Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001698 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001698
Unique NameTCONS_00001698
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length939

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001698 ID=TCONS_00001698|Name=TCONS_00001698|organism=Clytia hemisphaerica|type=transcript|length=939bp
gaaaggttCTGTTACGGTAACATTATGGTTTTTTCTGTAATAAAAATcat
tgttttagaaaatatcaaagaaatacaggaaagattaaacaaaaataatg
ttACTTGGGAATTTGAGCCGCTCCATTTTTACATTGCTTGGTCTGGTAGC
TGTTTTGAACGCATTCACAATCAAACGACAAGCTTCATCATCATCACATC
TGAACAGCATCTATGACAAAACAAATGGACTAAATCGTACAGGATCAAAT
GTTTGCAAATACCAAGAAACAGTGACCAAGCTAGTCAACACGACTTATTT
GTCAACTCGTTGGACCACTGTGTACTTCAAAACATGTGATTTCTGGGGAT
GCAAGAAAGTTTCAAGATTAGGAACGAAACAAGTGGTATCACACCGATTG
GAGACGAAATATATTGACCGTGATGTTTATTACTGTTGCAACGGATGGAA
AAGACCTGATAACACTCATAAAAGCTGTGATATTCCCACGTGTGCTTTCG
CATGTCAAAATGGTGGGAAATGTGTTGCACCAGATAAATGTCAATGTGTA
AATGGATACTATGGATCGTATTGCCAATTCGATAACAATGAATGCCAAGA
TCCTTCAAAGAACGATTGTTCACAAGTCTGTATCAATATCCAAGGAGGTT
TCAAATGTGGATGCAATTCTGGATACACACTTGATAGTGATGGAAAGACA
TGTTTAGACATAAACGAATGTTCTACAAAGAAAGCATGTGGATGTCAAGC
ACGAGATGGAGTGTGTCAAGCCACGTGTACTAATACAATGGGAAGCTACA
AGTGCGCATGTCCAAAAGGATATTTCTTGAATTCAGCTGAGCTTTGTGAA
GATAGGAACGAATGTTTCTTGGACCAAACGTTATGCGACCACAAATGTCT
GAACACACCAGGAGGATACAAATGCCAATGTTTCAAAGN
Run BLAST on NCBI

protein sequence of TCONS_00001698-protein

>TCONS_00001698-protein ID=TCONS_00001698-protein|Name=TCONS_00001698-protein|organism=Clytia hemisphaerica|type=polypeptide|length=280bp
MLLGNLSRSIFTLLGLVAVLNAFTIKRQASSSSHLNSIYDKTNGLNRTGS
NVCKYQETVTKLVNTTYLSTRWTTVYFKTCDFWGCKKVSRLGTKQVVSHR
LETKYIDRDVYYCCNGWKRPDNTHKSCDIPTCAFACQNGGKCVAPDKCQC
VNGYYGSYCQFDNNECQDPSKNDCSQVCINIQGGFKCGCNSGYTLDSDGK
TCLDINECSTKKACGCQARDGVCQATCTNTMGSYKCACPKGYFLNSAELC
EDRNECFLDQTLCDHKCLNTPGGYKCQCFK
Run BLAST on NCBI

transcript from alignment at sc0000011:960947..967506-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001698 ID=TCONS_00001698|Name=TCONS_00001698|organism=Clytia hemisphaerica|type=transcript|length=6560bp|location=Sequence derived from alignment at sc0000011:960947..967506- (Clytia hemisphaerica)
