Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001758-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001758-protein
Unique NameTCONS_00001758-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length311

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001758-protein ID=TCONS_00001758-protein|Name=TCONS_00001758-protein|organism=Clytia hemisphaerica|type=polypeptide|length=311bp
MSTKEDSQRLNEYKRIEKIGEGTYGIVYKAKHTPTGELVALKKIRLETDD
EGCPSTAIREISILKELRKYPFIVQLQDVIHSESKLYLVFEFLLMDLKKY
IDTVQGPIDQALIKSYTYQICAALEFCHARRIIHRDLKPQNLLIDSKGLI
KIADFGLGRSFGVPIRAFTHEVVTLWYRCPEVLLGMKRYSCGIDTWSIGC
IFAEMVTKKPIFQGDSEIDEIFKIFQILGTPSNAEWEGVEELPDYKNAFP
KWKPKNLKDLLPDMEPAGIDLLQKFLIYQPASRMSARKALKHPYFFDFDP
STLPQPPEDIL
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000943XLOC_000943Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001758TCONS_00001758Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0004672 protein kinase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 13..295
e-value: 4.3E-98
score: 341.9
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 13..295
e-value: 2.2E-73
score: 246.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 13..295
score: 45.87
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 2..230
e-value: 5.2E-20
score: 69.4
NoneNo IPR availableGENE3D3.30.200.20coord: 1..108
e-value: 4.1E-30
score: 103.7
NoneNo IPR availableGENE3D1.10.510.10coord: 109..303
e-value: 3.4E-61
score: 205.8
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 19..42
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 132..144
IPR011009Protein kinase-like domainSUPERFAMILY56112Protein kinase-like (PK-like)coord: 9..299

Blast
BLAST of TCONS_00001758-protein vs. Swiss-Prot (Human)
Match: CDK1 (Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3)

HSP 1 Score: 399.823 bits (1026), Expect = 4.596e-141
Identity = 185/292 (63.36%), Postives = 232/292 (79.45%), Query Frame = 0
Query:   10 LNEYKRIEKIGEGTYGIVYKAKHTPTGELVALKKIRLETDDEGCPSTAIREISILKELRKYPFIVQLQDVIHSESKLYLVFEFLLMDLKKYIDTV--QGPIDQALIKSYTYQICAALEFCHARRIIHRDLKPQNLLIDSKGLIKIADFGLGRSFGVPIRAFTHEVVTLWYRCPEVLLGMKRYSCGIDTWSIGCIFAEMVTKKPIFQGDSEIDEIFKIFQILGTPSNAEWEGVEELPDYKNAFPKWKPKNLKDLLPDMEPAGIDLLQKFLIYQPASRMSARKALKHPYFFDFD 299
            + +Y +IEKIGEGTYG+VYK +H  TG++VA+KKIRLE+++EG PSTAIREIS+LKELR +P IV LQDV+  +S+LYL+FEFL MDLKKY+D++     +D +L+KSY YQI   + FCH+RR++HRDLKPQNLLID KG IK+ADFGL R+FG+PIR +THEVVTLWYR PEVLLG  RYS  +D WSIG IFAE+ TKKP+F GDSEID++F+IF+ LGTP+N  W  VE L DYKN FPKWKP +L   + +++  G+DLL K LIY PA R+S + AL HPYF D D
Sbjct:    1 MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELR-HPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLD 291          
The following BLAST results are available for this feature:
BLAST of TCONS_00001758-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CDK14.596e-14163.36Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 ... [more]
back to top