGTCAATGAATTCTGGAATCAGATGACTGTCTTTCCAT
CAATGGGTAATAACAATAGAAGAGGAGAATGGAAAGGTGGTGAAGTTTCA
AATAATCGTGGTGGTGGCGCACGGGGAGGGCGTGGAGGTCAAGGCGGAAA
CAAACGAGGCGGTGGACGCGGAGGAAATAAAGGAAACAAGCAACAAAATA
ATGATAAATCGCAAGGAGGACAAAAAGAAGGAAGTAATCCTTCACAACGT
GGTGGCCAACGTGGCGGGAGAGGAGGTCGTGGTGGGCGTGGAAGAGGCGG
GAAACGTAATCATCGAGCCTTGGCTGATAAAAAGATGTCGAAGGGAATGT
TTTGAGAAATTCACGGTACCTCGTGTTCTTCAACAAATGAATCGAAAATC
AAGAAGAGGAGAACAAGAAGATGACGAAGAAGAGAGTGAAGAAAGTGACG
AAGAAGGGAGTGAAAATGATAACGAAGATGGTGGCGAACAACAACAACAA
CAACAACAACAACAACAGAATCAATACAAGACTTTGAAGCAACTTCGTGA
ATTACTGCCCAACAAATCCGAAGAATTCATTCGTAACTGCATGTCTCAGT
ATGGTTCCAACGTTGAGGTCATTCTCAATAACGTGATGGAAGGTAACATT
GTCGACGAGACGCTCCAAAAACCTGTCAAGAAGAAACCACAAAAACTAAT
TCCTGATAAGGAGTTTCTTGAAGACAATAAAGAACACGTGGAACGTGTTA
AACTATCATTCTATAACCAATCAGAGGAAGGCAATGATTATGATGACTAT
GGTGCTAATTATGTTAATTATGATAATGTATACGATGACGAGTATGACGA
TACGTATGACTCACAAGACGTCGGCGCCGCTGACACGGATAACGTAGATG
AATTGTATAAAAGATTTTTCGCCAGGTACTGCATGACCAGTAATGTTAGT
GAAGACTTGGAACAAATCAAGAAACTGGATGTCATTGATATCTCCAATTT
ACAATATTTGAGTAACATGGCAGGTGTCGTCGTCCACGAAACTGATACTG
ATGACGTCTAAAGATGAAAATGAAGAAAAAACAGCATCATATATTTCGAT
CATGGATTCGTTGTCTCAGTACAAACGATTGGCGACTATTTACGAGACAA
TGGTGCCCATGTTGATGAAATTAATTGAAATCAATCAAAAGAAATTCAAA
TATGTTTGCGCATGTGTACAAAAAGAACTTCTTCAAATTGTCACCTTTTC
CATCAAAAACGGTTTTGTTGCAAGAACTAAAGATTTCTACTACAATGACT
TATCAAGCGCTTTTGAAAGTATCATAGTGACCATTTCTAACATGGAAGAG
AGGCTGCAACCACCAAAAGGAGGCAAACCTGTCAATGGAAGAGAAGCAGT
AGACATGTTGATGTTTTTATATGACATGACTTGCTCACTATCTGCATTTT
TGAATGTTTTCCCTAAAGCTTCTTCATTGCTCTTTCGTACTGATCTCATT
TCAAGATTTGCGCCATCTTTCAACGGCCAAACAATGATGAGATGCAAACG
TTACTGGGTACTATTATGGAAAATGTTTTCGCATGCCAACCTAAAACCAA
CCGATGCCAACTGAAGTATTCGGTGATATGATTTACGAGAATTACATTTT
CGATGCTGCCAAATTGATAGACATTTTATGATTTGAAGAATATCCCAGAG
ACATGTAAGACAGCATTGGGTCGAGTCAGCAAATTATACCTTTTGGTCAT
TCAGCGGATGAGTTTACATGATGAAGATCAGGTCCTACATGATACAACCT
TGACATCGAGTCTTGAATCGTTTCTTCAAAATTCACCGAGGGTGGTCGTG
ATGTGGAAGATCGGAATTTCTTAACATTCACCATGCCTTCGAACATGCAA
TTAGAAGACAAAGGAGAGTTTAGCACGTGGTGTGAGAGGATGATCTTCAT
CTTCGAAGATTTAAAATGGCTTCTTGCACTCCCTGTCAATGAATTCTGGA
ATCAGATGACTGTCTTTCCATCAATGGGTAATAACAATAGAAGAGGAGAA
TGGAAAGGTGGTGAAGTTTCAAATAATCGTGGTGGTGGCGCACGGGGAGG
GCGTGGAGGTCAAGGCGGAAACAAACGAGGCGGTGGACGCGGAGGAAATA
AAGGAAACAAGCAACAAAATAATGATAAATCGCAAGGAGGACAAAAAGAA
GGAAGTAATCCTTCACAACGTGGTGGCCAACGTGGCGGGAGAGGAGGTCG
TGGTGGGCGTGGAAGAGGCGGGAAACGTAATCATCGAGCCTTGGCTGATA
AAAAGATGTCGAAGGGAATGTTTTGAGAAATTCACGGTACCTCGTGTTCT
TCAACAAATGAATCGAAAATCAAGAAGAGGAGAACAAGAAGATGACGAAG
AAGAGAGTGAAGAAAGTGACGAAGAAGGGAGTGAAAATGATAACGAAGAT
GGTGGCGAACAACAACAACAACAACAACAACAACAACAGAATCAATACAA
GACTTTGAAGCAACTTCGTGAATTACTGCCCAACAAATCCGAAGAATTCA
TTCGTAACTGCATGTCTCAGTATGGTTCCAACGTTGAGGTCATTCTCAAT
AACGTGATGGAAGGTAACATTGTCGACGAGACGCTCCAAAAACCTGTCAA
GAAGAAACCACAAAAACTAATTCCTGATAAGGAGTTTCTTGAAGACAATA
AAGAACACGTGGAACGTGTTAAACTATCATTCTATAACCAATCAGAGGAA
GGCAATGATTATGATGACTATGGTGCTAATTATGTTAATTATGATAATGT
ATACGATGACGAGTATGACGATACGTATGACTCACAAGACGTCGGCGCCG
CTGACACGGATAACGTAGATGAATTGTATAAAAGATTTTTCGCCAGGTAC
