Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001682 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001682
Unique NameTCONS_00001682
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3317

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001682 ID=TCONS_00001682|Name=TCONS_00001682|organism=Clytia hemisphaerica|type=transcript|length=3317bp
AAAAACAGGAAGAAAATATCGGTATccttttatgaaataaagcagaaata
aagtttaaaaaaatatgtcCTGGCTATCAGATTTCACGTCCAAGGCTGAA
AACTTGTTGACCAAGTTCGATCAAACTGCTGCACAAACGTTAAATGAATC
TGGCATACAAGACACACTACATAATGTCACACAACCAGCACCGACCACAG
CTTCACCTTCTTACGAACAAGAATCACCAGTCACTACTGCTTCTTCCAAA
GAATATCAGAATGCATCACATCTCTTTGGTGGAACTCAAAACGAACGGAA
ATCACTACCTACGAACCCAGcttCCACGAGTACTTACACACCTGTAGCTT
CAGTCTCAACAACCACCAGACCACCAGTATTGACCAACAAACCTTTACAG
CAAGTTTCATCCTCTGCAACAAACTCACCAAACATGAGTCGCTCATCTAG
TTCATCTTCTCTCAAGAAGGAGGAGGACATGTTGTTCGAATTCCTCAACT
CCAACCCACCACCAGCAACCGCTATCAAAGGTCATACTAGAAATCTATCA
GGTCCCAAAACCTCGACACCACGACGTCCTTCCGCTACGACCGCTTCCAC
AATCCCAGTCAGCCAAACTACAACGACAGTTTCCACCAGACCAGAAGGAC
CAGCCATAGACACTGTCCCTCCACTATCAGCAAAACCGTCAATCTCTCCT
GTAAACATTGATACAGTTGACGCAGTCCCCGTCATTGAAAAACCGACGAC
GACAACTCAGAAAGAACCACTCATCCACCAAATGAATAGTAAAGAGAGCA
AGGATGGAGAAAGCCGAGTTTCTAGTCTAAATCTTGAAAATACGTTACTA
AAGAATGAATTACAATCGTTGCATGAGGAGTTGGCAACCTTGTCGTCGAA
ATTGAAAGAACAACAGAAAGAAACGGAGAAATATCGAACACGTTACGAGA
ACCGTCGTAACCAACAGAACGAAGATTACGAGCGCGTAAGAGCTGGTTTC
GAGAATCGCGAAGCTGATCTGAACGAAGCTTTGAAAGCGAAAGACTCGCA
ACTGGCTGTGCTTCGTGTTCGTATACAGGAAACTGATGCTGAGTTACAAG
GGAAGACGAAATCATTGGAAGATGTCCAAAAACAAAACGAACAGTTGCTA
AGAGACCACAGTGAAGCATCGGGTGTCCAAGGGACGGTCATGAGTAATTT
ACGTCAAAAGATGGAAGAACTGGAAAATGAACTTCGAAAAGAAAAACTCG
AAAATAGTTCCATGAAGAACGAACTACTGAATGTCAACACGAAATTAGAA
ACAGAACAACAACAGTACGCTGTCAACATCAAAGATCTCCACAGTAAACA
AACGCAAGGAAAAGATAAAACAAGGGAGCTGGAAATGAGAGTAAAAGTGG
CGGAAGACTCCGCTGAAAATTCACAAAAGGAATTGAAAGAATATAAAGAC
AAAGCTGCTCGTATTCTTCAGGCCAAAGAGAAGTTGATAGCGTCATTACG
TCAAGGGAGTGATTCCACCTCAGACGTTTCACCGACTTTACTATCGGAAC
TGGAAGAATTGCGACAAGACCGAGACATGGTGCGCGACGAacttcaacaa
aacaaatataagaTGGAACAACTGCGACAAGAATATCTGGATTTGGATAT
GTTGCATAAGAACGATTCAGATGATAATCAAGACAAAATCGAGACACTTC
AATCCTCTTTACAAGATGAAGTTCAAAAGAGACAAACGGCTGAAGAAGAC
ATGAAAAGATATATTCagGAATTACACTTCACTCGTGAGGAAATACATAG
CTTGAAGAAATctcaaatcagcaaaaatcagGAATACGAAGCTGAAGTAA
AACGCCTTCAAAATCAAGTTAACGTGAAAGCAAGTTCATCATCCTCGCAA
GAAGAACTGGAGAATCGAATTAGAACGTTGACAGACAGCCTCATACACAA
ACAAACTGTTGTCGAAGCGCTCAGCACTGAAAAGAATTCACTCAATTTAC
AGCTGGAGCGACTAGAGAAACAATACAAAGACATTCAGAACAGTTTGATC
AAGCGAAATAAATCAACCGATATCGAAGATGGCACTGGAGaaGCGAAATT
ACTACCGATGAATACCATTATGCCGAAACAAATTACTGGGAATGTTCGCT
GGAGGTCCACCGTCAACGAAATTGATAAATTCAGTATACGACTCGGTGTC
TTCCTGCGACGCTACCCGATTGCTCGTCTTATGGTCATCTTTTATATGCT
CCTACTCCACTTGTGGGTAACTTTTGTCATTTTGACGTACACTCCTGAAA
TACACAACCACGACTTCACGCCAGAATCGCCCaaataaatctttgttttt
aaatgTAATTGTATAGTGGAATTTTATAGACcatttttttagataatttt
ctttttcttttctattgaaatgtctcTAGTAAACATTTGACCAAACTTCG
CATACTGGTAAGCCGTACTTTCAGATGCCCAATAAACGGGGGTTgaaatt
cgcgaattttggtaTACGGGGGCCTTAATTACCAGGGGTTTGGAAGTTCT
ACTTGTAAGTACAAATAAAGTATTCTTACTCTAAAATCACGCTTTTTGGA
TCATAATAATAAGGGACCTTGattgagaaaaaataataaacaggGAAGCC
TAATAAGGGGGGTCTGGAAAAATATACAGAAATCAAAAACCGGGGGCGTA
CTGAAAGTGGCCGCCAAGAATGTGAGGTATCTTGAAGCTTAATGGGAATA
CTTCAGGGATAAATCGAAATCGATGTCCAACCCATCCCTACGCCCTGGTG
TTCATTTATAATTCATTGTTGGAAATACTGATGTATGATTGGTCCATAAA
ATAGAAGCGTGgtatgtttcttattttttatcCTCGCAAATTAGTTTTTT
TCCCTAAGGGTGGGCTCGAATAAAATATTAGATCTAGTAGTTTAAAGTTA
TTGTCAcgagaaaaaagtttgaaaattgctTGTTTGAATAAGTAATTCGT
GCAAAGATAAGAAATCTATCCCAAACTCATTCCCAAACAAATCGCTACGC
TATATTACCCTAGCATCATTGTTGTAAAATAAATTCGACTgcttttttga
atatttttgaacgTGTATTATTTATTATATGTTGCATGGAAAAAggaatt