GAAAGGTTCTGTTACGGTAACATTATGGTTTTTTCTGTAATAAAAATCAT TGTTTTAGAAAATATCAAAGAAATACAGGAAAGATTAAACAAAAATAATG TTACTTGGGAATTTGAGCCGCTCCATTTTTACATTGCTTGGTCTGGTAGC TGTTTTGAACGCATTCACAATCAAACGACAAGCTTCATCATCATCACATC TGAACAGCATCTATGACAAAACAAATGGACTAAATCGTACAGGGTAGGTT CGAATACGTTGTGGATATTGACTTTATAGTCGATTTAGGGAATAAACTCT TAAGATTTGTAGCATTTTTCGTGAGACGCAACCGCGTGTCTTTAGTTCAA AAGTAGACAGGATTTTGAATTTTTTTGAGATGGGCCATTCGAATTAGGAC TGGAAAGACTTTTTATGGCCGAAAGAGTTGCAGGCAAAACTGGTAGAAGT CGAACTCGAAAGAAATGATTAATAAATTTTTAATAGCGTCATATGGGATG AGAGGAGATGGCTCTTACTGTCGACAGCAGTAGCTTAGCCAAGAGGGGTG CAAAATTTGTGTAGGAGAGCAGATTTTTAAGACACTGTAATTATCTATTC ATAATATTAAAAGATAATTACAGCGTCATAAAAATCTGCCCTCCTACACA AATTTTTCGCCCCTCTTGGCTACGCTACTAAACATAAAATGTCGGTGACA AAACTCATTCCATTTTTATTCCTTAAAAACAGCTATTTCGATAGTCTTTA AAACTTAGCAGCACCTTGAGGTCAACGAGGCAGATCATACAGGTCTTAGT TAGTAGTTATCTGCTACCGTGAGCATCACAACTCGAATAAATATCGAATA TTTTCTCTAAACATTTTATCTCTGGTATAAATATGTTTCATTTTGGTAGA TTGACTGAAAATTTGTTTACCACTTTTTAGATCAAATGTTTGCAAATACC AAGAAACAGTGACCAAGCTAGTCAACACGACTTATTTGTCAACTCGTTGG ACCACTGTGTACTTCAAAACATGTGATTTCTGGGGATGCAAGAAAGTTTC AAGATTAGGGTAATGTCATGATCGAATCGCACAACAAATTAAGTGATACT GGAATCATATTAAATCTCTTAGATTATCACGGTTCTTTGTTTTGTGAACC CAGCCGTTTGCGTGATGCGTGATGCGATTTTAATNATTCTTCTGGAAATG GCATGGGAACAGTCACAGCTGGTAAAGACTAGAAATATCAGCTTACTCAA GTGGATGGAAGAAACAAGGGAACAACGACTTGATGATCAAGTGCGATATA TTAATCACGTAATACGTGTGTGCAGGTGCGAGTGCTGTATATGCATAGCA TACATTCATCATATGCTTGATAAGTTTATATGTTATGATATCTGGATATG ATTATTATTGATGTTTGACGGACGGTATCTGACAGCTGGACGGACGACAA CTGACAGCCTGATGGACCATGATAGTGCATCAAATGGGATTTGTTTGCTT CAATATGNGCATTTTTCAAATCTTCCACTTTTTTGCAACTTTTCGAACGA TTCGAACGTTCTACGGACAAACTCACTAAATTAACTTTACATTTACGAAT TTGTTTTTAGCTATGGTAAGTCCAACCAAGTATAGGAAATCGGGAAATAG GCGGGAAAGTCACTAATCGGCAAATCGGGTTTCCCCCCGACAACAAGAAA GTAAACAAAACATTTTGTCAACAAAACCAAAAACCTGGAAACTTTTGGCT GATGACGACTGACGACATTGATTGGTTTGANTCAAAACATGGGACTGTTG ACAATCTGGCCTGCACTCCACCAAGTTTATCAATCTTACTTTCTGTCATA ACATGTCACGATAACTTTCACTGGACACTGATAACGCGCCCTTTTTAACT TTTTTGTTTTCATTCAGAATGACTGGACGCTGATTGGAGAATTAGAGAAC GCCTTTCGCCTAACCGCTTATCGCCTGATGGGATTAACCAATAACAAGCG TGTAATATGCCGCCCGTGCAAGTGACGTCAAACGCTGTCGTTTTGCCACT AATTTGTTCTTCTTCGTTCCAGACACTGGCATGTATTCCACTACGGATTT TCTTCATATTTTGATTTAAAAGCCTACTTGGTGCGAAAAAGAAATCGTGT ATTTTTTTGATACGCCGTTCATTAACTCAAATCAAATTATTTTGGAGGTT CGGTGAAATGGTGGCCGAATTGCCGTCCCATGTTTTGTCAGATAGTCCCA AGTTAGAGCAGTTGACGGTATAAATGATTGTGCTGTGCCAGAAAAAACTC TTCATTGGGCTTTGGTGATTTTTTCAGGGACCAGGGGTATTAAGTGATGG GTATGTCCAAACCAAAAATTGAAAATTGACCCTGTGAGAGACAGAATTTT GCACATGCCTGACACACCCAATTTACCTTTAAAGTAACAACCATCCCAGT TCTTGAAAAAATTGCAAAAAACAGTCATACCCAGGCCCAGGGGTCGATTT GTCCAGAGGTAAAATTATGGATTATTTCAACAAAAGAAATAGATTTATAT ATTTTATAATCTTTGACTTTTCTGGGTTTTTGAACTTATGAATTTTTTTA GGATATATGGAATTTATGGAAATTTTTAGGACTTCCTAGTATAGATTTTA AGTTATGTCAATAAATTTTGAGAAATTTTAGGACTCTTGGAGATTTTGCG GCCTTTATAAGACTTCTTGGTTTTACAGTCTCGTTTATTTGAAGCAGTAA