TGCATGACCAGTAATGTTAGTGAAGACTTGGAACAAATCAAGAAACTGGA
TGTCATTGATATCTCCAATTTACAATATTTGAGTAACATGGCAGGTGTCG
TCGTCCACGAAACTGATACTGATGACGTCTAAAGATGAAAATGAAGAAAA
AACAGCATCATATATTTCGATCATGGATTCGTTGTCTCAGTACAAACGAT
TGGCGACTATTTACGAGACAATGGTGCCCATGTTGATGAAATTAATTGAA
ATCAATCAAAAGAAATTCAAATATGTTTGCGCATGTGTACAAAAAGAACT
TCTTCAAATTGTCACCTTTTCCATCAAAAACGGTTTTGTTGCAAGAACTA
AAGATTTCTACTACAATGACTTATCAAGCGCTTTTGAAAGTATCATAGTG
ACCATTTCTAACATGGAAGAGAGGCTGCAACCACCAAAAGGAGGCAAACC
TGTCAATGGAAGAGAAGCAGTAGACATGTTGATGTTTTTATATGACATGA
CTTGCTCACTATCTGCATTTTTGAATGTTTTCCCTAAAGCTTCTTCATTG
CTCTTTCGTACTGATCTCATTTCAAGATTTGCGCCATCTTTCAACGGCCA
AACAATGATGAGATGCAAACGTTACTGGGTACTATTATGGAAAATGTTTT
CGCATGCCAACCTAAAACCAACCGATGCCAACTGAAGTATTCGGTGATAT
GATTTACGAGAATTACATTTTCGATGCTGCCAAATTGATAGACATTTTAT
GATTTGAAGAATATCCCAGAGACATGTAAGACAGCATTGGGTCGAGTCAG
CAAATTATACCTTTTGGTCATTCAGCGGATGAGTTTACATGATGAAGATC
AGGTCCTACATGATACAACCTTGACATCGAGTCTTGAATCGTTTCTTCAA
AATTCACCGAGGGTGGTCGTGATGTGGAAGATCGGAATTTCTTAACATTC
ACCATGCCTTCGAACATGCAATTAGAAGACAAAGGAGAGTTTAGCACGTG
GTGTGAGAGGATGATCTTCATCTTCGAAGATTTAAAATGGCTTCTTGCAC
TCCCTGTCAATGAATTCTGGAATCAGATGACTGTCTTTCCATCAATGGGT
AATAACAATAGAAGAGGAGAATGGAAAGGTGGTGAAGTTTCAAATAATCG
TGGTGGTGGCGCACGGGGAGGGCGTGGAGGTCAAGGCGGAAACAAACGAG
GCGGTGGACGCGGAGGAAATAAAGGAAACAAGCAACAAAATAATGATAAA
TCGCAAGGAGGACAAAAAGAAGGAAGTAATCCTTCACAACGTGGTGGCCA
ACGTGGCGGGAGAGGAGGTCGTGGTGGGCGTGGAAGAGGCGGGAAACGTA
ATCATCGAGCCTTGGCTGATAAAAAGATGTCGAAGGGAATGTTTTGAGAA
ATTCACGGTACCTCGTGTTCTTCAACAAATGAATCGAAAATCAAGAAGAG
GAGAACAAGAAGATGACGAAGAAGAGAGTGAAGAAAGTGACGAAGAAGGG
AGTGAAAATGATAACGAAGATGGTGGCGAACAACAACAACAACAACAACA
ACAACAACAGAATCAATACAAGACTTTGAAGCAACTTCGTGAATTACTGC
CCAACAAATCCGAAGAATTCATTCGTAACTGCATGTCTCAGTATGGTTCC
AACGTTGAGGTCATTCTCAATAACGTGATGGAAGGTAACATTGTCGACGA
GACGCTCCAAAAACCTGTCAAGAAGAAACCACAAAAACTAATTCCTGATA
AGGAGTTTCTTGAAGACAATAAAGAACACGTGGAACGTGTTAAACTATCA
TTCTATAACCAATCAGAGGAAGGCAATGATTATGATGACTATGGTGCTAA
TTATGTTAATTATGATAATGTATACGATGACGAGTATGACGATACGTATG
ACTCACAAGACGTCGGCGCCGCTGACACGGATAACGTAGATGAATTGTAT
AAAAGATTTTTCGCCAGGTACTGCATGACCAGTAATGTTAGTGAAGACTT
GGAACAAATCAAGAAACTGGATGTCATTGATATCTCCAATTTACAATATT
TGAGTAACATGGCAGGTGTCGTCGTCCACGAAACTGATACTGATGACGTC
TAAAGATGAAAATGAAGAAAAAACAGCATCATATATTTCGATCATGGATT
CGTTGTCTCAGTACAAACGATTGGCGACTATTTACGAGACAATGGTGCCC
ATGTTGATGAAATTAATTGAAATCAATCAAAAGAAATTCAAATATGTTTG
CGCATGTGTACAAAAAGAACTTCTTCAAATTGTCACCTTTTCCATCAAAA
ACGGTTTTGTTGCAAGAACTAAAGATTTCTACTACAATGACTTATCAAGC
GCTTTTGAAAGTATCATAGTGACCATTTCTAACATGGAAGAGAGGCTGCA
ACCACCAAAAGGAGGCAAACCTGTCAATGGAAGAGAAGCAGTAGACATGT
TGATGTTTTTATATGACATGACTTGCTCACTATCTGCATTTTTGAATGTT
TTCCCTAAAGCTTCTTCATTGCTCTTTCGTACTGATCTCATTTCAAGATT
TGCGCCATCTTTCAACGGCCAAACAATGATGAGATGCAAACGTTACTGGG
TACTATTATGGAAAATGTTTTCGCATGCCAACCTAAAACCAACCGATGCC
AACTGAAGTATTCGGTGATATGATTTACGAGAATTACATTTTCGATGCTG
CCAAATTGATAGACATTTTATGATTTGAAGAATATCCCAGAGACATGTAA
GACAGCATTGGGTCGAGTCAGCAAATTATACCTTTTGGTCATTCAGCGGA
TGAGTTTACATGATGAAGATCAGGTCCTACATGATACAACCTTGACATCG