tatattttttcaatttagtatCAATCAGGTGAATGTATGGAATCGGATCA
AATAATATATAATAAGAACCGCAAAGCTGTCTAACTTTTCCCTCTAAGAA
TGCTAGAATTATTCGAAACTATTTGTTGGTCTAGGTAGTGTTTTGTCAAC
CAATGTTTCGATTTCAA
Run BLAST on NCBI

protein sequence of TCONS_00001682-protein

>TCONS_00001682-protein ID=TCONS_00001682-protein|Name=TCONS_00001682-protein|organism=Clytia hemisphaerica|type=polypeptide|length=757bp
MSWLSDFTSKAENLLTKFDQTAAQTLNESGIQDTLHNVTQPAPTTASPSY
EQESPVTTASSKEYQNASHLFGGTQNERKSLPTNPASTSTYTPVASVSTT
TRPPVLTNKPLQQVSSSATNSPNMSRSSSSSSLKKEEDMLFEFLNSNPPP
ATAIKGHTRNLSGPKTSTPRRPSATTASTIPVSQTTTTVSTRPEGPAIDT
VPPLSAKPSISPVNIDTVDAVPVIEKPTTTTQKEPLIHQMNSKESKDGES
RVSSLNLENTLLKNELQSLHEELATLSSKLKEQQKETEKYRTRYENRRNQ
QNEDYERVRAGFENREADLNEALKAKDSQLAVLRVRIQETDAELQGKTKS
LEDVQKQNEQLLRDHSEASGVQGTVMSNLRQKMEELENELRKEKLENSSM
KNELLNVNTKLETEQQQYAVNIKDLHSKQTQGKDKTRELEMRVKVAEDSA
ENSQKELKEYKDKAARILQAKEKLIASLRQGSDSTSDVSPTLLSELEELR
QDRDMVRDELQQNKYKMEQLRQEYLDLDMLHKNDSDDNQDKIETLQSSLQ
DEVQKRQTAEEDMKRYIQELHFTREEIHSLKKSQISKNQEYEAEVKRLQN
QVNVKASSSSSQEELENRIRTLTDSLIHKQTVVEALSTEKNSLNLQLERL
EKQYKDIQNSLIKRNKSTDIEDGTGEAKLLPMNTIMPKQITGNVRWRSTV
NEIDKFSIRLGVFLRRYPIARLMVIFYMLLLHLWVTFVILTYTPEIHNHD
FTPESPK
Run BLAST on NCBI

transcript from alignment at sc0000011:592890..624504-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001682 ID=TCONS_00001682|Name=TCONS_00001682|organism=Clytia hemisphaerica|type=transcript|length=31615bp|location=Sequence derived from alignment at sc0000011:592890..624504- (Clytia hemisphaerica)
AAAAACAGGAAGAAAATATCGGTATCCTTTTGTAAGTATTTTTTTTAGCT CAAAGGGCCCTAAATCAGGCTGGTAGAATCCATGAAAATATATTGTCTGT TTTTTTAAACAGAATCCGTGTGAGTTTTCCTATATATGATATCCCATAGA CCCTGCCCGACGGCGACGCACCACCCAGCCTGTCCCAGCTTTTATGGATA GATAGATAGACAGACAGACTTGTGCACACCTCTCATTTATTGATTTAAAA TATTAGAATCATCATGGATTGAATAGACGTTTTGCTAAGGCCATGATCAC ACAAATATAAGCTTGTCAGTATAGATTTTAACTCTTATATTCAAGATTAC GAGGACCCTGCCGACGCACCGGACTTAACGAACACCGGACAAGCGAAAGT CCGGTGCAAAATGAGAATTTTTTTTAACCACCGGACAATTTCTACACCGG ACTTAAGGAAGTCGGATGTCCGGTGTCGGAGAAGGATATTTTTTCCCACC GGACAATCAAAACACCGGACATGATCTTTCCGGCGGTGCGTCCGGTGTTT TTTAATTTTTTGTCCGGCGTCCAAAATTCCCTGCATGCAACACCGGACTG ACACCGAACTTGTAGCGAAAGGATACTTTTTGCCACCGGACAAATACACC GGACAGTCCGGTGCGTCGGCAGGGTCCTAGATTACGAGAATTGGAGTCCA ATCTGGAAAGTATAGTATAGTAAGGCCATGTACGCCGGATATCTCCGACG CAGACTTTGGATTTCATAGGCTTACATAAAGGCTACGCCTAGAAATCTCT GGCGTAAATATTCTCTTCTTTCCAGACTGGATTGCATTGGGCCATTCCAT TTTCGAAAAACTTTGTTAACCCCCGTCGGACAACTTGCATTTTTTAATTT TTTGTAGCCTCGGAAATAATTTTTCTTTTCCAGTGGCGATCGGGAATTCC GATAAAAATCCATGTACTTTTGCAAAATGCATCAGAAATTCGACTTTTTT TGCCTTTTTTAATTCAATACACCGTTTAGGAGTCTCACCATTTCACGGTA CTCCATTGCAGAGGCCCGGTAAAAATGGTAGGTAAAAATGCGCACTTTAG TACTGTGAAAGGTTAGAGGAATGTAAACATTGTGAATTTTTGANNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNTTTTCCGTGATCGCTAAAATCAAAACAATGGAA AATTGGATTGACGCGTGCGCAGTCGACACTCCTAAACGGTGTATTGCCTT GGAAATTCATACCTTTTCTTCTATTGCCTTGGAAATTTCGAATTTTGGTG AAAACTTTTGCCCTCGGAAATCCTGTGTCGTCCGCCCCCTGTTACAGACA AATTCTGGAATGGCCGATTGGAGTGCGGGCGCCAATTTTTCTTTTGTTTT CATTGGTTTCATTTTTGATTTTTAAGCCAACATCTTTTAGTAACTGGGTG CACTTTGCCCATAGTTTATACATGGGTTTGTGTGCAATAACATAATAAAT AGAGAAATAAACAGCTTAGTGTAGAAGAAGTTTATAAAAAAATGTCTACA AAGTAGTTTATCCTCATCATATTAACAGATATCAGCAGCGCAGACAAGTT CTTTTTTGACGATTGTATTGACTCAAGTGAAACTCAGAAAAATCAAGTTT GATATAATAGTATAATACTTTCCAAACTTCCTCCCCCCCCCTTTCTTAAG GAGGGGGATGACACCTTCCGAAAAGTTCAAGAAGGGGGGATCAGAAATTT TCATGAAAAAGGGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTTTTTTCT AAAGCTTTTGTTAGAATACAATAGCTATTTATAAGAACAAAGGAAATTTT CGGTTTTTGCTCACCTTGGGCATGATGAGTGACGTCATCAAATTCTTGTC AAAAGTTACCTTACGTGACAAAGATCTTGTGTGCGAAATTTCACCCAAAA AGACCAACTAGATCAAAAGGTAAGGGGTGGTACAGGAAAAGCCCCCCCCT