Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001758 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001758
Unique NameTCONS_00001758
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4074

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001758 ID=TCONS_00001758|Name=TCONS_00001758|organism=Clytia hemisphaerica|type=transcript|length=4074bp
ttttATCAGCTGAAATTGATAGAAAGGTTTAAACTGTTTTTCTTTGCTTA
GTGGTCAGAGAGGAGTATTATTATTGTCTGTCTCTAAAGAAGGGTGTCAG
AATTAGATGAGGGATGTTGATATTAGACCAGACGGTACTGAACGATAAAT
TTGATTGTCGAAGTAATCAATAATGATGGAAGTAATCAAACAACCACTTA
TCGATTAACAATCGAATGTCAAGTACCAAAATTTCAGAAAAATTGTGAGT
ATTCGATCACTTTCTTAACAACCCTTCAAAGACTCCATAACCGTCCGAGT
ACTTTGATTGTTATTGATTACTTTCGATAACTTTGACAACTTTGCTAACC
AATTGATTACTTTGACGATAACCAATTACCGTCAACTGCTCTAACTTGGG
ACTATCTGACAAAAAATGGGACGGCAATCCGGCCACCATTTCACCGAACC
TCCAAAGTCATTTGATTTGAGTTAATAAATGGCATATATATAAAAAAATA
AAAGATTTCTCTTTTGCACCGAGTAGGCTTTTAAATCGAAATATGAAAAA
ATCCATAGTGGAACACACGCAAATGTCTGGAACGAAGAAGACCATATTAG
TGGCAAAACGATGGAGCGTTTAACGTCACTCCCGCTGCAAGTTACACACT
CGTTATTTGTTAACCCCATCAGGCACTAGACGGTTAGGCGTTCTGTAATT
CTCCAAACGACGTCCCGTCATTTGGAATGAAAACAAAAAGTTACAAAGGA
CACACTATCAGTGAAAGTTAGTATGGTGACATGTTAATAAACTTGGTAGA
ATTATCAAAACGAATTTGTTGTCAAAGACATTTAACAGTAAGTGAAAATA
CAGGCCAGATATCAAACAGTCCCACCATGTTTCGACCAATCATCCCAAGT
TAGAGCAGTTGATGGTATTATGATATATCTTTAAGAAAAACTAAAAAAAC
TGATCTAAAACCAAAGCACAAAAAGAAGCCCCTCCATAAAGATTGACCCC
CTTATTTCCCAGCCATTTTCCCTTGCCATTTTGTGTGGCCTTCGCCCTGG
GTTTCCTCAAGTGCTACTGGAAACATATTTGATAAAATTGAAGGCTGGAA
ATTACTGAGTACAATCGAAGGTATTCAATATGATTGAAGGTAATCGAAAT
GATTGAACAAATCGAAAATGGTCGAAGAAAATGCCATAATCTGGAGTCGA
GTGAGGCCAAGCCCAATTGATAGTTTGGTTCGTGTCCTCCGACCGACTCT
AAATTTTTGAGAAAAAGTGTTTCACTTTGAGTTGGAAAAATCAAAACAAA
TTTACCTCCTTTTCACATGATAACTACTATCTCTGCAGTTCTTTTCTAAC
TGACTGCTTTGATTCTTCTATAAACAACATCCAATTTGCGCACAGAAAAT
GTCCCGGTGTAGCAGAAACTCACAGCTGTATTCCTTTAAGCACACGCCGC
AAACGCCTTTATTTCCAACTAGAACCTATCTTGCGATCGCGTCGAGTGCC
GTTGTGGATCCGGGCTTTTGACTATTTTTTTACACTCGCGTTTGGATTCC
AGGATTGCACGATTGTTTGAGGAATTTCAAAAATAGAGGTTTTTGGTGGG
AAAATGAAAAAAAGGTTCCAATTTTAGCTACCGACCGACCGACCCATTTT
TCAGAGCTTCTAGGACACGAACCAAACAATCAATTGGGCCTGGCCTGAGT
ATTCAATCACCGATAAAATTGGATAGGGGGTGTCACTGACCACCTTCGAT
TATTATCGATCATTATTGATTACTTCCTTCACAATCGAACGTTCAATTAG
TACCGTAAGTTGGTCTAATATCGACCCAATAAAGACGACCCTAGGTATAG
CACCAACTTTTTCAGGCCACTCGCATGTTTTGAAATTGTTTTTATCCCAA
AAAAAAAGAATTAAAAAAAGGTTACAAAACTTTACCTCCTGTAACTAAGA
AATACGACAACAAAACGCATGAAAAAACAAACATTGCAGATGGAGCTTTG
ATCCATGTTGGCTTCTTAATCTTCAAATTTGGTGGCTCCAAAAATTGGAA
AGGTAATGTGAAAAAGAATTCCATTTTTGTGAACCTTCCACCAAACTTTT
GCCTTCGGATTGACGTGTTGACGTGATTGAGTCCCTGTAGCTACTGCACG
AATTTGGTTCGAAAACGAGGCTTGTTATCTAACTTCTGATTGGCTTAGAC
TTCGGCCGCTTCAAATTGATTGGTCAAAGGTCTCAAAAGCGGCGAATCTG
AACTTCTTGAATATCGAAAGGCCATCATTTTGAAAAGAGACTCAAAGTGT
GAACATCTCCAAACCGTCAAATGACTCAAATAATACTTCATTCACCCACC
TTCCATTTTCACTAACCTTCCACATACATTTTTTCACAATGAGTACCAAA
GAAGATAGTCAACGTTTAAATGAATacaaaagaatagaaaaaattggTGA
AGGCACCTACGGTATTGTTTACAAAGCTAAACACACCCCAACTGGGGAAT
TGGTTGCTTTAAAGAAGATTCGTCTGGAAACTGATGACGAAGGGTGCCCA
TCCACCGCTATTAGGGAAATTTCGATTCTCAAAGAATTAAGGAAATATCC
TTTTATTGTCCAACTCCAAGATGTTATTCACAGTGAATCAAAGTTGTATT
TGGTTTTCGAATTCTTGTTGATGGACTTGAAGAAATACATTGATACAGTC
CAAGGACCCATTGACCAAGCCTTAATCAAAAGTTACACATATCAAATTTG
TGCTGCTCTGGAATTTTGTCATGCAAGGAGGATCATCCATCGTGATTTGA
AGCCACAGAATCTTCTAATTGATTCCAAAGGATTGATCAAGATTGCTGAT
TTTGGTCTTGGGAGATCTTTTGGTGTTCCTATCAGGGCATTTACTCACGA
GGTTGTAACGTTATGGTACAGGTGTCCAGAAGTTTTGCTGGGTATGAAGA
GATATTCATGCGGTATTGACACTTGGAGTATTGGATGTATTTTCGCTGAA
ATGGTCACCAAGAAACCCATCTTCCAAGGAGATTCTGAAATTGATGAAAT