AGTCTTGAATCGTTTCTTCAAAATTCACCGAGGGTGGTCGTGATGTGGAA
GATCGGAATTTCTTAACATTCACCATGCCTTCGAACATGCAATTAGAAGA
CAAAGGAGAGTTTAGCACGTGGTGTGAGAGGATGATCTTCATCTTCGAAG
ATTTAAAATGGCTTCTTGCACTCCCTGTCAATGAATTCTGGAATCAGATG
ACTGTCTTTCCATCAATGGGTAATAACAATAGAAGAGGAGAATGGAAAGG
TGGTGAAGTTTCAAATAATCGTGGTGGTGGCGCACGGGGAGGGCGTGGAG
GTCAAGGCGGAAACAAACGAGGCGGTGGACGCGGAGGAAATAAAGGAAAC
AAGCAACAAAATAATGATAAATCGCAAGGAGGACAAAAAGAAGGAAGTAA
TCCTTCACAACGTGGTGGCCAACGTGGCGGGAGAGGAGGTCGTGGTGGGC
GTGGAAGAGGCGGGAAACGTAATCATCGAGCCTTGGCTGATAAAAAGATG
TCGAAGGGAATGTTTTGAGAAATTCACGGTACCTCGTGTTCTTCAACAAA
TGAATCGAAAATCAAGAAGAGGAGAACAAGAAGATGACGAAGAAGAGAGT
GAAGAAAGTGACGAAGAAGGGAGTGAAAATGATAACGAAGATGGTGGCGA
ACAACAACAACAACAACAACAACAACAACAGAATCAATACAAGACTTTGA
AGCAACTTCGTGAATTACTGCCCAACAAATCCGAAGAATTCATTCGTAAC
TGCATGTCTCAGTATGGTTCCAACGTTGAGGTCATTCTCAATAACGTGAT
GGAAGGTAACATTGTCGACGAGACGCTCCAAAAACCTGTCAAGAAGAAAC
CACAAAAACTAATTCCTGATAAGGAGTTTCTTGAAGACAATAAAGAACAC
GTGGAACGTGTTAAACTATCATTCTATAACCAATCAGAGGAAGGCAATGA
TTATGATGACTATGGTGCTAATTATGTTAATTATGATAATGTATACGATG
ACGAGTATGACGATACGTATGACTCACAAGACGTCGGCGCCGCTGACACG
GATAACGTAGATGAATTGTATAAAAGATTTTTCGCCAGGTACTGCATGAC
CAGTAATGTTAGTGAAGACTTGGAACAAATCAAGAAACTGGATGTCATTG
ATATCTCCAATTTACAATATTTGAGTAACATGGCAGGTGTCGTCGTCCAC
GAAACTGATACTGATGACGTCTAAAGATGAAAATGAAGAAAAAACAGCAT
CATATATTTCGATCATGGATTCGTTGTCTCAGTACAAACGATTGGCGACT
ATTTACGAGACAATGGTGCCCATGTTGATGAAATTAATTGAAATCAATCA
AAAGAAATTCAAATATGTTTGCGCATGTGTACAAAAAGAACTTCTTCAAA
TTGTCACCTTTTCCATCAAAAACGGTTTTGTTGCAAGAACTAAAGATTTC
TACTACAATGACTTATCAAGCGCTTTTGAAAGTATCATAGTGACCATTTC
TAACATGGAAGAGAGGCTGCAACCACCAAAAGGAGGCAAACCTGTCAATG
GAAGAGAAGCAGTAGACATGTTGATGTTTTTATATGACATGACTTGCTCA
CTATCTGCATTTTTGAATGTTTTCCCTAAAGCTTCTTCATTGCTCTTTCG
TACTGATCTCATTTCAAGATTTGCGCCATCTTTCAACGGCCAAACAATGA
TGAGATGCAAACGTTACTGGGTACTATTATGGAAAATGTTTTCGCATGCC
AACCTAAAACCAACCGATGCCAACTGAAGTATTCGGTGATATGATTTACG
AGAATTACATTTTCGATGCTGCCAAATTGATAGACATTTTATGATTTGAA
GAATATCCCAGAGACATGTAAGACAGCATTGGGTCGAGTCAGCAAATTAT
ACCTTTTGGTCATTCAGCGGATGAGTTTACATGATGAAGATCAGGTCCTA
CATGATACAACCTTGACATCGAGTCTTGAATCGTTTCTTCAAAATTCACC
GAGGGTGGTCGTGATGTGGAAGATCGGAATTTCTTAACATTCACCATGCC
TTCGAACATGCAATTAGAAGACAAAGGAGAGTTTAGCACGTGGTGTGAGA
GGATGATCTTCATCTTCGAAGATTTAAAATGGCTTCTTGCACTCCCTGTC
AATGAATTCTGGAATCAGATGACTGTCTTTCCATCAATGGGTAATAACAA
TAGAAGAGGAGAATGGAAAGGTGGTGAAGTTTCAAATAATCGTGGTGGTG
GCGCACGGGGAGGGCGTGGAGGTCAAGGCGGAAACAAACGAGGCGGTGGA
CGCGGAGGAAATAAAGGAAACAAGCAACAAAATAATGATAAATCGCAAGG
AGGACAAAAAGAAGGAAGTAATCCTTCACAACGTGGTGGCCAACGTGGCG
GGAGAGGAGGTCGTGGTGGGCGTGGAAGAGGCGGGAAACGTAATCATCGA
GCCTTGGCTGATAAAAAGATGTCGAAGGGAATGTTTTGAGAAATTCACGG
TACCTCGTGTTCTTCAACAAATGAATCGAAAATCAAGAAGAGGAGAACAA
GAAGATGACGAAGAAGAGAGTGAAGAAAGTGACGAAGAAGGGAGTGAAAA
TGATAACGAAGATGGTGGCGAACAACAACAACAACAACAACAACAACAAC
AGAATCAATACAAGACTTTGAAGCAACTTCGTGAATTACTGCCCAACAAA
TCCGAAGAATTCATTCGTAACTGCATGTCTCAGTATGGTTCCAACGTTGA
GGTCATTCTCAATAACGTGATGGAAGGTAACATTGTCGACGAGACGCTCC
AAAAACCTGTCAAGAAGAAACCACAAAAACTAATTCCTGATAAGGAGTTT