TTTTTTGTTGAGAACTTGCTGTTCTCATTTTTTATCTCATTTTCATTTCT ATGATTCCTATGAGTTTCAATAAGATAAATCAATAAATACTTTATTTGAT TACAATTTTATTGTTTACCACATGCTTGAGTTACTCATATTTTCTTCCAA AACTCTTAGTTGAGCCTAGGATGTTTTTTTTTTTTTCTATACCGAAGAAT CGTTATGATATTCTTATTTTAGATCGAAATTTTAAGATACTTAAGGCTAT CTTTGTCCCATTAATTTATTGAAGTATTTATTGAATTTTCATAATAAAAA AGCATACAATTTTTGCTTATTTCACCTCAATTGTTATTTTTTTGTAAGAA CTGTGTTTAAAGTTGTTTTTATACCCTGGCCATTTGCCTCGACTCTCATA AAGTCGTTCTTATAAAGAAATATGTCATTCTATCTTGTATTCCATCAGGA TTTACCAAGTTCTTCATTAATTAGGTCTTAGAGTAAACATTCTGACATTT GGTGTAGTTAACACGTTTCCTTTCTATTAAAATTCACCAACATTAACATT TGATGATTTTATAACCAATCAGCCGCTGGAGCTGGGGGGGGGTCAGTGTA TCATATAGCAGTATGTAATTTGAGGTTGGTCGGTGCTTTCAGGAAAATAT TCAGTGTTTTACTACACAGATATTATATAATTTCAATGATTTTTGAAAAT AGATTCTAGAGCAATATGTAGAAAAGATTTTCTTAAAAATTCAAAAAGCA GTTTATTTTAAAAATAGAATATTAACTTTCTAAAAAATTTTTGATTTTCA AAAATACGTTAACTTCGTGAAAGAGGCTCAATGTCCCAAAATCAAGTTTT TATTCACCAGAGCAAGGATACTTTAAAAGCTAAAGAAAAACTTTAGCTTT CAAAGTATCCTTGACCAGAGTTTTTATATGCTTAAAATGCATCTGTAGAA ATCTATCTTGCTCTCGTGACAATCATGCAAATCGCCAAAAGTGGTTGATA CATCATGCAAATGTAACGAAAATAGCCCAAATCACGCACCATGCCTCGAA TTATTTCCCTGCTTTAATATATGGAAACCATGTCGGTTTAACTACACCCA TTTTAGGGTGGTTTCCATATAGTAGCTAAAAAGAGTGCTCACTCCGGCTC ACTTAAAGCGGATAGAATTTAACTCGAAAATGACACAAAGATTTTAGTTT GGGCGTGTGCACTCATTCGAAATCAGCAAATATATTAGGAATTTAAGGTT TACAGAGTGATTCCATTAAATGGCTAAAAGCTATACATAGGTTATACGAA AACTTCTCAGTACCATTACCTTTTTTTATAAAAAAGAGTTGTAAAACAAC CCCAAAAAACTCCAGGCAAAATAAACATTTCTGCATTGAGAAAAATACTT CAAAACTGATAACTCTTTCCAACAGAACGAAACAAGTGGTATCACACCGA TTGGAGACGAAATATATTGACCGTGATGTTTATTACTGTTGCAACGGATG GAAAAGACCTGATAACACTCATAAAAGCTGTGATATTCGTAAGTTACTTG TTGTACAAGATTTCGGTTCTGGAGAGATCGACCGTTTTTCGTTTTTACTT CGGAATTTCCTGTAATCTTCGGTAAAATATGTTCTTTGATTTGGAAGATT TGTCCGGTAGAACCATTATTAATTCGAAATATTGGTAATGATCGGAATTT AAGCTTTACTTCGGAAATCATGACAAATTTATTCGGTATTTCGGAAATCA GAACCCTGATACATAACAAAAAACTACTATTTTCAACAATATTTACACTA AAGGTATATGAAAGGATTGATTGACTGAGTCTTTTTTCATTTTCCAACTC ACTGTACTTTCAATATTCAACAATATACCGGGTGACCCACGAAAAGGTTC AGACGTTTCTCGACGTCTTGAGGCCGAACAAATGTCCTAAAGTGCTTGGA GTTTAGATATTTAGAAAGTAGATATCCTAACTTAAAATTTGAGCTATCAC TTTTTAAATTTGACCTATTTGTTCTCTACTTATGAGCTTTTAAATTCAAA ATTCACTTTTCGGAAAGTGTAAAAAACACGTGAAAAAGGGGTATCAGATG TCGGGAAACGTCTGAACTTTTTCGTGGGTCACCCGGTATACTTTACATTT TTATAGCCACGTGTGCTTTCGCATGTCAAAATGGTGGGAAATGTGTTGCA CCAGATAAATGTCAATGTGTAAATGGATACTATGGATCGTATTGCCAATT CGGTAAGAAGTGATTTTTTAAAGAAGCGGGCCGAGTTTCCAATTTTTCTT TCAGTTTACATGGGCCCCGTCAACGGGACGGCCGGGGGTCCATGCCCCCC CCCCACTTTTTGGTAGACCATGTCATACGTTTTTAAGAGTTACTATTTTA