AGTTCTGAACCGCCCCTAAAAGCCTAGGTTGAATAGGGTTAAGAGCGGGG CAGGTCCAATAGTTTGAAACTTAGATTTTTTTCATTTTTGGATATGTTGT TAAGTACAATGAACTGAGTAAAATCCCAAANCGATTGGAGTGCGGGCGCC AATTTTTCTTTTGTTTTCATTGGTTTCATTTTTGATTTTTAAGCCAACAT CTTTTAGTAACTGGGTGCACTTTGCCCATAGTTTATACATGGGTTTGTGT GCAATAACATAATAAATAGAGAAATAAACAGCTTAGTGTAGAAGAAGTTT ATAAAAAAATGTCTACAAAGTAGTTTATCCTCATCATATTAACAGATATC AGCAGCGCAGACAAGTTCTTTTTTGACGATTGTATTGACTCAAGTGAAAC TCAGAAAAATCAAGTTTGATATAATAGTATAATACTTTCCAAACTTCCTC CCCCCCCCTTTCTTAAGGAGGGGGATGACACCTTCCGAAAAGTTCAAGAA GGGGGGATCAGAAATTTTCATGAAAAAGGGGGGATAGCAAGGAAAGGGAG ATAGTTTAAGAAGGGCCTTTATTGTTTATAGACTTAACTCTTCATACAAA AATTACGGGAAGCGCATATTTGAACTTTGTACCCTACTGTATGCTGCACG CAAGCACTTAAGCTAAAGCGCAAAAGCGGGACAAAAATCAGTTTTTTGAA GAAAAATCTTTCAAATTCAGTATGTGAATAGAGCAGTAAAAAATACAACT TTTCTATTTTTCCTTATTTTTGCAAAAGTTCTAGGAATGAAAATTAAGAG CCAGTTTTTTTACAGTCAGGGAAATCCCTCAATTGCCATATACTGCAATT GCGGTAGTTTTCATTCGTGATTAGCCTACAAAGGCTTATAACAGCTACAT ATAGTGCTGGTCGACAAAGATAAAGAAACATTGACTGTAAAAAATTGTAC GAGAAGATAGCTTTTTTTTATTAAAAGAATCTGATCTACGGAAAAAATAT TTTGTCTGTGCATTAAAAAGATATGATCAATTATGTACAAAAATTGCCTG TTTTCTCCTTGAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGGCGGATTTATGCCAAT TTGAAGTTTTTGACATTTTTGGGCATTGCACTTAAAAAGTTTTTTGATAT AGAACCATGCTTTCTCAAATCAAAATGAGGAAATTTTTTTGGGTGATTCT GAAACTATGGCCAGTAAACTATACAATTTTCCAAAAAAATCAAAATTTTC AAAATGGTAGCTGGAGTTATGACGTCACAAAAACACTACAAATTTGATTT TAGGGGTATTTTTAGAGCCATCTGACCTGTCCCAGGGGCGTTTCTTACTG CCCAAAATAATATTTTCTGGTAGTTTAGTCCCTGGGCTATCCATTTGAAG TGATTGCAATAAAAAATTCCGGCCCTACTGGCCCCTAGAGGCCCAAAAAG CCAATAAGGTCTCAAAAAAGTACCAACTTTAGCCCAATTTTCCTAGAAAT CCCAACATTGTCTGACCTCCAACTCTTCTGTTTCTGAAAGACAACTGCCT GGTCTCTTAGGATCAAAAGAGAAACCTATGTGATCTCCTACCATTAATTG TTTATCTTGATTTAAAAATTTTCTTAACATCGCTCGAAAAATGACTAAAA AATTTGGGATATTTTGGCCCATTGGCAAACTTCAAAGGGGTCTAGGTCAC TGAATTTGCTATAATATAAGGGCTATGATGAATCTTTTATATAAAAACAA TGAAACTAGGTGAAAAAAGTTGTCAAATGTGCTTTTTTGGGCCAAAAAGG CTTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNAAAATATTCCTAAACCTTTCCTTCTCTTTGTATAATTTGAACTTTG GGCTCATTAACAGCAAACAGGCTGATAGCAAAATTGTATAGTTTCAGAAT CACTCAAAATCAATTCCTCATTTTGATTTGAGAATGCATGGTTCTATATC AAAAAACTTTTTAAGTGCAATGCCCAAAAATGTCAAAAACTTCAAATTGG CATAAATCCGCCATTATGGATTTTCAGNATTGCAGCCAGTAATTGGCAGT TAGAAAATAAATTTTATCTGAAAATCTTGATTCCTCATCACATTCCAGAA AGGTTTCTAGGAAAATCAAATATGGTACTCTTCGAAAGCTTATAGAGGCT GAATTTTCACTCAAAGGCGGCTTCTAACTCCCCNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAA GGGATAATGATAATTGAATACTATCCAATGATGATGATCTGCGGCACTAT CGTAAAGCTAGAATGGCTTGGCATACTCTTTTTTGAGAAGATGATTGACA GATTAAAGTTTTTCACCTGTGCAGTAGCTCGGGGGTGTTCTGCAAGCATT TTTGGCTCAATCCGCGGACCGCGCTAAAAATGGTAGACCTAGCTGTGACA GATCATTTTGATGGAAATTGTTGGAATGTTTATAATGACTCTTGACAGAA AATCCTTTGTTTTAATTGTCAATGATGACAGTGAATTGACAGTGCTGTTA TTAATTTTGTTAGATCTGACAATTTGATGTTTGTAAGTGCACTTTATAGT TTTGATTCCCATTGAAGAATCATATACTGGTTTTCATGTTATTAGATGCT GTTTTAGAGCTTTAGAGCTAGCCTGAAGAGGGGGGGCTTACACATATATT GTAGATTATTTTCCAGCACAGATTATGAAATTTGGTCTCATGAAAGGAAG TTTTCTGATCGAGTAGTCTGAGTCAAAAAGAAGAAAGAAGTTTATTATTT CGCTTTCTCTCTAAGATATTTCACCATTTGTTAGCTATTTTTGTCCAAAA TCCTTGGGGGATAAGCATTTTTAAAGGTTAGGGGGGATGCCAAGAAGGGG GGATCATTTATAAAGGGGGGGGGTCAAACCCCTTTCCGCATTATGAACTT TCCCTTTGCTTTCACTACGTCACAAAATAGAAGGGGGTGTCTCATTCTCC TTCGTAGAGGAGCTTCATAATTGGATAAAAGAACAGATTTTTGAATCGTT CTTTTTTTTGTTTGATTACATTTTTTATGCCCTATAATTTTAGGCAAAAT AATGCAGGGGCAAAATGCAAACCTCAATTCCCCTTTAAGCTTATCACTTG TTTTGTTTAGTTGATATATTTTAGCATATGTAGTTTAATTTGACAGCTTG GGAAAGACTTTCAAGAAATGACATGCGTGTCATCAATGCCACAATCAACA AAAGAAACCAATAAAAGATCAAGGAGAAAAAAAGCATAAAGTGTCAATGT GTATTATGTGCTCAACTATGTAAGCATTTTATTGTTGGAAAAGGAAAGAG AAAAAAGGTAAGTCTAGCCTAGCATAGCCTAAATGTCAGCTGTCAGGGGG