CTTGAAGACAATAAAGAACACGTGGAACGTGTTAAACTATCATTCTATAA
CCAATCAGAGGAAGGCAATGATTATGATGACTATGGTGCTAATTATGTTA
ATTATGATAATGTATACGATGACGAGTATGACGATACGTATGACTCACAA
GACGTCGGCGCCGCTGACACGGATAACGTAGATGAATTGTATAAAAGATT
TTTCGCCAGGTACTGCATGACCAGTAATGTTAGTGAAGACTTGGAACAAA
TCAAGAAACTGGATGTCATTGATATCTCCAATTTACAATATTTGAGTAAC
ATGGCAGGTGTCGTCGTCCACGAAACTGATACTGATGACGTCTAAAGATG
AAAATGAAGAAAAAACAGCATCATATATTTCGATCATGGATTCGTTGTCT
CAGTACAAACGATTGGCGACTATTTACGAGACAATGGTGCCCATGTTGAT
GAAATTAATTGAAATCAATCAAAAGAAATTCAAATATGTTTGCGCATGTG
TACAAAAAGAACTTCTTCAAATTGTCACCTTTTCCATCAAAAACGGTTTT
GTTGCAAGAACTAAAGATTTCTACTACAATGACTTATCAAGCGCTTTTGA
AAGTATCATAGTGACCATTTCTAACATGGAAGAGAGGCTGCAACCACCAA
AAGGAGGCAAACCTGTCAATGGAAGAGAAGCAGTAGACATGTTGATGTTT
TTATATGACATGACTTGCTCACTATCTGCATTTTTGAATGTTTTCCCTAA
AGCTTCTTCATTGCTCTTTCGTACTGATCTCATTTCAAGATTTGCGCCAT
CTTTCAACGGCCAAACAATGATGAGATGCAAACGTTACTGGGTACTATTA
TGGAAAATGTTTTCGCATGCCAACCTAAAACCAACCGATGCCAACTGAAG
TATTCGGTGATATGATTTACGAGAATTACATTTTCGATGCTGCCAAATTG
ATAGACATTTTATGATTTGAAGAATATCCCAGAGACATGTAAGACAGCAT
TGGGTCGAGTCAGCAAATTATACCTTTTGGTCATTCAGCGGATGAGTTTA
CATGATGAAGATCAGGTCCTACATGATACAACCTTGACATCGAGTCTTGA
ATCGTTTCTTCAAAATTCACCGAGGGTGGTCGTGATGTGGAAGATCGGAA
TTTCTTAACATTCACCATGCCTTCGAACATGCAATTAGAAGACAAAGGAG
AGTTTAGCACGTGGTGTGAGAGGATGATCTTCATCTTCGAAGATTTAAAA
TGGCTTCTTGCACTCCCTGTCAATGAATTCTGGAATCAGATGACTGTCTT
TCCATCAATGGGTAATAACAATAGAAGAGGAGAATGGAAAGGTGGTGAAG
TTTCAAATAATCGTGGTGGTGGCGCACGGGGAGGGCGTGGAGGTCAAGGC
GGAAACAAACGAGGCGGTGGACGCGGAGGAAATAAAGGAAACAAGCAACA
AAATAATGATAAATCGCAAGGAGGACAAAAAGAAGGAAGTAATCCTTCAC
AACGTGGTGGCCAACGTGGCGGGAGAGGAGGTCGTGGTGGGCGTGGAAGA
GGCGGGAAACGTAATCATCGAGCCTTGGCTGATAAAAAGATGTCGAAGGG
AATGTTTTGAGAAATTCACGGTACCTCGTGTTCTTCAACAAATGAATCGA
AAATCAAGAAGAGGAGAACAAGAAGATGACGAAGAAGAGAGTGAAGAAAG
TGACGAAGAAGGGAGTGAAAATGATAACGAAGATGGTGGCGAACAACAAC
AACAACAACAACAACAACAACAGAATCAATACAAGACTTTGAAGCAACTT
CGTGAATTACTGCCCAACAAATCCGAAGAATTCATTCGTAACTGCATGTC
TCAGTATGGTTCCAACGTTGAGGTCATTCTCAATAACGTGATGGAAGGTA
ACATTGTCGACGAGACGCTCCAAAAACCTGTCAAGAAGAAACCACAAAAA
CTAATTCCTGATAAGGAGTTTCTTGAAGACAATAAAGAACACGTGGAACG
TGTTAAACTATCATTCTATAACCAATCAGAGGAAGGCAATGATTATGATG
ACTATGGTGCTAATTATGTTAATTATGATAATGTATACGATGACGAGTAT
GACGATACGTATGACTCACAAGACGTCGGCGCCGCTGACACGGATAACGT
AGATGAATTGTATAAAAGATTTTTCGCCAGGTACTGCATGACCAGTAATG
TTAGTGAAGACTTGGAACAAATCAAGAAACTGGATGTCATTGATATCTCC
AATTTACAATATTTGAGTAACATGGCAGGTGTCGTCGTCCACGAAACTGA
TACTGATGACGTCTAAAGATGAAAATGAAGAAAAAACAGCATCATATATT
TCGATCATGGATTCGTTGTCTCAGTACAAACGATTGGCGACTATTTACGA
GACAATGGTGCCCATGTTGATGAAATTAATTGAAATCAATCAAAAGAAAT
TCAAATATGTTTGCGCATGTGTACAAAAAGAACTTCTTCAAATTGTCACC
TTTTCCATCAAAAACGGTTTTGTTGCAAGAACTAAAGATTTCTACTACAA
TGACTTATCAAGCGCTTTTGAAAGTATCATAGTGACCATTTCTAACATGG
AAGAGAGGCTGCAACCACCAAAAGGAGGCAAACCTGTCAATGGAAGAGAA
GCAGTAGACATGTTGATGTTTTTATATGACATGACTTGCTCACTATCTGC
ATTTTTGAATGTTTTCCCTAAAGCTTCTTCATTGCTCTTTCGTACTGATC
TCATTTCAAGATTTGCGCCATCTTTCAACGGCCAAACAATGATGAGATGC
AAACGTTACTGGGTACTATTATGGAAAATGTTTTCGCATGCCAACCTAAA