AGCTGATTTGAGACCAAATCAAACCACAAAAACTATTATTCTCCCCAATT AGATATCGTTTTAAGGTGTTTTGAGGGTGTAAAAAGTGAAAAAAATTTTC TTCGTCGCCCAACCATGGTGGGCGACATTTTTTCCCCAAATGTTGGCCCC CTCACTCAAAATGGCTCGCCGGGGCTCATGGTTTATAGATGGAGAGTATA GTGTACTTTGTGGTGATGAAACATTTTTTAATATTTTATGTAGTACTTGG AAATGAACATTTAACATTTTTCCTCTCAGATAACAATGAATGCCAAGATC CTTCAAAGAACGATTGTTCACAAGTCTGTATCAATATCCAAGGAGGTTTC AAATGTGGATGCAATTCTGGATACACACTTGATAGTGATGGAAAGACATG TTTAGGTATAATCATATATAATAAAGTTAGACCTTTCTCACTCGATTAAA AGGTTTAAAAGGCTCAAAGAGGTTTCTAGGATGGTTTTTATACATAAACA GTAAAACAAAGATGAAAGCAAGATTAGCTACAGGCGGAGTCTCTATAACT CGAACATGAGCTTGTTTCGAGTTAAGGAGATATTTGAGTCATAGAGGTTC AAGAGTTGAAATACATTCAAGAACCGTTTTCACATTGGAAAAATGGAGAA AAAAATATTCCGTCTAAATTATCTATATTTCTAGACATAAACGAATGTTC TACAAAGAAAGCATGTGGATGTCAAGCACGAGATGGAGTGTGTCAAGCCA CGTGTACTAATACAATGGGAAGCTACAAGTGCGCATGTCCAAAAGGATAT TTCTTGAATTCAGCTGAGCTTTGTGAAGGTAAGAATTTTTTCTCAGCATT TTAAAGAAAGCGAAGTCAAATTTATAAATCGTTTGGAACTTGAAAGGACG AAAGCAAACTTTTCGTATACACGCTTTTTTTATAAGAATATCTTCTATAA GAATATTAGGGTGAAAATTGTAAGAATACCCTAAGAATACCTTCTAGGGT GAGTTTCACAGGTTTTTGGCAATTTCTTAAAAATACTTGACCCTCATCCA CAGTAGTAAAGTACACTATTCTTATAAAAAAGCGTGTATTTTTGTTTATT TTTTCTTCAAATTTTCAACGTTATCCAATGAACTTCCCCTTTTCAATTCT AAATTTTTAATTTCAATACTAAGTTTTAAACTACTTAGCAGAGAGACATC AAACACATTGTCACCAGGTAAAAAACACATAGGCAGATAAACACCAACCA AGGAAAACATATGTAGTTCTCAGTACGAGCAGATAACTTAACTAAACTAT TGCCACTTCTTCTCTTCAATAGATAGGAACGAATGTTTCTTGGACCAAAC GTTATGCGACCACAAATGTCTGAACACACCAGGAGGATACAAATGCCAAT GTTTCAAAGN

Coding sequence (CDS) from alignment at sc0000011:960947..967506-

>TCONS_00001698 ID=TCONS_00001698|Name=TCONS_00001698|organism=Clytia hemisphaerica|type=CDS|length=5880bp|location=Sequence derived from alignment at sc0000011:960947..967506- (Clytia hemisphaerica)
ATAGGAACGAATGTTTCTTGGACCAAACGTTATGCGACCACAAATGTCTG
AACACACCAGGAGGATACAAATGCCAATGTTTCAAAACATAAACGAATGT
TCTACAAAGAAAGCATGTGGATGTCAAGCACGAGATGGAGTGTGTCAAGC
CACGTGTACTAATACAATGGGAAGCTACAAGTGCGCATGTCCAAAAGGAT
ATTTCTTGAATTCAGCTGAGCTTTGTGAAGATAACAATGAATGCCAAGAT
CCTTCAAAGAACGATTGTTCACAAGTCTGTATCAATATCCAAGGAGGTTT
CAAATGTGGATGCAATTCTGGATACACACTTGATAGTGATGGAAAGACAT
GTTTAGCCACGTGTGCTTTCGCATGTCAAAATGGTGGGAAATGTGTTGCA
CCAGATAAATGTCAATGTGTAAATGGATACTATGGATCGTATTGCCAATT
CGAACGAAACAAGTGGTATCACACCGATTGGAGACGAAATATATTGACCG
TGATGTTTATTACTGTTGCAACGGATGGAAAAGACCTGATAACACTCATA
AAAGCTGTGATATTCATCAAATGTTTGCAAATACCAAGAAACAGTGACCA
AGCTAGTCAACACGACTTATTTGTCAACTCGTTGGACCACTGTGTACTTC
AAAACATGTGATTTCTGGGGATGCAAGAAAGTTTCAAGATTAGGATGTTA
CTTGGGAATTTGAGCCGCTCCATTTTTACATTGCTTGGTCTGGTAGCTGT