TGTTAAAAAAATTTAAGAGCTTATTGATATCAAAAATAAAACACAGAGTT TTCCCAAGCTGTCCTAATGGACCATCTCCTTAATATTTGTTTGGGAGAAC AAGATGACCTATTGAATCTGTTCCGCATATTATTATCTACTCCTTATTAC AGAATAAGACTCTATACCTTATAATTATAGCACGCTGCAAGGGAGAAAGT TAACGTACCTATCTGAACTGATCTGAACAAAACTTATTTATAGGTAAAAT CTAATTTCCCGCTGGTTTTACTTGCATCCACTGAAGTATATTCTCAACTT CAGTTGAGCTAGAATCTGACAATGTATGTATGTGTGTGTGTATGTATGTC TGTCCGAAAACTTTGGGGCAGGCTGGAGACTTCAAAAATGATCAGGTTTG GCTAAAATTTGGCACACTTGTTCCTTGGGTGAATATCTGGGGGTGTTTTT TTCATTTTTTGAAAATTTTCATTTTTAAGGGCGTGGTCATGAGTTTNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAA ATTTTCATTTTTAAGGGCGTGGTCACGAGTTTTCGCCAAAACGAGGCTAA AACTTTGGGGCAGGCTGGAGACTTCAAAAATGATCGGGTTTGGTTGAAAT TCGGCACACTTGTTCCTTGGGTGACTATCTGGGGGAATTTTTCTCATTTT CTGAAAATTTTAATTTTTAAGGGTGTGGTCACGAGTTTTTGCCAAAACGA GGCTAAAACTTTGGGGCAGGCTGGAGACTTCAAAAATGATCAGATTTGGC CGAAATTTTGCACACTTGATACTAGGGCGAATCCCTGGTGGCGGTTTTTT CATTTTTTCAAAATTTCCATTTTCAAGGGCGTGGTCACAAGTTTTCGCCA AAACGAGGCTAAAACTTTTAGGCANNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNCCCAGTGCGGTTAGCACGTTCGACAGTAGGTATCATA ATTTAAGCTGTTGTAATTAGTCATTAAGTTGCAATAGACCAAACACAAGT TATTTGTAATGGCTACTTTACCCAGAAACTAAAAATTGCATTTCAAAATG TTGTTTGGACGTTTTCTTACATATGGCCAGCGTAAGCTCCTCATACATTT CTCCTTAGCTTGCATCCAAGCTTTTCTTTGGATTAATTTGAGTCTTTTTC CAAAGTCTGCAGAACAATTCAAAACTGCACTGATAAAATTAGTGTATATA AATCTTGTTTTTAAGGAATTTTGTTCAGCTAGGCTGAAATCACACTGTTT TTTATCATATCCCTTACTGTATTCAGCATTATTTCTTTACATGTTAGCTT GCAACTGCTTTTTATTAGGAATCTTTTAAGTTTTATAGGTTATTTACTTT TTATTTTTATACAATCTTATAACTTGTATGTATGGATAATGGGTCTTAGG ACCTTTTGATACTTAGAGCCTGAACCATTCATGTTTTTAAAAACACCTTG CTTACCTGGTTTGCAGAAAACACTTTCCAGCATGAAAGGTTCAATTTTTA AAAACACCATAAACACCAAATTTCCTGTCGAAGGCGACTGCTATAAAACA AGTCCTGACTGGCTGAAACGGTATCGAAAAGTCCCATTTCCCCGTTTTTT TTCCGATTTTCTAGCCCGATTTTTAACCCGATTTTTATCTGATTGGTTCA GTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNCTTAAAAATATAGATAGAAGTCATTTCCCAAGT CTTCAGAACACCCAAAAGTTTCCAAGTCGATAAAAAGCTAAAAAAGAAGT CTGGTGTAAAATATTCACATAATGAAACACCGGACAGTTCTGTCAGACAT AATTTAATAATACTTTTTGGCGCCAGACAAAAACACTGAACAGTCTGGTA GTCTGGTGTGTTGGCAGGGGGTAGTGTTATTTTGAATGTCAATGTAGGGA ATTCCTTTCAATAACATGTAGAAATCATACCCTTTTTGGACTTTCCTTAT TGTCTAGCATGATTCCTTCACTAGTCATCTTACATCCATTTTTCTTTCCG ATCTTTTTGAGCCATTTTCAAAATCTGCAGAACAATTCAAAGTTACACTA CTAAAATTAGTGTAATTCTCGTTTTTAGGGAATTTCCCTCATGCAGGTGA AAGCCACACCCATTTTGGTTATTTCAGTTATTCAACATTGTTTTGTCTTT ACCTGTTAGCTTGTACATCTTTTTGGTTTGGGGTCTATAAAGTATTTTCT AAGTTTGGAGCACTCCGCCCGCGTTAAGCCTAAAACCATACAAGCATTAG GTTTGCTTTTTCTACCTAGTAGTGCACTGACACTGGTATAGCAAAATCAA TATAGATAAATATTAAGTGCTAAAAAGTTGATCTAATATCAAGCTATCAT GTGTCGTCATTACATAATGTTTTCACTGCTAATTATACTGAAGTTAAAAT AATATCCGAATAGCAAAATGTCTATAACCCTTGCCTGGGTCTGAAGAAAA AGGGAATAATGAACAAGATCGTTTCATTTTCTTTGCTGCTTTTCTAAGCT TTAATAATTTGGTTCACTTTAACTGGGGTATTGCAAAAAATAGAAAATTT GCATTCCTTCATATATTTTTGAAACAAATATTTTCTTTTCTTCTTCTCTG AGATAAGGGATCTTCTCAAAAATAAAATCAATTATTTAATCAAATTTAAG CGAAATATTCGATTATTTTCAACATGAAATTCGATTATTTAAGTAAACCA ATTCGATTATTTAAGGGAACCAATTCGATTATTTGAGAAAAATATTTCGC TTAGATACTCGAATTTCTCTATATTTTAATCGAATTTCGATAATTGATAA TCGAATTTCGACTAGAAGGATAACCGAATTTGAAATCAATTGGAAGCGAA AATGCTTTTAAAAACACTTTTAAAAGTATAACAATATCATCATAAATATA TTATTAGAGAGTAAAATTTTATGTTTTGCTAAAGTGACATTGAGATCCAT TTTTCTAGGACTTACTATTGTTCAGGAATTTGTAAAACTGGCCATGAAAT TCACCACAAGGTTCGTCACCGCTTTGTGTCTTTTTATTTCGACCATGGCT AGCTCAAATAAAATTCTTATACATCAATTGCACCACAGAGCAAAAACAAC CACGATAAAACAAATTTTCTGATCTCTGACAACTTTATTGGTTCATCTGA AACTTTTGTTTATTTTTTTTTGACAATCGAACATTTTAGAATTTGAAAAT TCGAACGTTCGAATTTCGAATAAAAAAATTCGAAAGAGGAAGTAAGTACA TGCTTTTTTTATAAGAATGGTGGTTTTCCAATTTATCATGAATATCTGAA TATTCTTAACTTTTTGGAAAAAAACGCAAAAAACTTACCGTCACAAACGG TTCTAAGTTTTAAAAACTGTATGTGACGAATGGTTTTTCTTAGTTTGTGA