CTTCAAGATATTCCAAATTTTGGGTACACCAAGTAATGCTGAGTGGGAAG
GTGTTGAAGAATTACCCGATTACAAGAATGCATTCCCCAAATGGAAACCA
AAGAATTTAAAAGACCTTCTACCTGATATGGAGCCTGCAGGAATCGACCT
ACTTCAGaaaTTCCTGATTTACCAGCCAGCATCGAGAATGTCAGCAAGGA
AAGCATTAAAGCACCCATACTTTTTCGACTTTGATCCTTCCACATTGCCA
CAACCTCCAGAAGATATCCTGTAAGTGGTGTAATACATCAGAATACTTTA
AAATGGTGTCAATCGCACAACCAAAATGTAtcttttcaaatagttttaca
tGAAGCGATGGTAATGTAGTCATGTCGAGATGACGACCCAATCTAGCGTT
CTATGAGAGAAAGAGAAGGAAAGGAGATCAGGCATCAATAAAAACACTGT
AtatatgaaataaattaaatttgacaaaCAATATTCACACTTGCATGTAT
CATAAATGTAAAcattttcttgttttatttttcatggaaattgaTGCGAA
AATCATTACTATAATTACTAATGACATTTATATCAAGTGCTCTATTTTTG
TTCCGAATTATtatattttggatttttttttaaattgagatAATGAAATT
GAGATCCTATGATGATATTgaataagatttaataattcTTCAACCTCTTG
CCCTTCTTTTTGCGATGAacaaaaagttaattttggTAATGGTAACCTTT
TTAACGGGCCGACTTTTATCAcagattttttatgaaattttaaattcata
CTTATATTCTCACGGTACTAAATGTAATTAACtgactttattttttataa
taggATATAAAGAAAGTACTTAAAACGTAATTTgtccgacgaaaaaaaat
tcatttataATTGTTTTTGCAAATGTAACTTACTTTGATCacataaaatt
tcgcgggtGTTAAATTTtgagtcccaatggaaatttggaaaggccttGTA
TGGAGTCTTGTGCGGGAATGGGAA
Run BLAST on NCBI

protein sequence of TCONS_00001758-protein

>TCONS_00001758-protein ID=TCONS_00001758-protein|Name=TCONS_00001758-protein|organism=Clytia hemisphaerica|type=polypeptide|length=311bp
MSTKEDSQRLNEYKRIEKIGEGTYGIVYKAKHTPTGELVALKKIRLETDD
EGCPSTAIREISILKELRKYPFIVQLQDVIHSESKLYLVFEFLLMDLKKY
IDTVQGPIDQALIKSYTYQICAALEFCHARRIIHRDLKPQNLLIDSKGLI
KIADFGLGRSFGVPIRAFTHEVVTLWYRCPEVLLGMKRYSCGIDTWSIGC
IFAEMVTKKPIFQGDSEIDEIFKIFQILGTPSNAEWEGVEELPDYKNAFP
KWKPKNLKDLLPDMEPAGIDLLQKFLIYQPASRMSARKALKHPYFFDFDP
STLPQPPEDIL
Run BLAST on NCBI

transcript from alignment at sc0000012:4757..15166+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001758 ID=TCONS_00001758|Name=TCONS_00001758|organism=Clytia hemisphaerica|type=transcript|length=10410bp|location=Sequence derived from alignment at sc0000012:4757..15166+ (Clytia hemisphaerica)
ttttATCAGCTGAAATTGATAGAAAGGTTTAAACTGTTTTTCTTTGCTTA GTGGTCAGAGAGGAGTATTATTATTGTCTGTCTCTAAAGAAGGGTGTCAG AATTAGATGAGGGATGTTGATATTAGACCAGACGGTACTGAACGATAAAT TTGATTGTCGAAGTAATCAATAATGATGGAAGTAATCAAACAACCACTTA TCGATTAACAATCGAATGTCAAGTACCAAAATTTCAGAAAAATTGTGAGT ATTCGATCACTTTCTTAACAACCCTTCAAAGACTCCATAACCGTCCGAGT ACTTTGATTGTTATTGATTACTTTCGATAACTTTGACAACTTTGCTAACC AATTGATTACTTTGACGATAACCAATTACCGTCAACTGCTCTAACTTGGG ACTATCTGACAAAAAATGGGACGGCAATCCGGCCACCATTTCACCGAACC TCCAAAGTCATTTGATTTGAGTTAATAAATGGCATATATATAAAAAAATA AAAGATTTCTCTTTTGCACCGAGTAGGCTTTTAAATCGAAATATGAAAAA ATCCATAGTGGAACACACGCAAATGTCTGGAACGAAGAAGACCATATTAG TGGCAAAACGATGGAGCGTTTAACGTCACTCCCGCTGCAAGTTACACACT CGTTATTTGTTAACCCCATCAGGCACTAGACGGTTAGGCGTTCTGTAATT CTCCAAACGACGTCCCGTCATTTGGAATGAAAACAAAAAGTTACAAAGGA CACACTATCAGTGAAAGTTAGTATGGTGACATGTTAATAAACTTGGTAGA ATTATCAAAACGAATTTGTTGTCAAAGACATTTAACAGTAAGTGAAAATA CAGGCCAGATATCAAACAGTCCCACCATGTTTCGACCAATCATCCCAAGT TAGAGCAGTTGATGGTATTATGATATATCTTTAAGAAAAACTAAAAAAAC TGATCTAAAACCAAAGCACAAAAAGAAGCCCCTCCATAAAGATTGACCCC CTTATTTCCCAGCCATTTTCCCTTGCCATTTTGTGTGGCCTTCGCCCTGG GTTTCCTCAAGTGCTACTGGAAACATATTTGATAAAATTGAAGGCTGGAA ATTACTGAGTACAATCGAAGGTATTCAATATGATTGAAGGTAATCGAAAT GATTGAACAAATCGAAAATGGTCGAAGAAAATGCCATAATCTGGAGTCGA GTGAGGCCAAGCCCAATTGATAGTTTGGTTCGTGTCCTCCGACCGACTCT AAATTTTTGAGAAAAAGTGTTTCACTTTGAGTTGGAAAAATCAAAACAAA TTTACCTCCTTTTCACATGATAACTACTATCTCTGCAGTTCTTTTCTAAC TGACTGCTTTGATTCTTCTATAAACAACATCCAATTTGCGCACAGAAAAT GTCCCGGTGTAGCAGAAACTCACAGCTGTATTCCTTTAAGCACACGCCGC AAACGCCTTTATTTCCAACTAGAACCTATCTTGCGATCGCGTCGAGTGCC GTTGTGGATCCGGGCTTTTGACTATTTTTTTACACTCGCGTTTGGATTCC