ACCAACCGATGCCAACTGAAGTATTCGGTGATATGATTTACGAGAATTAC
ATTTTCGATGCTGCCAAATTGATAGACATTTTATGATTTGAAGAATATCC
CAGAGACATGTAAGACAGCATTGGGTCGAGTCAGCAAATTATACCTTTTG
GTCATTCAGCGGATGAGTTTACATGATGAAGATCAGGTCCTACATGATAC
AACCTTGACATCGAGTCTTGAATCGTTTCTTCAAAATTCACCGAGGGTGG
TCGTGATGTGGAAGATCGGAATTTCTTAACATTCACCATGCCTTCGAACA
TGCAATTAGAAGACAAAGGAGAGTTTAGCACGTGGTGTGAGAGGATGATC
TTCATCTTCGAAGATTTAAAATGGCTTCTTGCACTCCCTGTCAATGAATT
CTGGAATCAGATGACTGTCTTTCCATCAATGGGTAATAACAATAGAAGAG
GAGAATGGAAAGGTGGTGAAGTTTCAAATAATCGTGGTGGTGGCGCACGG
GGAGGGCGTGGAGGTCAAGGCGGAAACAAACGAGGCGGTGGACGCGGAGG
AAATAAAGGAAACAAGCAACAAAATAATGATAAATCGCAAGGAGGACAAA
AAGAAGGAAGTAATCCTTCACAACGTGGTGGCCAACGTGGCGGGAGAGGA
GGTCGTGGTGGGCGTGGAAGAGGCGGGAAACGTAATCATCGAGCCTTGGC
TGATAAAAAGATGTCGAAGGGAATGTTTTGAGAAATTCACGGTACCTCGT
GTTCTTCAACAAATGAATCGAAAATCAAGAAGAGGAGAACAAGAAGATGA
CGAAGAAGAGAGTGAAGAAAGTGACGAAGAAGGGAGTGAAAATGATAACG
AAGATGGTGGCGAACAACAACAACAACAACAACAACAACAACAGAATCAA
TACAAGACTTTGAAGCAACTTCGTGAATTACTGCCCAACAAATCCGAAGA
ATTCATTCGTAACTGCATGTCTCAGTATGGTTCCAACGTTGAGGTCATTC
TCAATAACGTGATGGAAGGTAACATTGTCGACGAGACGCTCCAAAAACCT
GTCAAGAAGAAACCACAAAAACTAATTCCTGATAAGGAGTTTCTTGAAGA
CAATAAAGAACACGTGGAACGTGTTAAACTATCATTCTATAACCAATCAG
AGGAAGGCAATGATTATGATGACTATGGTGCTAATTATGTTAATTATGAT
AATGTATACGATGACGAGTATGACGATACGTATGACTCACAAGACGTCGG
CGCCGCTGACACGGATAACGTAGATGAATTGTATAAAAGATTTTTCGCCA
GGTACTGCATGACCAGTAATGTTAGTGAAGACTTGGAACAAATCAAGAAA
CTGGATGTCATTGATATCTCCAATTTACAATATTTGAGTAACATGGCAGG
TGTCGTCGTCCACGAAACTGATACTGATGACGTCTAAAGATGAAAATGAA
GAAAAAACAGCATCATATATTTCGATCATGGATTCGTTGTCTCAGTACAA
ACGATTGGCGACTATTTACGAGACAATGGTGCCCATGTTGATGAAATTAA
TTGAAATCAATCAAAAGAAATTCAAATATGTTTGCGCATGTGTACAAAAA
GAACTTCTTCAAATTGTCACCTTTTCCATCAAAAACGGTTTTGTTGCAAG
AACTAAAGATTTCTACTACAATGACTTATCAAGCGCTTTTGAAAGTATCA
TAGTGACCATTTCTAACATGGAAGAGAGGCTGCAACCACCAAAAGGAGGC
AAACCTGTCAATGGAAGAGAAGCAGTAGACATGTTGATGTTTTTATATGA
CATGACTTGCTCACTATCTGCATTTTTGAATGTTTTCCCTAAAGCTTCTT
CATTGCTCTTTCGTACTGATCTCATTTCAAGATTTGCGCCATCTTTCAAC
GGCCAAACAATGATGAGATGCAAACGTTACTGGGTACTATTATGGAAAAT
GTTTTCGCATGCCAACCTAAAACCAACCGATGCCAACTGAAGTATTCGGT
GATATGATTTACGAGAATTACATTTTCGATGCTGCCAAATTGATAGACAT
TTTATGATTTGAAGAATATCCCAGAGACATGTAAGACAGCATTGGGTCGA
GTCAGCAAATTATACCTTTTGGTCATTCAGCGGATGAGTTTACATGATGA
AGATCAGGTCCTACATGATACAACCTTGACATCGAGTCTTGAATCGTTTC
TTCAAAATTCACCGAGGGTGGTCGTGATGTGGAAGATCGGAATTTCTTAA
CATTCACCATGCCTTCGAACATGCAATTAGAAGACAAAGGAGAGTTTAGC
ACGTGGTGTGAGAGGATGATCTTCATCTTCGAAGATTTAAAATGGCTTCT
TGCACTCCCTGTCAATGAATTCTGGAATCAGATGACTGTCTTTCCATCAA
TGGGTAATAACAATAGAAGAGGAGAATGGAAAGGTGGTGAAGTTTCAAAT
AATCGTGGTGGTGGCGCACGGGGAGGGCGTGGAGGTCAAGGCGGAAACAA
ACGAGGCGGTGGACGCGGAGGAAATAAAGGAAACAAGCAACAAAATAATG
ATAAATCGCAAGGAGGACAAAAAGAAGGAAGTAATCCTTCACAACGTGGT
GGCCAACGTGGCGGGAGAGGAGGTCGTGGTGGGCGTGGAAGAGGCGGGAA
ACGTAATCATCGAGCCTTGGCTGATAAAAAGATGTCGAAGGGAATGTTTT
GAGAAATTCACGGTACCTCGTGTTCTTCAACAAATGAATCGAAAATCAAG
AAGAGGAGAACAAGAAGATGACGAAGAAGAGAGTGAAGAAAGTGACGAAG
AAGGGAGTGAAAATGATAACGAAGATGGTGGCGAACAACAACAACAACAA
CAACAACAACAACAGAATCAATACAAGACTTTGAAGCAACTTCGTGAATT