TTTGAACGCATTCACAATCAAACGACAAGCTTCATCATCATCACATCTGA
ACAGCATCTATGACAAAACAAATGGACTAAATCGTACAGGATAGGAACGA
ATGTTTCTTGGACCAAACGTTATGCGACCACAAATGTCTGAACACACCAG
GAGGATACAAATGCCAATGTTTCAAAACATAAACGAATGTTCTACAAAGA
AAGCATGTGGATGTCAAGCACGAGATGGAGTGTGTCAAGCCACGTGTACT
AATACAATGGGAAGCTACAAGTGCGCATGTCCAAAAGGATATTTCTTGAA
TTCAGCTGAGCTTTGTGAAGATAACAATGAATGCCAAGATCCTTCAAAGA
ACGATTGTTCACAAGTCTGTATCAATATCCAAGGAGGTTTCAAATGTGGA
TGCAATTCTGGATACACACTTGATAGTGATGGAAAGACATGTTTAGCCAC
GTGTGCTTTCGCATGTCAAAATGGTGGGAAATGTGTTGCACCAGATAAAT
GTCAATGTGTAAATGGATACTATGGATCGTATTGCCAATTCGAACGAAAC
AAGTGGTATCACACCGATTGGAGACGAAATATATTGACCGTGATGTTTAT
TACTGTTGCAACGGATGGAAAAGACCTGATAACACTCATAAAAGCTGTGA
TATTCATCAAATGTTTGCAAATACCAAGAAACAGTGACCAAGCTAGTCAA
CACGACTTATTTGTCAACTCGTTGGACCACTGTGTACTTCAAAACATGTG
ATTTCTGGGGATGCAAGAAAGTTTCAAGATTAGGATGTTACTTGGGAATT
TGAGCCGCTCCATTTTTACATTGCTTGGTCTGGTAGCTGTTTTGAACGCA
TTCACAATCAAACGACAAGCTTCATCATCATCACATCTGAACAGCATCTA
TGACAAAACAAATGGACTAAATCGTACAGGATAGGAACGAATGTTTCTTG
GACCAAACGTTATGCGACCACAAATGTCTGAACACACCAGGAGGATACAA
ATGCCAATGTTTCAAAACATAAACGAATGTTCTACAAAGAAAGCATGTGG
ATGTCAAGCACGAGATGGAGTGTGTCAAGCCACGTGTACTAATACAATGG
GAAGCTACAAGTGCGCATGTCCAAAAGGATATTTCTTGAATTCAGCTGAG
CTTTGTGAAGATAACAATGAATGCCAAGATCCTTCAAAGAACGATTGTTC
ACAAGTCTGTATCAATATCCAAGGAGGTTTCAAATGTGGATGCAATTCTG
GATACACACTTGATAGTGATGGAAAGACATGTTTAGCCACGTGTGCTTTC
GCATGTCAAAATGGTGGGAAATGTGTTGCACCAGATAAATGTCAATGTGT
AAATGGATACTATGGATCGTATTGCCAATTCGAACGAAACAAGTGGTATC
ACACCGATTGGAGACGAAATATATTGACCGTGATGTTTATTACTGTTGCA
ACGGATGGAAAAGACCTGATAACACTCATAAAAGCTGTGATATTCATCAA
ATGTTTGCAAATACCAAGAAACAGTGACCAAGCTAGTCAACACGACTTAT
TTGTCAACTCGTTGGACCACTGTGTACTTCAAAACATGTGATTTCTGGGG
ATGCAAGAAAGTTTCAAGATTAGGATGTTACTTGGGAATTTGAGCCGCTC
CATTTTTACATTGCTTGGTCTGGTAGCTGTTTTGAACGCATTCACAATCA
AACGACAAGCTTCATCATCATCACATCTGAACAGCATCTATGACAAAACA
AATGGACTAAATCGTACAGGATAGGAACGAATGTTTCTTGGACCAAACGT
TATGCGACCACAAATGTCTGAACACACCAGGAGGATACAAATGCCAATGT
TTCAAAACATAAACGAATGTTCTACAAAGAAAGCATGTGGATGTCAAGCA
CGAGATGGAGTGTGTCAAGCCACGTGTACTAATACAATGGGAAGCTACAA
GTGCGCATGTCCAAAAGGATATTTCTTGAATTCAGCTGAGCTTTGTGAAG
ATAACAATGAATGCCAAGATCCTTCAAAGAACGATTGTTCACAAGTCTGT
ATCAATATCCAAGGAGGTTTCAAATGTGGATGCAATTCTGGATACACACT
TGATAGTGATGGAAAGACATGTTTAGCCACGTGTGCTTTCGCATGTCAAA
ATGGTGGGAAATGTGTTGCACCAGATAAATGTCAATGTGTAAATGGATAC
TATGGATCGTATTGCCAATTCGAACGAAACAAGTGGTATCACACCGATTG
GAGACGAAATATATTGACCGTGATGTTTATTACTGTTGCAACGGATGGAA
AAGACCTGATAACACTCATAAAAGCTGTGATATTCATCAAATGTTTGCAA
ATACCAAGAAACAGTGACCAAGCTAGTCAACACGACTTATTTGTCAACTC