AGGATTGCACGATTGTTTGAGGAATTTCAAAAATAGAGGTTTTTGGTGGG AAAATGAAAAAAAGGTTCCAATTTTAGCTACCGACCGACCGACCCATTTT TCAGAGCTTCTAGGACACGAACCAAACAATCAATTGGGCCTGGCCTGAGT ATTCAATCACCGATAAAATTGGATAGGGGGTGTCACTGACCACCTTCGAT TATTATCGATCATTATTGATTACTTCCTTCACAATCGAACGTTCAATTAG TACCGTAAGTTGGTCTAATATCGACCCAATAAAGACGACCCTAGGTATAG CACCAACTTTTTCAGGCCACTCGCATGTTTTGAAATTGTTTTTATCCCAA AAAAAAAGAATTAAAAAAAGGTTACAAAACTTTACCTCCTGTAACTAAGA AATACGACAACAAAACGCATGAAAAAACAAACATTGCAGATGGAGCTTTG ATCCATGTTGGCTTCTTAATCTTCAAATTTGGTGGCTCCAAAAATTGGAA AGGTAATGTGAAAAAGAATTCCATTTTTGTGAACCTTCCACCAAACTTTT GCCTTCGGATTGACGTGTTGACGTGATTGAGTCCCTGTAGCTACTGCACG AATTTGGTTCGAAAACGAGGCTTGTTATCTAACTTCTGATTGGCTTAGAC TTCGGCCGCTTCAAATTGATTGGTCAAAGGTCTCAAAAGCGGCGAATCTG AACTTCTTGAATATCGAAAGGCCATCATTTTGAAAAGAGACTCAAAGTGT GAACATCTCCAAACCGTCAAATGGTATGAGTGTTTTCTGTAGACAGTTCA TGTTTGTTTGTCGATAAAGTCTGTTTGATTCGCCCCTCTGCTCATGTATA TCCACAGTGACCCAATACTATGCATAATCTGCTTCTTCTGAGTTTAAATC TCGTAGAGTTTATTCACTAAAAAAGTCCATCTGCCTGAACAGGAAAGGAC TTCGGTGTTTGTTTGTAAACTCTGGCGATTCCAACATCAGTCTAAATCTT TCTGTGTTCAGGGATTTGAATTAATACCTTTTCTTGAAGCCTACATATGA CCCAGTTTGCAAAGTGTGGCACATTTGCTTGNTTGTTTGTAAACTCTGGC AATTCCAACATCAGTCTAAATCTTTCTGTGTTCAGGGATTTGAATTAATA CCTTTTCTTGAAGCCTACATATGACCCAGTTTGCAAAGTGTGGCACATTT GCTTGAGATATTGAGTGCACAACTTGTAAAAAATCGAGTGCAGGTGCAAA ATATATCTAAGGTTTTCAGGTGTAGTGTTCAGCTATCTTTTCCTCTAGTG CAGccaatttgagcaattttttgcctttttgggcaaatttccgAGCTATA GATGCACCTTGTCCGGATTTATATCAGGTGCGTTCTTCGAGTGCGGAACG AATTTTTCTTCGAGTGCAGCCTTcttgccatactctgcaaactggcaTAT GACTGATAACTAaaagaatgtttttatttgCATGCGACACAGACTCTACT CTTTTTAAAACCTTACCTAAATTAAGCAGTAGTGATAATTGACACACTTT TCAAGAAGGGAAGGGAGGTCTGTTTTTAAAGATTTCCTAGGGGCTACCAT GCTATATTTATTAGACAGCGTGGTATAGTGTAGTCATTGagcttggttgc tgcacagacGACTGAGGTTTGATttccactcgcagcggttcacttgacaa gtgaatgaaccttcgcccaggtcaacccatgccatgctATGtgccagacc cccgcgctcgataggatcgatcatcggaacggctcgatgacggatcgata tgtgatcgatggattacttatcgatccggataggagatcgatagaggatc gataccgtaacttggtctaatgtcgacatccctcctctaaattcgacacc cttttctagagctgaaaaattaaaaaaaggtcgaaattattttatttgct tagtggtaagggaggataaatcttttttcaatcaccgaTTCCGACTTTCA TACtattcctatctttaaagaagggtgtcgaaattagaagacggatgtcg agattagaccaacttacggtactcaagatttttttaagcttatgattatt tatcgatctatcatcgatctatcatcgatcttttatcgatcttatcgacc ctaacAACTctatcgagtatatcgattcgtcatcaatGCATAATCGATGa tgaatcgattaacgatcgaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCTT Ccctcgatctcctatccggatcgataagtaatccatcgatcacatatcga tccgtcatcgagccgttccgatgatcgatcctatcgagcgcgggggtctg gtatGTGAGAGGAATTGGGTAGTCGGACGGCGCGCTCATTGAAAGTGTCT ATATTTgcaaaaataggcctcaaagcctcctgcaactcaaccaaatagaa atagaaatattctAGAAAGGCCAACGTCAAAAAAGGCCATTTTTCTGTCC ATAAAATCAGCTATTCCAAACCAAAGTTTCATTGATTCAAATCGGCACAA GAAGAGACAGCATCTCTGATAAACCAACTTAGCAGGATGCCCTTCTTTAA GAGGTAGTattcaactttataagaaaggCTTTTTATGACATTAAACATGA TCATTTCTGCTATTTTGGTATTCTCCAAATGGTAATGGTTTTTGAAATag cccatttttctaagaaaatagCAGAAAGAATATGTTTTAGTAACACCTTG CTTAGCTCCAAAGCTTTTTGTGTTCCTGTTTGAACCTGCGCATAATTTCc tgtttgttttcatttcatGGATGAAAATCATTCAGCCTTGCTTAATTTAC ACACTTTTGTTTTGACACATCTCAGTCTGGGATGGGAAATCCTCTTAATT GCGGCTTAACTTTGATTATTATTAGCTATcatagaatttagaaaatagcT AGAATTTTTTAAGGGTGCAATTACATACTTATCACTATTTGAATGGGTGT TAAAGCATGTAATTTCATCCTGAACTAGTCTATCATTTAAAAAGACTTGA TTAGCTCCCGACCGCTTCATTGAAATCAGAAAGTCTTGGACTATCTTACT AAAAAATTTTGAGGCCCGCAATCTTCGAGTTagcaatttcaattttgact cTGGTTGAGTTCTTAGCTGACTGGttttatgtaaaaaatcaaattcaagt TAATTCTTTCTAGCTCGAAAatccatttttgaaaattaaaaatcaagtta gattcacgtgacgtcataatttgcacttttatgacgtcataatttagctg ACTCGAAGATTCCAGGCCTGAAAATTTATCCTACAAAACAATCATGTTAA