ACTGCCCAACAAATCCGAAGAATTCATTCGTAACTGCATGTCTCAGTATG
GTTCCAACGTTGAGGTCATTCTCAATAACGTGATGGAAGGTAACATTGTC
GACGAGACGCTCCAAAAACCTGTCAAGAAGAAACCACAAAAACTAATTCC
TGATAAGGAGTTTCTTGAAGACAATAAAGAACACGTGGAACGTGTTAAAC
TATCATTCTATAACCAATCAGAGGAAGGCAATGATTATGATGACTATGGT
GCTAATTATGTTAATTATGATAATGTATACGATGACGAGTATGACGATAC
GTATGACTCACAAGACGTCGGCGCCGCTGACACGGATAACGTAGATGAAT
TGTATAAAAGATTTTTCGCCAGGTACTGCATGACCAGTAATGTTAGTGAA
GACTTGGAACAAATCAAGAAACTGGATGTCATTGATATCTCCAATTTACA
ATATTTGAGTAACATGGCAGGTGTCGTCGTCCACGAAACTGATACTGATG
ACGTCTAAAGATGAAAATGAAGAAAAAACAGCATCATATATTTCGATCAT
GGATTCGTTGTCTCAGTACAAACGATTGGCGACTATTTACGAGACAATGG
TGCCCATGTTGATGAAATTAATTGAAATCAATCAAAAGAAATTCAAATAT
GTTTGCGCATGTGTACAAAAAGAACTTCTTCAAATTGTCACCTTTTCCAT
CAAAAACGGTTTTGTTGCAAGAACTAAAGATTTCTACTACAATGACTTAT
CAAGCGCTTTTGAAAGTATCATAGTGACCATTTCTAACATGGAAGAGAGG
CTGCAACCACCAAAAGGAGGCAAACCTGTCAATGGAAGAGAAGCAGTAGA
CATGTTGATGTTTTTATATGACATGACTTGCTCACTATCTGCATTTTTGA
ATGTTTTCCCTAAAGCTTCTTCATTGCTCTTTCGTACTGATCTCATTTCA
AGATTTGCGCCATCTTTCAACGGCCAAACAATGATGAGATGCAAACGTTA
CTGGGTACTATTATGGAAAATGTTTTCGCATGCCAACCTAAAACCAACCG
ATGCCAACTGAAGTATTCGGTGATATGATTTACGAGAATTACATTTTCGA
TGCTGCCAAATTGATAGACATTTTATGATTTGAAGAATATCCCAGAGACA
TGTAAGACAGCATTGGGTCGAGTCAGCAAATTATACCTTTTGGTCATTCA
GCGGATGAGTTTACATGATGAAGATCAGGTCCTACATGATACAACCTTGA
CATCGAGTCTTGAATCGTTTCTTCAAAATTCACCGAGGGTGGTCGTGATG
TGGAAGATCGGAATTTCTTAACATTCACCATGCCTTCGAACATGCAATTA
GAAGACAAAGGAGAGTTTAGCACGTGGTGTGAGAGGATGATCTTCATCTT
CGAAGATTTAAAATGGCTTCTTGCACTCCCTGTCAATGAATTCTGGAATC
AGATGACTGTCTTTCCATCAATG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001005XLOC_001005Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001943-exon-sc0000012-1575043694:588966..589069TCONS_00001943-exon-sc0000012-1575043694:588966..589069Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:588600..588764TCONS_00001943-exon-sc0000012-1575043694:588600..588764Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:588098..588156TCONS_00001943-exon-sc0000012-1575043694:588098..588156Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:587703..587811TCONS_00001943-exon-sc0000012-1575043694:587703..587811Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:587096..587173TCONS_00001943-exon-sc0000012-1575043694:587096..587173Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:586940..587028TCONS_00001943-exon-sc0000012-1575043694:586940..587028Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:586318..586536TCONS_00001943-exon-sc0000012-1575043694:586318..586536Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:585917..586075TCONS_00001943-exon-sc0000012-1575043694:585917..586075Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:585122..585193TCONS_00001943-exon-sc0000012-1575043694:585122..585193Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:584890..585031TCONS_00001943-exon-sc0000012-1575043694:584890..585031Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:584019..584401TCONS_00001