GTTGGACCACTGTGTACTTCAAAACATGTGATTTCTGGGGATGCAAGAAA
GTTTCAAGATTAGGATGTTACTTGGGAATTTGAGCCGCTCCATTTTTACA
TTGCTTGGTCTGGTAGCTGTTTTGAACGCATTCACAATCAAACGACAAGC
TTCATCATCATCACATCTGAACAGCATCTATGACAAAACAAATGGACTAA
ATCGTACAGGATAGGAACGAATGTTTCTTGGACCAAACGTTATGCGACCA
CAAATGTCTGAACACACCAGGAGGATACAAATGCCAATGTTTCAAAACAT
AAACGAATGTTCTACAAAGAAAGCATGTGGATGTCAAGCACGAGATGGAG
TGTGTCAAGCCACGTGTACTAATACAATGGGAAGCTACAAGTGCGCATGT
CCAAAAGGATATTTCTTGAATTCAGCTGAGCTTTGTGAAGATAACAATGA
ATGCCAAGATCCTTCAAAGAACGATTGTTCACAAGTCTGTATCAATATCC
AAGGAGGTTTCAAATGTGGATGCAATTCTGGATACACACTTGATAGTGAT
GGAAAGACATGTTTAGCCACGTGTGCTTTCGCATGTCAAAATGGTGGGAA
ATGTGTTGCACCAGATAAATGTCAATGTGTAAATGGATACTATGGATCGT
ATTGCCAATTCGAACGAAACAAGTGGTATCACACCGATTGGAGACGAAAT
ATATTGACCGTGATGTTTATTACTGTTGCAACGGATGGAAAAGACCTGAT
AACACTCATAAAAGCTGTGATATTCATCAAATGTTTGCAAATACCAAGAA
ACAGTGACCAAGCTAGTCAACACGACTTATTTGTCAACTCGTTGGACCAC
TGTGTACTTCAAAACATGTGATTTCTGGGGATGCAAGAAAGTTTCAAGAT
TAGGATGTTACTTGGGAATTTGAGCCGCTCCATTTTTACATTGCTTGGTC
TGGTAGCTGTTTTGAACGCATTCACAATCAAACGACAAGCTTCATCATCA
TCACATCTGAACAGCATCTATGACAAAACAAATGGACTAAATCGTACAGG
ATAGGAACGAATGTTTCTTGGACCAAACGTTATGCGACCACAAATGTCTG
AACACACCAGGAGGATACAAATGCCAATGTTTCAAAACATAAACGAATGT
TCTACAAAGAAAGCATGTGGATGTCAAGCACGAGATGGAGTGTGTCAAGC
CACGTGTACTAATACAATGGGAAGCTACAAGTGCGCATGTCCAAAAGGAT
ATTTCTTGAATTCAGCTGAGCTTTGTGAAGATAACAATGAATGCCAAGAT
CCTTCAAAGAACGATTGTTCACAAGTCTGTATCAATATCCAAGGAGGTTT
CAAATGTGGATGCAATTCTGGATACACACTTGATAGTGATGGAAAGACAT
GTTTAGCCACGTGTGCTTTCGCATGTCAAAATGGTGGGAAATGTGTTGCA
CCAGATAAATGTCAATGTGTAAATGGATACTATGGATCGTATTGCCAATT
CGAACGAAACAAGTGGTATCACACCGATTGGAGACGAAATATATTGACCG
TGATGTTTATTACTGTTGCAACGGATGGAAAAGACCTGATAACACTCATA
AAAGCTGTGATATTCATCAAATGTTTGCAAATACCAAGAAACAGTGACCA
AGCTAGTCAACACGACTTATTTGTCAACTCGTTGGACCACTGTGTACTTC
AAAACATGTGATTTCTGGGGATGCAAGAAAGTTTCAAGATTAGGATGTTA
CTTGGGAATTTGAGCCGCTCCATTTTTACATTGCTTGGTCTGGTAGCTGT
TTTGAACGCATTCACAATCAAACGACAAGCTTCATCATCATCACATCTGA
ACAGCATCTATGACAAAACAAATGGACTAAATCGTACAGGATAGGAACGA
ATGTTTCTTGGACCAAACGTTATGCGACCACAAATGTCTGAACACACCAG
GAGGATACAAATGCCAATGTTTCAAAACATAAACGAATGTTCTACAAAGA
AAGCATGTGGATGTCAAGCACGAGATGGAGTGTGTCAAGCCACGTGTACT
AATACAATGGGAAGCTACAAGTGCGCATGTCCAAAAGGATATTTCTTGAA
TTCAGCTGAGCTTTGTGAAGATAACAATGAATGCCAAGATCCTTCAAAGA
ACGATTGTTCACAAGTCTGTATCAATATCCAAGGAGGTTTCAAATGTGGA
TGCAATTCTGGATACACACTTGATAGTGATGGAAAGACATGTTTAGCCAC
GTGTGCTTTCGCATGTCAAAATGGTGGGAAATGTGTTGCACCAGATAAAT
GTCAATGTGTAAATGGATACTATGGATCGTATTGCCAATTCGAACGAAAC
AAGTGGTATCACACCGATTGGAGACGAAATATATTGACCGTGATGTTTAT
TACTGTTGCAACGGATGGAAAAGACCTGATAACACTCATAAAAGCTGTGA