AGTTTATCGCTTTTTTAAACAGAGGTTTTCCTCGTATTCTTGCTTTTAAT GATGAAAATTATTTGATTTTTCTTTGACTTCAAACAGAGTCGCTGAGACA GGGGTGTAGGGAAATTTAATAAGGATGAAAATCAAATGATTTTGCTTTGA TTTGCAAATGATTTGCCATTTTGCTAAATGTCCAAAAGTGAATCAACACT GATAAAAATAAAGTCTTATGGATAAAGGCTCTCTTCGAAAACTGAATAAT TTTGAAGGCAGGAAACTTATACAGTGAAAACTGAAGCAAACAAAGAATTC CATTTCTCTACATACATACCTCTTACAATCAAATCTCAATTCAATTAATT TTATAACTTTCCTTCAATCCTCAAAGGTTTTTTCAAAAATGAGTAATAAT AAAATCACAATAACTTAGGTTTTATTTTTTGAGAAGTCCAAGTGTTATTC TTTTCAAAGACAAAAGTCACAAATGAAACCTTTTTGTTTTGATTGCGACA TTTTCGAATCTTTCGAATGCGTGACGCGCAATTTGATTGTCACAAAATAG AACTCGAGCGAGAAACAATGTAACGACTTCTTTACTGAGACGACAGAGAT GAAGCTAAATAATCGAATTTGAGAATTCGATTAAATAATCGAATTATTTA TTTGTTGCTTTTAATAATCAAATTCAAAAGGAGTCAAATTCGCTTAAATA ATCAAATTAATTAGCTTAAATAATCGAATTAATTTGCTTAAATAATTGAA TTAATTCGCTTAAATAATCGAATTCAACCGCTTCAATAAGCGAATCATTA ATCGAATTGCATAGTCGAAATTCGATTATTATTTTTGAGAAGATCCCTAA GTATACCTGAAAAGCCACCAGAAGGTCGGTTAGTGTAAACAAGGAATTAT TATAGACACTGGAAAAACTGGAGTATTTATTGTTTTCAAAACTTGTCAAT CTATATCCACTTGCAGCCTCAGCATCCTATTATGCATGAAAAATATTTTA TTGTTAATTGGTGTACAAAACCTCATACTTTGAGATAACGGTTTAACGTC ATTATTTACATAATTTAAGTGTCATTTGTATGTTGCGTGTGCGTTACCTA CAGTTTTCCTGTCTATAATTTGTATGACCTGTGACCTGTAACCTGGGACT TGTAACCTGTGGTTTACACTAACCAGAAGGTTCTAATTTTGAAGAGATTT TAGTTGACTTACGTCCGAGGGATCCTGTATTCTTCAAAAGTCGAAATGAT GGATGAAGCTCACCGAGTTAAACATTACGCAACAGTAACTTACAATTATT GCGCAATTAAAGATTTCTTCTTTGCAAAAGAGCTATTAAATAATAATTGT ACATCGTTTTGTTCACTTGTAAAATAAAAAGTTATCAAATGTTATCATAA TTTTATGACTTGTGCGAATATGAAAAGATTATAATGACTGAAAATTGCTG ATGTTTGAATCACGAGATTCCGGGAACTTTTTATTTAGCATTGGCATAAG TGATGTACTATGATGGTGAAAAAAATTGTGTGACATGTGATGGATTTAGC TTAGTTTACTTTAAGTAGATAAAATTTGGCGCGGATTTAATTCGGCGATT TGCCAAAATACGATTTTAGGCGGGGATTTAATTCGGCGCGATGGATCAAT TGATTGATTTGGCGAAATGCAAATTTTGAGACACTCAACTTACTATAAAA TATTTAACTCAGCGAATTTGTCCGCCAAAATTTATTCACTTAAGATAGTT GATTAGTCCCCCACCAGAAGGTTGGCTTTATGAGATTTCAGGAGTAACAC AGATGTTTTTGTATGTTTTGGTATTTTGTTGTTGTAAAGTTCCATATCAG ACGTTATGCATGTCACTTGATTACGCAGTAAGGAGTCTGAGTTTTGTATG AATATTTTTGAATTTCTTTGACAAAATCTTNGTCACTTGATTACGCAGTA ATTTTTTTTTGTTTGAGTCTGAGTTTTGTATGAATATTTTTGAATTTCTT TGACAAAATCTTTTTTAAACAAACTAATGATCATATTATTTTTTTTGTGT GTGATTTAGTATTATTAGCAACCTTATTTTTATAATCTGAGGAAGGATTG GTAATATAACACTTGTCTTTTGTTTTAGGTTTGAAATCAGTATGGTAAAA TCAATAAAAATTATAAATCTTGAGCCTGGAGGGACATTGTTTCCTGTAGA GGAGGCACAAACACTTGATAGCCTCTCTAAAATACTTGAACAACTTTTTC AAATCCCAAAGGAGATTCATGTTTTCTATGTTGGGTTTGTAAAGCTTGAC AATGATTCTTATGTCAAGTTGATAACAGATGGAAAATCAAACTATTACCA GCTCCAATTTTTTGTAAAAGGAACCCCTGATAGTGATGTTGTTCATCATT GTAATGTTATTGGACTGAATAAAGAACTCCGAAGAATAATTATCAGAGAT CGTAGTGGCAAAGAAGTCCTGTCATATAAGCCAAATTTGAACTCAATTGT TTATGACCTTAAAGAAGCTGTCTACCTAAAAACCAAAATGGACCCTCGAA ATCAGGTACTTGCCATTAAAAATGAACATGGAAAAGAGGGTGTTCTTGTT GATAATTGGGCATTTCTGACTGATTTATATTTTGAAAATGCTTTAATGAA AACAGTTATTAATTTGAAAATAATGGTTGACTCTACAACCCTTAGAGATG AAGATCCTCATAACTGTTTTCATTTTGATTTACCGTTCTTATCACTGGTA AATATCAACATACCAGGTATTGTTGGCAATAGATCCATAACGTACCCTTT ATTGGAAAGGGGAGATTTTAGCGTTCTTTCTTTAAAAGAATGGATTGAAG AAAACCATGGAATTCCAAAGTTTGATCAGCTCCTCCTGCATGATTTCCAG ATTTTGGATGACAATCGCCAAATATATAAATTCTTTCCACCACGGCGCTC TTTTGATCCATTTGAGATACAGGTTTTTGTCTATGCTACTCGGGATGAAA AGTTGCAAAATGTTTATGCTGAAAACAACATTGTTACTTTGAACCCAGTA AATGTGATTAATACTTCTGACCAAAAGCTTTTATTTACCTATTACTATGA AAAGAGATATTTAACTCGTTCTGCTGAGATGTATGCAAAGTTTCATATTG AAGATTTTATAGAAGAAAAATACGGTTTTTTGAATAGAAACCAAGTATTT TTTATGAATGGAAGATATCTTTCAAGTTTAGAAACAATAATTAGAGGACA ATTATCAGGGAATATTCCATTGGATACTGTCATTGATATCAATTTAGCAA TACAAGTATATGATACTTCTAATCAAGATTGTATAACTACAGCCTCTGCT AAGGGTATTGATTTGATCAAAAATGTTATTATAAGGCACCCAAACAAAGA TACAAAAATCGCTGAATATGCAATAGGATCAGGGACTGTTCTATTCNGTA AGGCACCCAAACAAAGATACCAAAATCGCTGAATATGCAATAGGATCAGG