AGCTTTAGCTCATTTGACCATGTATTaacccaatttttttaaatcggaAC CCTCTAATCTGTtcaagcaatttcaaccggggcaggatcataagcgtgca attgcacatGGGCATAAATTTTAACTGTGTAATTGCGGGCTTACAGCCTT GGGAGTCAAGTGTGTAATTAAGAGGTTTACAACAATACAACATATCTAAA TTCTTTACAGCTCACTAAGTCAGTTTTATCACAAAACATTTCTAAGAGGC TTCTTGTCTTGTTGAGCCTCCAAGCAAATATTTGGCTTATGTCTATAGAG TGGAAAATACATCGTGTATTTATAAAAACACATTGTGAAAACTAAAAGAT TGTCTATTCGATCCCTAGGCCTTCACAAAAGAAAGTTTTCTGTTACAGTA GTCATGCCAAGAatgggatcagacccctttccgcactattcCCTGCCTCT GAAAATTACCTTGCTCCATCTAAGCATAAAAAGTTGTAATTTGACGAATT TTTAACGATTATCATTTTCCCTaaggtagttctaattcaagaataaaTGG AAGGGATTTAAGTAAACTGTATGTAATATTGCtggttgaaataaatgaaa gaaaaactaaGCATATCTATACACCCAAAATGACATTGTGATATTTGcga tgttagcttttttaggcttatgcaAATTAATGGATAGAAATAGACATGGA ATACACCTCCCTGAGCTTAGGGGGGCTAAACCATTTGCatttttccattt atttttcaaaaaatactgggggTCAGCTTGCTAGGGGGGCTGAGTGTGTG TAATAGAATTGggggcagagctgataggttcaagatattttaaattatgt taaaaatctatgctgcggggaaggttttatccctcttgaaaaaaaatttc tttgatattttgttttgtgaagGTGGGGGGGTATGTTTCTAGAATTCAGC TTGGGCTATTTTCCTTTGCCCtctgaaaaatgctgggggctggacccctc tgcacactatgttaAATGGTGAATACCACTAAAATAATAACCATATTCTT GATCCATCACAACATCTCATAAAACCAGTTTTTTTCAATGTTGATATGGT TTTGGTGAGTCCCCCAATGTCTACAATCAAATTATTCCATCCCgctcatt tttccccaccctggcttcaaaaaaCTCCCCCTCCCCCCTCGTAAGTCCCT TTGGTTTCAAAACCCATTCCCTGGAATCCAGGGGGAGAACGTTATAATGT CTGTTAAAAAATTTGGTCCTTTGCTCATAACTTGCAAGATAATTACCAAT CATGCCTACAATGGTTTTTCATCCACTCCTACAAAAATGTGTTTTTGAAG TATGAAAAGTGACTTTAAATGCAATATTTGCACAGGCGATAGAATCAGAT AGAATAACAGCTtaaaaatttcccaaatttcTTGATTctggaaaatattt atttgatttctGTTGCTTTTTATTATTCTGGAAACTGAGTCAAATACTCA AAAATAGATACTTTACTCTCTGATTTttgtttaattatttttaacacTTC TAATGTTTTCATGTCTTGCTAAAAATGGGTCTAGTAATTTTATACATTAG GACTAAGCTAGAGAACTTCTGTTATTGTCAAAAAATtactttactttcat tttctagACTCAAATAATACTTCATTCACCCACCTTCCATTTTCACTAAC CTTCCACATACATTTTTTCACAATGAGTACCAAAGAAGATAGTCAACGTT TAAATGAATacaaaagaatagaaaaaattggTGAAGGTAAGCTCTCCTTG ACAGAACTATATATTCAAAGCAATTCACTAGTCTCTTAAACTTGAATccc ttaaaaaaatttgaacaaataaaTTTATTGGTTTTGCTTTATTTTGTAAT GAACCTTTCCACCTCAAACTCCAGAACTCAAATTTTACTCAAAAGGTTTT CTTGCTCCTTAACAGAATATCAATGCAGTAACTGGAATTCTCCTTAGATA GAACAATTCATTTTTATCATCCTCAAGTGATGAAACCTGATTGTTAACAT TTGActtatataaatataaatattattttataGGCACCTACGGTATTGTT TACAAAGCTAAACACACCCCAACTGGGGAATTGGTTGCTTTAAAGAAGAT TCGTCTGGAAACTGATGACGAAGGGTGCCCATCCACCGCTATTAGGGAAA TTTCGATTCTCAAAGAATTAAGGAAATATCCTTTTATTGTCCAGTAAGTT ATTACTGACTACATTAGTATTTACTAGTCTATCTATGGACTATATTTTAC ACTTTTGAAAAGAAGTGACCAAGCCCTCCCAAAAAATGTATGATGGGCAG CAGAGAAGGAAATACAATTAAAAAGCAAGCATCTTTTAGAAGTAGAGTTA CTGCACACTGATTAAGGTGTCCATTTCTCCTGTAATAAGCTTTGCCATAt tttaaatttatgcaaaccGCTTTGAAGTGTTTTTGTGCTAATTCAATTAC AGGtctctgttaattaatcattgAGGTAGGTTTTGATTGTCAGATTGGTC TCTTTTTTTGTAATAGACTCCAAGATGTTATTCACAGTGAATCAAAGTTG TATTTGGTTTTCGAATTCTTGTTGATGGACTTGAAGAAATACATTGATAC AGTCCAAGGACCCATTGACCAAGCCTTAATCAAAGTAAGTCAATGCTCAA GTTAAGTCAGACCAACCTTTGAAACCTTGACAAGGAATGTTTTCCGACCC CAACAAAAAAACTCCAGAAATTTACTTTCCTAATTCAGCTTTCCTTGAAC AGAAAAAACCTTGTATTTTAGCAACTGAGATACATAACTTCCACCAAATG ATGGGGGTCAACTATGAAGTCCCTGAGGTCAAACATTTACATGGCATTGA ATAGACCATATCGGCTTtccaaattctccccgaatgatttcccatgatgc attgcgcaaaaaattcacggaaagtcaatatcgtctgtgaatttttttgc gcaatgcatcatgggtaatcattcggggagaattcggaaagccgatatcg tctattgtaaTAAGAAATACAGTCATCTCTATGAAAGTTTTAGCCATGTT AATGAAGAGGAAACCAGGCTTATTTTATGCTGCCTATCAATAACTTCTTT TGAGCTAGAATAAATCCAATTGATTTACTAATACATTGTATTTTAGAGTT ACACATATCAAATTTGTGCTGCTCTGGAATTTTGTCATGCAAGGAGGATC ATCCATCGTGATTTGAAGCCACAGAATCTTCTAATTGATTCCAAAGGATT GATCAAGATTGCTGATTTTGGTCTTGGGAGATCTTTTGGTGTTCCTATCA GGGCATTTACTCACGAGGTTTGTCCCTATCTGAGTAGACATAATATACTT