TATTCATCAAATGTTTGCAAATACCAAGAAACAGTGACCAAGCTAGTCAA
CACGACTTATTTGTCAACTCGTTGGACCACTGTGTACTTCAAAACATGTG
ATTTCTGGGGATGCAAGAAAGTTTCAAGATTAGGATGTTACTTGGGAATT
TGAGCCGCTCCATTTTTACATTGCTTGGTCTGGTAGCTGTTTTGAACGCA
TTCACAATCAAACGACAAGCTTCATCATCATCACATCTGAACAGCATCTA
TGACAAAACAAATGGACTAAATCGTACAGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000885XLOC_000885Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001698-proteinTCONS_00001698-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001698-exon-sc0000011-1575043694:967264..967506TCONS_00001698-exon-sc0000011-1575043694:967264..967506Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1575043694:966448..966576TCONS_00001698-exon-sc0000011-1575043694:966448..966576Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1575043694:963219..963331TCONS_00001698-exon-sc0000011-1575043694:963219..963331Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1575043694:962505..962600TCONS_00001698-exon-sc0000011-1575043694:962505..962600Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1575043694:961952..962077TCONS_00001698-exon-sc0000011-1575043694:961952..962077Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1575043694:961529..961672TCONS_00001698-exon-sc0000011-1575043694:961529..961672Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1575043694:960947..961034TCONS_00001698-exon-sc0000011-1575043694:960947..961034Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1510915933:967264..967506TCONS_00001698-exon-sc0000011-1510915933:967264..967506Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1510915933:966448..966576TCONS_00001698-exon-sc0000011-1510915933:966448..966576Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1510915933:963219..963331TCONS_00001698-exon-sc0000011-1510915933:963219..963331Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1510915933:962505..962600TCONS_00001698-exon-sc0000011-1510915933:962505..962600Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1510915933:961952..962077TCONS_00001698-exon-sc0000011-1510915933:961952..962077Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1510915933:961529..961672TCONS_00001698-exon-sc0000011-1510915933:961529..961672Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1510915933:960947..961034TCONS_00001698-exon-sc0000011-1510915933:960947..961034Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1491911889:967264..967506TCONS_00001698-exon-sc0000011-1491911889:967264..967506Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1491911889:966448..966576TCONS_00001698-exon-sc0000011-1491911889:966448..966576Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1491911889:963219..963331TCONS_00001698-exon-sc0000011-1491911889:963219..963331Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1491911889:962505..962600TCONS_00001698-exon-sc0000011-1491911889:962505..962600Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1491911889:961952..962077TCONS_00001698-exon-sc0000011-1491911889:961952..962077Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1491911889:961529..961672TCONS_00001698-exon-sc0000011-1491911889:961529..961672Clytia hemisphaericaexon
TCONS_00001698-exon-sc0000011-1491911889:960947..961034TCONS_00001698-exon-sc0000011-1491911889:960947..961034Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:960947..967506 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.381636 0.121719 0.615652 0.484518 1.9923 2.00842 7.46357 10.3167 36.5258 44.7557 41.6107 21.7811 179.226 183.883 72.8326 118.314 31.3303 29.8613 94.2206 153.67 36.5124 35.5864 53.9404 69.4652 130.492 116.085 83.7868 74.5761 278.615 241.001
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001881EGF-like_Ca-bd_dom
IPR000742EGF-like_dom
IPR026823cEGF
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR018097EGF_Ca-bd_CS
IPR013032EGF-like_CS
Vocabulary: Molecular Function
TermDefinition
GO:0005509calcium ion binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005509 calcium ion binding
Blast
BLAST of TCONS_00001698 vs. Swiss-Prot (Human)
Match: PROS (Vitamin K-dependent protein S OS=Homo sapiens GN=PROS1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.434e-22
Identity = 56/135 (41.48%), Postives = 78/135 (57.78%), Query Frame = 2
Query:  539 CQCVNGYYGSYCQFDNNECQDPSKND--CSQVCINIQGGFKCGCNSGYTLDSDGKTCLDINECSTKKA-CGCQARDGVCQATCTNTMGSYKCACPKGYFLN-SAELCEDRNECFLDQTLCDHKCLNTPGGYKCQC 931
            C C  G+ G  C+FD NEC+DPS  +  CSQ+C N  G + C C +G+ + S+ K C D++ECS K + CG         A C N  G ++C CP+GY  N  ++ CED +EC   + +C   C+N PGGY C C
Sbjct:  143 CTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGT--------AVCKNIPGDFECECPEGYRYNLKSKSCEDIDEC--SENMCAQLCVNYPGGYTCYC 267          
The following BLAST results are available for this feature:
BLAST of TCONS_00001698 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PROS1.434e-2241.48Vitamin K-dependent protein S OS=Homo sapiens GN=P... [more]
back to top