GACTGTTCTATTCCTTAAAAAGAAAATTTCTGAACATTTCACTGTTGGTG ATAATGTTATCGAACTTTTTAATGGAAACAGAATTTTGAATGACTCTGAT TATTTATATGATGTGCTCATGAACCAAGATTTGTTTGAAGAAAATTTATA TTTGACCTTGCTTTTAAATCCAAACATCAATACAAATGCAGTTTCTTTCG CTGCGAGGTTATCAATTACTTATTTAAAGACTGCGGATGTAAAATTTTTG ACAAGAACTTTTTCTATTGACCTTTGGAAGCATCAAATAAAGACTGTTGC AGACCTTAAAAAAGGAATCGAGATGGAAGAAAATATACCAAGACATTTAC AAAAAATCTTCTTTAAAGAAGACTTAGATGATGAAGTAAAATTGGTTAGT TTGGTTGTGCAAGAAGGGTTTTTCACACAGGAAACCATTGCAGTGTCGTT GATTGTTACTTCTGCAGATATGTTAACACTACACCTTCACAGTAATCTTC AGTTAAGGGAGACTCACATTCAAATCTCTGAAACTGAGTTGGTTTCAGAA TTAAAAGATCGTGTAAGTCAACTTTGTGATGTAAACAAGTCCCTCTTGGA CCTTGAAAACAAGGCAATGATATCTTTGAAAGATGAACAACAGATTTGGG AATGTAAACTTAAAGACAATTTCATTAAAGTTCACAAAGCCATTAGTGTA CAGATTTTACGTAAACATCTCGAAAACCCAAAACAATTATCTTTTCATGT TTTGAATTTGAATAAAGATTCAGTTGAAACAATGAGAGTTGCGTTGTCTA GATTTTATCACTACCAAGGAACAGTACTTGTATTTAAAAAGAAAAACAAT TCTGAGAAAGTATCAGGGAAAACAAAACTAAAACACCTTGAAGAATCTGT TACGTTTAATCTGGAAGAGAGGAAAAAAGATTGTGTTGTATCTTAGGAGA AGTGAATCACTACTTGCGTAGCAACAAAACTAAATGACTATTTTATAAAG GTTCTTTTGTATGTCAAGGTAAGGAAAACAAATTATTACTATTTTTTATT ATTAAAATTATACAACAAAATAGATCCTTTAAAGAAGGATAATCAGCTTG GCTGAATTACATTTTTTTGTTAAAAACAACTGACATTTGAAGATGATTTT GATGATTTTTATAGATTTCTAAATTTTTAACTTAGATCTCAACATTACAT CTCAATAGGTTGTTGCTAATTATTTTCATAATATTTTCATGATAAGTGTA AAAATATGTGAAGTGCCTGAGCAAAAGCTATTGTTATCAAAAGTTTTTAA AAGCATTCTTGAGCTTTTCTGAAAATTTTACAGGAATTTAGCTATTTTTG TCTACAGCACACTTTCTTCTCTATACTTTATTTTTAAGAAAAACGTTTGC AATTTTTGAATGCATCTAGTGCAATTCACACAGAAGTATTAAAATATTTT TTTTCATTATTCAAAAATGTATATAGAATTTTATTTTTTCATGTCACAAA TTAATTTCATATCTTGACTTTTGATAAAAGTTGTCTTTGATTCAATCAGC AAGATGTTTTATATAGTTTCTGACTGCATTANACTTTTGATAAAAGTTGT ATTTGATTCAATCAGCAAGATGTTTTATATAGTTTCTGACTGCATTAGAG ACTAAAACAAGTATTTTCTTATTTTCTGGTTTTAATATTGGGAGATGACT TTTGTAACCCGAGGATGGAAAAAAAATGAAAATAGAATTGTTTTTTTTAA ACTTTAATATCAGAAAAAATTAAATAAAATGTGTTTTGAGGAAACTAACA TAGATACAAAATAGGGAAATGGTGTTGAAATGCCATTAAAAGAAGCATTT CCTTCCCTGTTCTTATAAAATGAAGATTTCAAAAAATTTCCAGACGTTTT TCCAGATAAGGTACATCAGGTCTGAAGAACAAAAACCAATAACATTTGTG TGAATTTTAATTTTATTTTCATTTTATTTTTACTTTGGCAAAAAGAACGT TGGAAAATCCATAAACCAGAAAAATAAAAAAATTGATTGCCTGAAGAGTT ATTTTGTGTTTTCCTGTTAGTTTTTGATTGGGATAGATTTGGTCATCATG ATCATTTTTTTAAAGGATCGTTTTCTTAAGGAAATGGTAATTTGCTCTTC AAGAAAAACAATTACAGAGGGGGTTGAGGATTATGTGATTTTGTGCCATT TTGTATCATTTACAATTTAAATTTTAAACTTTTTTTATGTTTGTGAAATG CTGAGGGTTTGAAAAGTTCTGGGTGTATATAATATAATGGTCTCACCTAT TTTTCACTCAAAAGGGTGTTTCAAAACAATGAAGAACACTTTTGAAGGAG GACTACTTTCATGAATGCTAGAATGATTTTTCCCTTCAAACTATTGGCTT TCAGGTCATATATTTTCATCTCATTTATACATCTTCAGCCATTATGTATG CTGATCAACTTTTTTGAGTGCATCTTCATCATAAGTATGTTTCTTAATTA TTTTCTTTTATATTTTTAGATGAAAAAATGAGTAATCCATTTAACTTGAC TTTACATGTGACAAATTATGTGGCAAAGTCACTCCAAGATCTTCAGGAGC TAATCGAATATAGATTTCACATACCAAGAGATTTACAAGTTTTTGTTTTC TCCAGTACAATTTTGACTGACGAAATATATTCATATTATATGAGGATTGG AGAAATACAACAACACAGAATAGAATTTTATATGAAAGGGACTTCTGATT CAAATCTGTTACAATTATTTAATGATGCAAAATTAAATCAACGCCTGAAG CACATCAATATATATGATACCAGAAGAAGAACTATTGATGAGATTGAACA ACCAAAATTGAATTTAACACTTACTGACCTCAAAAAAAAGGTTTTTTGGA GAACTGAAATAAAGCCTGAACACCAAGTGTTTTCATATAAACAGCCGCAA AGAACAGCAAGATCTACACAAAAGGATATGCAAATCCTAAAATATGATGG ACAGTTTTTGGTTGATCTTTTTTTTGAGGGAGAGTATTTGAGAAAAATAG TTGACCTATATTTAATGGTTGACACAACATTGTTTACAGGACAAGATGAG GCTAACTACATTAAGGCTCAACAACATTTTACTCACATAGCTATTCCTGT TATTAAAATTAGCTTACCTGGAAGGGGCTCAGATATTCTTTGTGAATATC CTATAGTTGATGTTGGTTCCTTTGCCGTTGATGACCTCAAAAGTTATATT AAAAAATTGTACGGTATTCCTGAAAAAGAACAATTATTGGTATTCAATAA TTCTGTTATAGAATCTTTATCATTGGATACTTTATTTTCATCAGAACTTC CTACAGATCCTTACATAATATCTGTATTTATTTTTGGTACTGATAATCAG GAGCTATTGAAGCTTTATAATGAAAACGGTTTATCTATGATGAATCCTAT AAATATTGTCAATCCAAAAGACAAAAGGAAGTTGTTTACGTATTATTTTG