TAAGTACTAATCTTTTAGAGCCTTTTAAAAGGGTCACACttaaaaactga aagaaaacatCTATGCTTGAGGAAACGTATAGTTATGATGAAGTTTAAGT TAAGCATTGATAGATTGCCTCATTAAATTCTTGATTAGTTGTATAGGTGT AAGAAGTTAGCTTGATTGAGAGATATAGAAATCATTACATTGAAATTTAC TGATAGAATAGACTTTGATTTTCTTGTCTTTCTCCTCAGGTTGTAACGTT ATGGTACAGGTGTCCAGAAGTTTTGCTGGGTATGAAGAGATATTCATGCG GTATTGACACTTGGAGTATTGGATGTATTTTCGCTGAAATGGTCACCAAG AAACCCATCTTCCAAGGAGATTCTGAAATTGATGAAATCTTCAAGATATT CCAGTAAGCAAGCAATATAAATGCTAAAAACATCTTTTGATTCCAATTTC AAAAACCCAAAATCATTTATTTTGTCCTGTAAATAAAATTTATAGTTCAA TATCTCCATGTtggctcaaaaacattttatggTAATCTAACCTGAGCACT TTGCTCCAACACCTACACAAGTAACAAGTAACTAATCAATACTCAAAAAc ggtgttttattttttatctccACAGAATTTTGGGTACACCAAGTAATGCT GAGTGGGAAGGTGTTGAAGAATTACCCGATTACAAGAATGCATTCCCCAA ATGGAAACCAAAGAATTTAAAAGACCTTCTACCTGATATGGAGCCTGCAG GAATCGACCTACTTCAGGTAAGAAGTTTGAGCAGCATGGTTGCttatgtt tgaaaaaaatttcacaaaataaattctatAATTTGAACCCAGTCTCAATC TCTGTGGGAGGTCAAACGTATGCAAAAAACGTGCCAACAAACCTCTTCGG CTCTTTCATAACAACCAAAGTTGAAACTGTTAACGTTTCTTGAGAAATTG ATAAATGTTTTGAAGAATGacgaaagaaaaagaatttcttCCCTCCTCCT TTCTTGCATTAACGTAATAACTCAAAgttctttcttcttttagaaaTTCC TGATTTACCAGCCAGCATCGAGAATGTCAGCAAGGAAAGCATTAAAGCAC CCATACTTTTTCGACTTTGATCCTTCCACATTGCCACAACCTCCAGAAGA TATCCTGTAAGTGGTGTAATACATCAGAATACTTTAAAATGGTGTCAATC GCACAACCAAAATGTAtcttttcaaatagttttacatGAAGCGATGGTAA TGTAGTCATGTCGAGATGACGACCCAATCTAGCGTTCTATGAGAGAAAGA GAAGGAAAGGAGATCAGGCATCAATAAAAACACTGTAtatatgaaataaa ttaaatttgacaaaCAATATTCACACTTGCATGTATCATAAATGTAAAca ttttcttgttttatttttcatggaaattgaTGCGAAAATCATTACTATAA TTACTAATGACATTTATATCAAGTGCTCTATTTTTGTTCCGAATTATtat attttggatttttttttaaattgagatAATGAAATTGAGATCCTATGATG ATATTgaataagatttaataattcTTCAACCTCTTGCCCTTCTTTTTGCG ATGAacaaaaagttaattttggTAATGGTAACCTTTTTAACGGGCCGACT TTTATCAcagattttttatgaaattttaaattcataCTTATATTCTCACG GTACTAAATGTAATTAACtgactttattttttataataggATATAAAGAA AGTACTTAAAACGTAATTTgtccgacgaaaaaaaattcatttataATTGT TTTTGCAAATGTAACTTACTTTGATCacataaaatttcgcgggtGTTAAA TTTtgagtcccaatggaaatttggaaaggccttGTATGGAGTCTTGTGCG GGAATGGGAA

Coding sequence (CDS) from alignment at sc0000012:4757..15166+

>TCONS_00001758 ID=TCONS_00001758|Name=TCONS_00001758|organism=Clytia hemisphaerica|type=CDS|length=6552bp|location=Sequence derived from alignment at sc0000012:4757..15166+ (Clytia hemisphaerica)
ATGAGTACCAAAGAAGATAGTCAACGTTTAAATGAATacaaaagaataga
aaaaattggTGAAGGCACCTACGGTATTGTTTACAAAGCTAAACACACCC
CAACTGGGGAATTGGTTGCTTTAAAGAAGATTCGTCTGGAAACTGATGAC
GAAGGGTGCCCATCCACCGCTATTAGGGAAATTTCGATTCTCAAAGAATT
AAGGAAATATCCTTTTATTGTCCAACTCCAAGATGTTATTCACAGTGAAT
CAAAGTTGTATTTGGTTTTCGAATTCTTGTTGATGGACTTGAAGAAATAC
ATTGATACAGTCCAAGGACCCATTGACCAAGCCTTAATCAAAAGTTACAC
ATATCAAATTTGTGCTGCTCTGGAATTTTGTCATGCAAGGAGGATCATCC
ATCGTGATTTGAAGCCACAGAATCTTCTAATTGATTCCAAAGGATTGATC
AAGATTGCTGATTTTGGTCTTGGGAGATCTTTTGGTGTTCCTATCAGGGC
ATTTACTCACGAGGTTGTAACGTTATGGTACAGGTGTCCAGAAGTTTTGC
TGGGTATGAAGAGATATTCATGCGGTATTGACACTTGGAGTATTGGATGT
ATTTTCGCTGAAATGGTCACCAAGAAACCCATCTTCCAAGGAGATTCTGA
AATTGATGAAATCTTCAAGATATTCCAAATTTTGGGTACACCAAGTAATG
CTGAGTGGGAAGGTGTTGAAGAATTACCCGATTACAAGAATGCATTCCCC
AAATGGAAACCAAAGAATTTAAAAGACCTTCTACCTGATATGGAGCCTGC
AGGAATCGACCTACTTCAGaaaTTCCTGATTTACCAGCCAGCATCGAGAA
TGTCAGCAAGGAAAGCATTAAAGCACCCATACTTTTTCGACTTTGATCCT
TCCACATTGCCACAACCTCCAGAAGATATCCTGTAAATGAGTACCAAAGA
AGATAGTCAACGTTTAAATGAATacaaaagaatagaaaaaattggTGAAG
GCACCTACGGTATTGTTTACAAAGCTAAACACACCCCAACTGGGGAATTG
GTTGCTTTAAAGAAGATTCGTCTGGAAACTGATGACGAAGGGTGCCCATC
CACCGCTATTAGGGAAATTTCGATTCTCAAAGAATTAAGGAAATATCCTT
TTATTGTCCAACTCCAAGATGTTATTCACAGTGAATCAAAGTTGTATTTG