943-exon-sc0000012-1575043694:584019..584401Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:582631..582805TCONS_00001943-exon-sc0000012-1575043694:582631..582805Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1575043694:581544..582269TCONS_00001943-exon-sc0000012-1575043694:581544..582269Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:588966..589069TCONS_00001943-exon-sc0000012-1510915933:588966..589069Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:588600..588764TCONS_00001943-exon-sc0000012-1510915933:588600..588764Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:588098..588156TCONS_00001943-exon-sc0000012-1510915933:588098..588156Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:587703..587811TCONS_00001943-exon-sc0000012-1510915933:587703..587811Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:587096..587173TCONS_00001943-exon-sc0000012-1510915933:587096..587173Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:586940..587028TCONS_00001943-exon-sc0000012-1510915933:586940..587028Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:586318..586536TCONS_00001943-exon-sc0000012-1510915933:586318..586536Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:585917..586075TCONS_00001943-exon-sc0000012-1510915933:585917..586075Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:585122..585193TCONS_00001943-exon-sc0000012-1510915933:585122..585193Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:584890..585031TCONS_00001943-exon-sc0000012-1510915933:584890..585031Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:584019..584401TCONS_00001943-exon-sc0000012-1510915933:584019..584401Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:582631..582805TCONS_00001943-exon-sc0000012-1510915933:582631..582805Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1510915933:581544..582269TCONS_00001943-exon-sc0000012-1510915933:581544..582269Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:588966..589069TCONS_00001943-exon-sc0000012-1491911889:588966..589069Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:588600..588764TCONS_00001943-exon-sc0000012-1491911889:588600..588764Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:588098..588156TCONS_00001943-exon-sc0000012-1491911889:588098..588156Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:587703..587811TCONS_00001943-exon-sc0000012-1491911889:587703..587811Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:587096..587173TCONS_00001943-exon-sc0000012-1491911889:587096..587173Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:586940..587028TCONS_00001943-exon-sc0000012-1491911889:586940..587028Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:586318..586536TCONS_00001943-exon-sc0000012-1491911889:586318..586536Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:585917..586075TCONS_00001943-exon-sc0000012-1491911889:585917..586075Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