AGAATGGTTATGCAGAGGATGGTTTGGAAAGATTTATAGAAGAGAATTAC CAAATACCAATATCTAAACAGGTGCTCTTTTGGAAGGGAAAACATTTGAA AAATTCAATGGAAATATATTCTAAATATTGGGATGGTTCAATTTCAAGAG ATGAAATAGTGTATGTCGATTTTGCAATTAGAATTGATGTCCAGACTGAA TGTGACCTTGTGGAAAACGCTTCATCTCTTAATCTAAACACAATAAACAA TGCTGTTGTATTACATCCAAATAATGAAGAAATTGTGGGAAATTTTTCAA TGGATCTCAGTATTGAGAAACTTAAGAAAGATATTGCATCTACACTCAAC TTTGATGATTGGAAGATCATTGAATTAAGCTACCAAAGTTGCCTGCTGAA AAGTACGGATAATCTGTACAATTTACTGTTTGAGGGAAAACATTTTTCAA ATGAATTACATGTTAATATGCTGATCAGTCCTACCAAAAACACAAAGATT CAAGAAGTTTGCAAAGAAAAAAATATCCCTCTTTTAAGGAGAATCAATGT CAAGCTTCTAACAGAAATTATAACGATAGATGCTGGAATAACCGAAATCA GAAACATATCTGAGCTTATGGAAGTCATTCAAACAGAAAAAATGATACCT AAGCACATGCAAAAGATCTTGTTCGACAACATGGAGCTCAAAGAGGAAAT TCAATTAATGGAATTTTTACTTGAGAATGATTTGGTGATGAATGATGAGA TATCTGTATTATTGATTGTCAGCACTCCTGAAGTAGTTACCGTTGATCTG GATGCTAGTTTCAACATACAAGAAAATAAAATCCAGATTGCTGAAACTGC TACTATTCTACAATTGAAAGAAGTCGTTAGTGGATTGATAAGTGTCCCAG AATCTCATTTTGATCTTGTTAATTTGCATGATATCCAGAGAATTAAACCG CTATTGAACGACCAGCAGATTTGGCAAGTAAAACAAAATGGTACCTACAA AATTGTTGTTATCAAGAAAATCAAGATTGTGATTCAGAAAATCAATGAGG ATCCTTTGAATTTCTTTTTTCCAATCACTAATTGGGAATCTGAAACAATT GATAGTATGAGACTGGCATTAACAGAAGATCGCTTTCCAAATCAGCCAAT GAAACTGATTTTTAAAGAAGAGGATTATGATGGTGTCTTTGCAACAACAT TGTTAAAAGATTTGAATGTGCAAACTATTTTTTTCCATTCGGAAAATAAT AGTAATTGTGTAAAATGTTCATTGATGTAGAGTCTGGTATTTTTAAACAT TTGTGTGATGGTTTTTTTTAGATTGATCTTAGAGTAGTTGTATTCATGAT ATGCACCACTGGAGAGTCTTCCGAGAACTTTTAAAATTTTCCACCCAATA CGTCACTTAAACAACAGAAAAAGTGACGTATTGGGTGGAACAAAAACAGA AAAGTTGCATAATTTCGTGAAGTCATTGCAGTGGTGCATATCATGAATAA GGCCACATTAGACTTAATACATTATCTTCACTTCTGTTGCAACATTGAAT CCTTCAACAATAAACAATGTGGAACATTTTGAGCCAGCTTTTGTAGTCGT ATTTTCTGTTGAAATAATTTGATATTTTTATAGTAAAACTTTTTTTTAAA GATTTGTAGCCGTAATTTCTGTTATAATAATTTGATATTTTTATAGTAAA ACTTTTTTTTAAAGATTTGTAGCCGTAATTTCTGTTATAATAATTTGATA TTTTTATAGTAAAACTTTTTTTTTAAGATTTGTAGCCGTAATTTCTGTTA TGATAATTTGATATTTTTATAGTAAAACTTTTTTTTAAAGATTTGTAGTC GTAAATTCTGTTATAATAATTTGATATTTTTATAGTAAAACTTTTTTTTT AAGATTTGTAGCCGTAATTTCTGTTATGATAATTTGATATTTTTATAGTA AAACTTTTTTTTAAAGATTTGTAGTCGTAAATTCTGTTATGATAATTTGA TATTTTTTTTAGTAAAACTTTTTTTTTAAGATTTGTAGCCGTAATTTCTG TTATAATAATTTGATATTTTTATAGTAAAACTTTTTTTTAAGATTCCATA AACAATTTATTTTCGATGCATTTTCGATGCATTTTCGATGCATTTTCATC ATTTTTATGTAATAAATGGAGGAAGTGAATTAAAGTCCTTTTGAAATATC ATTTGTAGTTCTTTTCTTGTGTAGCAAAAGCGATACACTACTTAAAGCGA ATGCATGGACTTTAATAAACGCTTTTTTTGAATACCGGGTGACCCACGAA AAAGTTCAGACGTTTCCCGACGTCTTGAGGCCGAACAAATGTCCCAAAGT GCTTGGAGTTTTGATATTTAGAAAGTAGATNNNNNNNNNNNNNNNNCATC ACTTTTTAAATTTGACCAACTTGTTCTCTGCTTATGAGCTTTTAAAGTCA AAATTCACTTTTCGAAAAGTGTAAAAAACACGGTAGTTTATTTTTTATTC AATTATGATGTATTTTTTATATTACTTTTCAAGATTATTCAATAACTTTT AGCTTCGAAGTTTTTTTTAGAAGTAAAAACTATCACTGCGTATAAACCAT AAATTTAATCTACAAAGATTTTATTTTGAGTGAATCAGATGTATTTTACA ATCTACTATTCAATGAAGGGACTAGCTGTGAAGACTTATTCATTAAATTT ATGCCCAATCCATATGCAGACAAACGAATATTGCAATTTTGAAAACTTCT TGTTTGTCAACTCTTTCGCCGTTTTCATCAGAGGTATTGTGTCATCTTTA TTTATCGAGATTACGCCTGGCAAAAAAAATCGATTTAAAAAAGTCTCTTC CGAATGTTTCTGATAGTTTTTTTTGTAATTAAATTTATGCTAAATACAAT ATAATATAATGTGATGTAAATACGCCAATAATTCTTTAATTAATAATTAA AAGGGAACTTCCACCATTCTGTTTATCCTTTTTGGGTGATGTGACAATGA GTCTTGAATACAACCCATATTTCATCAAAGTTGACAAGAACCAGTTGCGA TAACCTCTTTGAGAACCTTATTGCATTTCTTTTCTCCTTGAATATAGATT TCTACCTTTTTCTTTCTTTTCTCAGATGAAATAAAGCAGAAATAAAGTTT AAAAAAATATGTCCTGGCTATCAGATTTCACGTCCAAGGCTGAAAACTTG TTGACCAAGTTCGATCAAACTGCTGCACAAACGTTAAATGAATCTGGCAT ACAAGACACACTACATAATGTCACACAACCAGCACCGACCACAGCTTCAC CTTCTTACGAACAAGAATCACCAGTCACTACTGCTTCTTCCAAAGAATAT CAGAATGCATCACATCTCTTTGGTGGAACTCAAAACGAACGGAAATCACT ACCTACGAACCCAGGTATCCTTTTTCAGACTGGTCACGAATATTTATATA TTATCCTGTCTAGATTCTTGCTGACCTGAATTATACCTACTAGATATTAG