Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001698-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001698-protein
Unique NameTCONS_00001698-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length280

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001698-protein ID=TCONS_00001698-protein|Name=TCONS_00001698-protein|organism=Clytia hemisphaerica|type=polypeptide|length=280bp
MLLGNLSRSIFTLLGLVAVLNAFTIKRQASSSSHLNSIYDKTNGLNRTGS
NVCKYQETVTKLVNTTYLSTRWTTVYFKTCDFWGCKKVSRLGTKQVVSHR
LETKYIDRDVYYCCNGWKRPDNTHKSCDIPTCAFACQNGGKCVAPDKCQC
VNGYYGSYCQFDNNECQDPSKNDCSQVCINIQGGFKCGCNSGYTLDSDGK
TCLDINECSTKKACGCQARDGVCQATCTNTMGSYKCACPKGYFLNSAELC
EDRNECFLDQTLCDHKCLNTPGGYKCQCFK
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000885XLOC_000885Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001698TCONS_00001698Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001881EGF-like_Ca-bd_dom
IPR000742EGF-like_dom
IPR026823cEGF
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR018097EGF_Ca-bd_CS
IPR013032EGF-like_CS
Vocabulary: Molecular Function
TermDefinition
GO:0005509calcium ion binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005509 calcium ion binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 204..251
e-value: 7.4E-9
score: 45.4
coord: 162..203
e-value: 5.1E-7
score: 39.3
coord: 252..279
e-value: 0.057
score: 11.8
coord: 128..160
e-value: 1.2
score: 1.3
IPR001881EGF-like calcium-binding domainPFAMPF07645EGF_CAcoord: 252..278
e-value: 3.2E-4
score: 20.7
IPR000742EGF-like domainSMARTSM00181egf_5coord: 131..160
e-value: 0.054
score: 22.6
coord: 165..203
e-value: 7.1E-5
score: 32.2
coord: 215..251
e-value: 0.0016
score: 27.7
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 128..160
score: 15.392
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 162..203
score: 6.91
NoneNo IPR availableGENE3D2.10.25.10coord: 121..159
e-value: 1.0E-4
score: 21.9
NoneNo IPR availableGENE3D2.10.25.10coord: 254..280
e-value: 7.3E-8
score: 32.0
NoneNo IPR availableGENE3D2.10.25.10coord: 209..233
e-value: 1.9E-9
score: 37.0
NoneNo IPR availableGENE3D2.10.25.10coord: 234..253
e-value: 3.5E-11
score: 42.3
NoneNo IPR availableGENE3D2.40.490.10coord: 160..208
e-value: 1.1E-15
score: 57.1
NoneNo IPR availableSUPERFAMILY57196EGF/Laminincoord: 216..259
NoneNo IPR availableSUPERFAMILY57196EGF/Laminincoord: 171..213
NoneNo IPR availableSUPERFAMILY57196EGF/Laminincoord: 250..279
IPR026823Complement Clr-like EGF domainPFAMPF12662cEGFcoord: 184..207
e-value: 1.1E-8
score: 34.7
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 178..189
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 204..236
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 252..276
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 148..159
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 187..202
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 148..159

Blast
BLAST of TCONS_00001698-protein vs. Swiss-Prot (Human)
Match: PROS (Vitamin K-dependent protein S OS=Homo sapiens GN=PROS1 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 9.701e-24
Identity = 56/135 (41.48%), Postives = 78/135 (57.78%), Query Frame = 0
Query:  148 CQCVNGYYGSYCQFDNNECQDPSKND--CSQVCINIQGGFKCGCNSGYTLDSDGKTCLDINECSTKKA-CGCQARDGVCQATCTNTMGSYKCACPKGYFLN-SAELCEDRNECFLDQTLCDHKCLNTPGGYKCQC 278
            C C  G+ G  C+FD NEC+DPS  +  CSQ+C N  G + C C +G+ + S+ K C D++ECS K + CG         A C N  G ++C CP+GY  N  ++ CED +EC   + +C   C+N PGGY C C
Sbjct:  143 CTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGT--------AVCKNIPGDFECECPEGYRYNLKSKSCEDIDEC--SENMCAQLCVNYPGGYTCYC 267          
The following BLAST results are available for this feature:
BLAST of TCONS_00001698-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PROS9.701e-2441.48Vitamin K-dependent protein S OS=Homo sapiens GN=P... [more]
back to top