GTTTTCGAATTCTTGTTGATGGACTTGAAGAAATACATTGATACAGTCCA
AGGACCCATTGACCAAGCCTTAATCAAAAGTTACACATATCAAATTTGTG
CTGCTCTGGAATTTTGTCATGCAAGGAGGATCATCCATCGTGATTTGAAG
CCACAGAATCTTCTAATTGATTCCAAAGGATTGATCAAGATTGCTGATTT
TGGTCTTGGGAGATCTTTTGGTGTTCCTATCAGGGCATTTACTCACGAGG
TTGTAACGTTATGGTACAGGTGTCCAGAAGTTTTGCTGGGTATGAAGAGA
TATTCATGCGGTATTGACACTTGGAGTATTGGATGTATTTTCGCTGAAAT
GGTCACCAAGAAACCCATCTTCCAAGGAGATTCTGAAATTGATGAAATCT
TCAAGATATTCCAAATTTTGGGTACACCAAGTAATGCTGAGTGGGAAGGT
GTTGAAGAATTACCCGATTACAAGAATGCATTCCCCAAATGGAAACCAAA
GAATTTAAAAGACCTTCTACCTGATATGGAGCCTGCAGGAATCGACCTAC
TTCAGaaaTTCCTGATTTACCAGCCAGCATCGAGAATGTCAGCAAGGAAA
GCATTAAAGCACCCATACTTTTTCGACTTTGATCCTTCCACATTGCCACA
ACCTCCAGAAGATATCCTGTAAATGAGTACCAAAGAAGATAGTCAACGTT
TAAATGAATacaaaagaatagaaaaaattggTGAAGGCACCTACGGTATT
GTTTACAAAGCTAAACACACCCCAACTGGGGAATTGGTTGCTTTAAAGAA
GATTCGTCTGGAAACTGATGACGAAGGGTGCCCATCCACCGCTATTAGGG
AAATTTCGATTCTCAAAGAATTAAGGAAATATCCTTTTATTGTCCAACTC
CAAGATGTTATTCACAGTGAATCAAAGTTGTATTTGGTTTTCGAATTCTT
GTTGATGGACTTGAAGAAATACATTGATACAGTCCAAGGACCCATTGACC
AAGCCTTAATCAAAAGTTACACATATCAAATTTGTGCTGCTCTGGAATTT
TGTCATGCAAGGAGGATCATCCATCGTGATTTGAAGCCACAGAATCTTCT
AATTGATTCCAAAGGATTGATCAAGATTGCTGATTTTGGTCTTGGGAGAT
CTTTTGGTGTTCCTATCAGGGCATTTACTCACGAGGTTGTAACGTTATGG
TACAGGTGTCCAGAAGTTTTGCTGGGTATGAAGAGATATTCATGCGGTAT
TGACACTTGGAGTATTGGATGTATTTTCGCTGAAATGGTCACCAAGAAAC
CCATCTTCCAAGGAGATTCTGAAATTGATGAAATCTTCAAGATATTCCAA
ATTTTGGGTACACCAAGTAATGCTGAGTGGGAAGGTGTTGAAGAATTACC
CGATTACAAGAATGCATTCCCCAAATGGAAACCAAAGAATTTAAAAGACC
TTCTACCTGATATGGAGCCTGCAGGAATCGACCTACTTCAGaaaTTCCTG
ATTTACCAGCCAGCATCGAGAATGTCAGCAAGGAAAGCATTAAAGCACCC
ATACTTTTTCGACTTTGATCCTTCCACATTGCCACAACCTCCAGAAGATA
TCCTGTAAATGAGTACCAAAGAAGATAGTCAACGTTTAAATGAATacaaa
agaatagaaaaaattggTGAAGGCACCTACGGTATTGTTTACAAAGCTAA
ACACACCCCAACTGGGGAATTGGTTGCTTTAAAGAAGATTCGTCTGGAAA
CTGATGACGAAGGGTGCCCATCCACCGCTATTAGGGAAATTTCGATTCTC
AAAGAATTAAGGAAATATCCTTTTATTGTCCAACTCCAAGATGTTATTCA
CAGTGAATCAAAGTTGTATTTGGTTTTCGAATTCTTGTTGATGGACTTGA
AGAAATACATTGATACAGTCCAAGGACCCATTGACCAAGCCTTAATCAAA
AGTTACACATATCAAATTTGTGCTGCTCTGGAATTTTGTCATGCAAGGAG
GATCATCCATCGTGATTTGAAGCCACAGAATCTTCTAATTGATTCCAAAG
GATTGATCAAGATTGCTGATTTTGGTCTTGGGAGATCTTTTGGTGTTCCT
ATCAGGGCATTTACTCACGAGGTTGTAACGTTATGGTACAGGTGTCCAGA
AGTTTTGCTGGGTATGAAGAGATATTCATGCGGTATTGACACTTGGAGTA
TTGGATGTATTTTCGCTGAAATGGTCACCAAGAAACCCATCTTCCAAGGA
GATTCTGAAATTGATGAAATCTTCAAGATATTCCAAATTTTGGGTACACC
AAGTAATGCTGAGTGGGAAGGTGTTGAAGAATTACCCGATTACAAGAATG
CATTCCCCAAATGGAAACCAAAGAATTTAAAAGACCTTCTACCTGATATG
GAGCCTGCAGGAATCGACCTACTTCAGaaaTTCCTGATTTACCAGCCAGC
ATCGAGAATGTCAGCAAGGAAAGCATTAAAGCACCCATACTTTTTCGACT
TTGATCCTTCCACATTGCCACAACCTCCAGAAGATATCCTGTAAATGAGT
ACCAAAGAAGATAGTCAACGTTTAAATGAATacaaaagaatagaaaaaat
tggTGAAGGCACCTACGGTATTGTTTACAAAGCTAAACACACCCCAACTG
GGGAATTGGTTGCTTTAAAGAAGATTCGTCTGGAAACTGATGACGAAGGG
TGCCCATCCACCGCTATTAGGGAAATTTCGATTCTCAAAGAATTAAGGAA
ATATCCTTTTATTGTCCAACTCCAAGATGTTATTCACAGTGAATCAAAGT
TGTATTTGGTTTTCGAATTCTTGTTGATGGACTTGAAGAAATACATTGAT
ACAGTCCAAGGACCCATTGACCAAGCCTTAATCAAAAGTTACACATATCA
AATTTGTGCTGCTCTGGAATTTTGTCATGCAAGGAGGATCATCCATCGTG
ATTTGAAGCCACAGAATCTTCTAATTGATTCCAAAGGATTGATCAAGATT
GCTGATTTTGGTCTTGGGAGATCTTTTGGTGTTCCTATCAGGGCATTTAC
TCACGAGGTTGTAACGTTATGGTACAGGTGTCCAGAAGTTTTGCTGGGTA
TGAAGAGATATTCATGCGGTATTGACACTTGGAGTATTGGATGTATTTTC
GCTGAAATGGTCACCAAGAAACCCATCTTCCAAGGAGATTCTGAAATTGA
TGAAATCTTCAAGATATTCCAAATTTTGGGTACACCAAGTAATGCTGAGT
GGGAAGGTGTTGAAGAATTACCCGATTACAAGAATGCATTCCCCAAATGG
AAACCAAAGAATTTAAAAGACCTTCTACCTGATATGGAGCCTGCAGGAAT
CGACCTACTTCAGaaaTTCCTGATTTACCAGCCAGCATCGAGAATGTCAG