:585122..585193TCONS_00001943-exon-sc0000012-1491911889:585122..585193Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:584890..585031TCONS_00001943-exon-sc0000012-1491911889:584890..585031Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:584019..584401TCONS_00001943-exon-sc0000012-1491911889:584019..584401Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:582631..582805TCONS_00001943-exon-sc0000012-1491911889:582631..582805Clytia hemisphaericaexon
TCONS_00001943-exon-sc0000012-1491911889:581544..582269TCONS_00001943-exon-sc0000012-1491911889:581544..582269Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001943-proteinTCONS_00001943-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:581544..589069 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
11.0761 10.8886 3.06693 9.23925e-05 16.8894 12.1297 13.5485 14.6287 11.6242 12.4091 13.1999 9.73835 6.61827 8.31894 7.29174 9.12896 8.32648 8.57043 4.56682 5.05689 5.24206 6.82954 12.9683 11.7249 12.1364 13.128 8.35418 9.28158 10.0568 11.6242
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003892CUE
IPR015943WD40/YVTN_repeat-like_dom
IPR009060UBA-like
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00001943 vs. Swiss-Prot (Human)
Match: ASCC2 (Activating signal cointegrator 1 complex subunit 2 OS=Homo sapiens GN=ASCC2 PE=1 SV=3)

HSP 1 Score: 146.747 bits (369), Expect = 3.090e-36
Identity = 105/380 (27.63%), Postives = 182/380 (47.89%), Query Frame = 3
Query:   96 PSMGGRDVEDRNFLTFTMPSNMQLEDKGEFSTWCERMIFIFEDLKWLLALPVNEFWNQVLHDTTLTSSLESFLQNSPRFYD--LKNIPETCKTALGRVSKLYLLVIQRMSLHDEDQNQPMPTEVFGDMIYENYIFDAAKLIDICAIFQRPNNDEMQTLLGTIMENVFACQPNYYNDLSSAFESIIVTISN------------------MEERLQPPKGGKPVNGREAVDMLMFLYDMTCSLSAFLNVFPKASSLLFRTDLISRLATIYETMVPMLMKLIEINQKKFKYVCACV-------QKELLQIVTFSIKNGFVARTKDLSKDENEEKTASYISIMDSLSQYKRFFARYCMTSNVSEDLEQIKKL-DVIDISNLQYL 1151
            P++      DR F+ +  P    +    E   + ER  F+  DL WLLALP ++FW QV+ D TL   L+S+L+  PR +D  + + PE       R+ +   L   RMS H E ++  +    FG+++Y N++FD  K++D+C +F + N+  +Q ++G    N+F  QP+YY+DL     +I+   SN                  +EER +      P+   E  D++++L D   +L AFL++FP A     + D   RLA+ YE  +P +   I+  + +   +   +       +K+L++I    +    +    + S D  +     ++ I  SL Q KRF   Y     V+ED+  +++   V+D +   Y+
Sbjct:   25 PALHPEQKADRYFVLYKPPPKDNIPALVE--EYLERATFVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLRYVPRKFDEGVASAPEVVDMQ-KRLHRSVFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMIG----NIFTQQPSYYSDLDETLPTILQVFSNILQHCGLQGDGANTTPQKLEERGRLTPSDMPL--LELKDIVLYLCDTCTTLWAFLDIFPLACQTFQKHDFCYRLASFYEAAIPEMESAIKKRRLEDSKLLGDLWQRLSHSRKKLMEIFHIILNQICLLPILESSCDNIQGFIEEFLQIFSSLLQEKRFLRDYDALFPVAEDISLLQQASSVLDETRTAYI 395          
The following BLAST results are available for this feature:
BLAST of TCONS_00001943 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ASCC23.090e-3627.63Activating signal cointegrator 1 complex subunit 2... [more]
back to top