CAAGGAAAGCATTAAAGCACCCATACTTTTTCGACTTTGATCCTTCCACA
TTGCCACAACCTCCAGAAGATATCCTGTAAATGAGTACCAAAGAAGATAG
TCAACGTTTAAATGAATacaaaagaatagaaaaaattggTGAAGGCACCT
ACGGTATTGTTTACAAAGCTAAACACACCCCAACTGGGGAATTGGTTGCT
TTAAAGAAGATTCGTCTGGAAACTGATGACGAAGGGTGCCCATCCACCGC
TATTAGGGAAATTTCGATTCTCAAAGAATTAAGGAAATATCCTTTTATTG
TCCAACTCCAAGATGTTATTCACAGTGAATCAAAGTTGTATTTGGTTTTC
GAATTCTTGTTGATGGACTTGAAGAAATACATTGATACAGTCCAAGGACC
CATTGACCAAGCCTTAATCAAAAGTTACACATATCAAATTTGTGCTGCTC
TGGAATTTTGTCATGCAAGGAGGATCATCCATCGTGATTTGAAGCCACAG
AATCTTCTAATTGATTCCAAAGGATTGATCAAGATTGCTGATTTTGGTCT
TGGGAGATCTTTTGGTGTTCCTATCAGGGCATTTACTCACGAGGTTGTAA
CGTTATGGTACAGGTGTCCAGAAGTTTTGCTGGGTATGAAGAGATATTCA
TGCGGTATTGACACTTGGAGTATTGGATGTATTTTCGCTGAAATGGTCAC
CAAGAAACCCATCTTCCAAGGAGATTCTGAAATTGATGAAATCTTCAAGA
TATTCCAAATTTTGGGTACACCAAGTAATGCTGAGTGGGAAGGTGTTGAA
GAATTACCCGATTACAAGAATGCATTCCCCAAATGGAAACCAAAGAATTT
AAAAGACCTTCTACCTGATATGGAGCCTGCAGGAATCGACCTACTTCAGa
aaTTCCTGATTTACCAGCCAGCATCGAGAATGTCAGCAAGGAAAGCATTA
AAGCACCCATACTTTTTCGACTTTGATCCTTCCACATTGCCACAACCTCC
AGAAGATATCCTGTAAATGAGTACCAAAGAAGATAGTCAACGTTTAAATG
AATacaaaagaatagaaaaaattggTGAAGGCACCTACGGTATTGTTTAC
AAAGCTAAACACACCCCAACTGGGGAATTGGTTGCTTTAAAGAAGATTCG
TCTGGAAACTGATGACGAAGGGTGCCCATCCACCGCTATTAGGGAAATTT
CGATTCTCAAAGAATTAAGGAAATATCCTTTTATTGTCCAACTCCAAGAT
GTTATTCACAGTGAATCAAAGTTGTATTTGGTTTTCGAATTCTTGTTGAT
GGACTTGAAGAAATACATTGATACAGTCCAAGGACCCATTGACCAAGCCT
TAATCAAAAGTTACACATATCAAATTTGTGCTGCTCTGGAATTTTGTCAT
GCAAGGAGGATCATCCATCGTGATTTGAAGCCACAGAATCTTCTAATTGA
TTCCAAAGGATTGATCAAGATTGCTGATTTTGGTCTTGGGAGATCTTTTG
GTGTTCCTATCAGGGCATTTACTCACGAGGTTGTAACGTTATGGTACAGG
TGTCCAGAAGTTTTGCTGGGTATGAAGAGATATTCATGCGGTATTGACAC
TTGGAGTATTGGATGTATTTTCGCTGAAATGGTCACCAAGAAACCCATCT
TCCAAGGAGATTCTGAAATTGATGAAATCTTCAAGATATTCCAAATTTTG
GGTACACCAAGTAATGCTGAGTGGGAAGGTGTTGAAGAATTACCCGATTA
CAAGAATGCATTCCCCAAATGGAAACCAAAGAATTTAAAAGACCTTCTAC
CTGATATGGAGCCTGCAGGAATCGACCTACTTCAGaaaTTCCTGATTTAC
CAGCCAGCATCGAGAATGTCAGCAAGGAAAGCATTAAAGCACCCATACTT
TTTCGACTTTGATCCTTCCACATTGCCACAACCTCCAGAAGATATCCTGT
AA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000943XLOC_000943Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001758-proteinTCONS_00001758-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001758-exon-sc0000012-1491911889:4757..7079TCONS_00001758-exon-sc0000012-1491911889:4757..7079Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1510915933:4757..7079TCONS_00001758-exon-sc0000012-1510915933:4757..7079Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1575043694:4757..7079TCONS_00001758-exon-sc0000012-1575043694:4757..7079Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1491911889:11514..11642TCONS_00001758-exon-sc0000012-1491911889:11514..11642Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1510915933:11514..11642TCONS_00001758-exon-sc0000012-1510915933:11514..11642Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1575043694:11514..11642TCONS_00001758-exon-sc0000012-1575043694:11514..11642Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1491911889:11940..12099TCONS_00001758-exon-sc0000012-1491911889:11940..12099Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1510915933:11940..12099TCONS_00001758-exon-sc0000012-1510915933:11940..12099Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1575043694:11940..12099TCONS_00001758-exon-sc0000012-1575043694:11940..12099Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1491911889:12423..12540TCONS_00001758-exon-sc0000012-1491911889:12423..12540Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1510915933:12423..12540TCONS_00001758-exon-sc0000012-1510915933:12423..12540Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1575043694:12423..12540TCONS_00001758-exon-sc0000012-1575043694:12423..12540Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1491911889:13053..13223TCONS_00001758-exon-sc0000012-1491911889:13053..13223Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1510915933:13053..13223TCONS_00001758-exon-sc0000012-1510915933:13053..13223Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1575043694:13053..13223TCONS_00001758-exon-sc0000012-1575043694:13053..13223Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1491911889:13496..13659TCONS_00001758-exon-sc0000012-1491911889:13496..13659Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1510915933:13496..13659TCONS_00001758-exon-sc0000012-1510915933:13496..13659Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1575043694:13496..13659TCONS_00001758-exon-sc0000012-1575043694:13496..13659Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1491911889:13882..14023TCONS_00001758-exon-sc0000012-1491911889:13882..14023Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1510915933:13882..14023TCONS_00001758-exon-sc0000012-1510915933:13882..14023Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1575043694:13882..14023TCONS_00001758-exon-sc0000012-1575043694:13882..14023Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1491911889:14300..15166TCONS_00001758-exon-sc0000012-1491911889:14300..15166Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1510915933:14300..15166TCONS_00001758-exon-sc0000012-1510915933:14300..15166Clytia hemisphaericaexon
TCONS_00001758-exon-sc0000012-1575043694:14300..15166TCONS_00001758-exon-sc0000012-1575043694:14300..15166Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:4757..15166 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
58.8547 60.8228 46.2604 36.9628 183.472 136.649 63.0251 63.673 41.9934 46.2002 31.4903 28.4245 14.7911 12.5886 29.6245 33.6937 67.4296 54.3111 8.93356 7.5105 25.0386 23.7254 73.9013 65.6614 60.1114 48.9368 20.5927 10.7093 40.0837 37.8256
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0004672 protein kinase activity
Blast
BLAST of TCONS_00001758 vs. Swiss-Prot (Human)
Match: CDK1 (Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3)

HSP 1 Score: 399.823 bits (1026), Expect = 1.035e-127
Identity = 185/292 (63.36%), Postives = 232/292 (79.45%), Query Frame = 1
Query: 2416 LNEYKRIEKIGEGTYGIVYKAKHTPTGELVALKKIRLETDDEGCPSTAIREISILKELRKYPFIVQLQDVIHSESKLYLVFEFLLMDLKKYIDTVQGP--IDQALIKSYTYQICAALEFCHARRIIHRDLKPQNLLIDSKGLIKIADFGLGRSFGVPIRAFTHEVVTLWYRCPEVLLGMKRYSCGIDTWSIGCIFAEMVTKKPIFQGDSEIDEIFKIFQILGTPSNAEWEGVEELPDYKNAFPKWKPKNLKDLLPDMEPAGIDLLQKFLIYQPASRMSARKALKHPYFFDFD 3285
            + +Y +IEKIGEGTYG+VYK +H  TG++VA+KKIRLE+++EG PSTAIREIS+LKELR +P IV LQDV+  +S+LYL+FEFL MDLKKY+D++     +D +L+KSY YQI   + FCH+RR++HRDLKPQNLLID KG IK+ADFGL R+FG+PIR +THEVVTLWYR PEVLLG  RYS  +D WSIG IFAE+ TKKP+F GDSEID++F+IF+ LGTP+N  W  VE L DYKN FPKWKP +L   + +++  G+DLL K LIY PA R+S + AL HPYF D D
Sbjct:    1 MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELR-HPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLD 291          
The following BLAST results are available for this feature:
BLAST of TCONS_00001758 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CDK11.035e-12763.36Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 ... [more]
back to top