ATCTTTTAAGAGTTTGCTCTCTTTCAACATTGGCTGGTTTTAATTGTGAT AACTCAGACTTTTCGTTGTTTTCTTTATTAGTTTTTTGTTGTTTTATTGA TTTCTGACATTTTTAACACATGACTAGAACCACACATCACCTCACTATCA GCGTATTGGTACAGCGGTCACAAAGAAATGCTTTCAAACTTTTGATTGAT ATTATGTCGCAATTTTTTTTCTAGCTTCCACGAGTACTTACACACCTGTA GCTTCAGTCTCAACAACCACCAGACCACCAGTATTGACCAACAAACCTTT ACAGCAAGTTTCATCCTCTGCAACAAACTCACCAAACATGAGTCGCTCAT CTAGTTCATCTTCTCTCAAGAAGGAGGAGGACATGTTGTTCGAATTCCTC AACTCCAACCCACCACCAGCAACCGCTATCAAAGGTCATACTAGAAATCT ATCAGGTCCCAAAACCTCGACACCACGACGTCCTTCCGCTACGACCGCTT CCACAATCCCAGTCAGCCAAACTACAACGACAGTTTCCACCAGACCAGAA GGACCAGGTATAGACAAGCTGCTTAAAAATCTCTTTTGTCCTTTAGACAT CGCTTATGCGTCGAAAGTTTCAGCAAGATTTAAAACTTCCTTTTTATTTG TTCATAACAGAAGATATATAAATGAAATCGCAGGTGATAGCCCTTTTTCA ACACGAATTTTCGCCAAAAAAGCCACAATCAACAACTCCTTTTTTCAGCC ATAGACACTGTCCCTCCACTATCAGCAAAACCGTCAATCTCTCCTGTAAA CATTGATACAGTTGACGCAGTCCCCGTCATTGAAAAACCGACGACGACAA CTCAGAAAGAACCACTCATCCACCAAATGAATAGTAAAGAGAGCAAGGAT GGAGAAAGCCGAGTTTCTAGTCTAAATCTTGAAAATACGTTACTAAAGAA TGAATTACAATCGTTGCATGAGGAGTTGGCAACCTTGTCGTCGAAATTGA AAGAACAACAGAAAGGTTTAATTTTCGTTTCTTTAGATTGGAAAAAACCT AATTAGATGTAGTCATGTCGTTTCTTTTACATTTGACTTTAGAAAGTTAC TCTCCTAAGATTTTGGTCTAACTCCTTTCCCATTTTTTTTACACAAAGCT TTTAAAGTGATGAAATTCTTTCAAGCAAAAGAATCACAGTTTTGAAAAAT ATTATTTGGGTCAAACATTTTTTTGAGTTAATGGGCAAAATCTCAATTTC AAAAACTATCTGATTATAAAATAATCCAGAGGAAGATGATTTTAACCCAA TTCTCTCTAGAAGAGTATTAAGATGTATCATAACTGCCCTTACCAAGAAC AAACCATTTTCTAGTTGGTCCTGTAGGTTCATTAAGCTGTATGGATTAAA TAGAAGCACTGTCTTTGGTATTCATCAAAGAGTTGAGTTGGTGTTCGGTT CGTGAAACCATTATTTTTACCTCCGGTAAGAAAGGCGCATAGCTTCGACC TAGATAAATCCTTGTTCTTCAAGGGGATCGATCAATTACAGAATTGTGAT CACTTATATTGCTGTGTTTTCCCTTTCAGAAACGGAGAAATATCGAACAC GTTACGAGAACCGTCGTAACCAACAGAACGAAGATTACGAGCGCGTAAGA GCTGGTTTCGAGAATCGCGAAGCTGATCTGAACGAAGCTTTGAAAGCGAA AGACTCGCAACTGGCTGTGCTTCGTGTTCGTATACAGGAAACTGATGCTG AGTTACAAGGGAAGACGAAATCATTGGAAGATGTCCAAAAACAAAACGAA CAGTAAGTTTTGACTTTTCAACTTATTGCTTTACTAAAAATCTCATATTC AGGACTCATATTCAAATAGAACAATTACTTATCTTATATGTTCCCAAAAA CTGCCATTATTTTGATACATAAGTGCAAACGGTAACTCACACTAAACTAT GACATACGATGTTGGAGTATCTAAACACCAACAATTTGAAAATGAGGTTT CGCAATGTTTTTATGTATTTCGAGAAATGCAGAGAAATGCGTATTATTCA ACCAAAGTTCCTTCACATAGAAGACAAATCTGTCTGTAAATTTATTTATT TCGATTTCTGTCTCAATCAATCCTGCATGAGTTTTCATACCTTCGACTAC GTCTTTAAACCGATCTCGTTAGATTCAATAGTGTTATAAAGTTAAGAGTG GATGATTTATCCGCAGATACGTGTCCCAGGACTCGTACGCTAGTGCGAAT ACGCCAGAGTGTCATTAGAGCACTCCAAAGTTCTAAGTGACTAACCTATA CTTGACGTCGTGGCTTTTTTTCTACGTGGTAATGTCTATCCCAATTTACT GTTTTTTTTTACTATCATACTGTTTACATTCATTTCAATTTAGGTTGCTA AGAGACCACAGTGAAGCATCGGGTGTCCAAGGGACGGTCATGAGTAATTT ACGTCAAAAGATGGAAGAACTGGAAAATGAACTTCGAAAAGAAAAACTCG AAAATAGTTCCATGAAGGTATGATAGCTTGTATGAGAGGAAATTTTTCTG TGGAATCGCTCAAATTGAATGTCCGTGATTTATAATATTTGATCATTGCT CTGACTGCGTGACAGGGCGGGAGTCAAACAAAAATTTGGTGATGTATCTG TAAATTAAGGAAGAAGGGAAGTTTATGGCAATTTCTTGCTCTCCTGGACT TTATATGCTCTCCCATAATTCGTTTTCTAGAAGATTCCAATCTTGACGCA TATTAAGAGTCTTAACATCTGAATTACTTGAATTTTAAATTTTTTCTATC GTCGAAATTTCTCATTTACCTTAAAGCTACTTGACTTTTTTTCCCTTCCG TTTTTTTCTTAGAACGAACTACTGAATGTCAACACGAAATTAGAAACAGA ACAACAACAGTACGCTGTCAACATCAAAGATCTCCACAGTAAACAAACGC AAGGAAAAGGTAATGTTCTGTAACCTTGTATGTAATTTTTCGAATCATTC AAGAATCTCATTTTTCTATTATGAGTCCCAATAAGATAATGCATTTGTCT TGGAGAGACAGTAATTACACCCATGTTTCATTTAAACAGAAAGCTACGCA CTCCAAGGGTAAATGCATACAGTAAAAATTCTAAATAATGTTCTTTATCA CAATTTTGAAAATTTTTTATAGAATAGATCGTATTATATGGAGAGTCTCC TATATCTTATATTTCCAAGCTTTTTTATAAATTGTAGCTCTAAAAGGTCC CTTCAGCATGTAGCTTGCTGAGAGTCTTCTATTCCTTATTATATTTTCAA GCTTCTGTATAACTCAGTGTTCACAATTCTTCCGTCTTAGGCGGATTTCC GTCTCTGCGAAGTTAAAACACGAGGCTTTTTCGCCTTAGAATTTAGCAAA ATATTGAAGACCTGTGGGCTAATTTGTTGTGTCCATTTTCCGCCTCAGAG AAAAAACTTTACTTCACTTTGACCACTAACTCAAAATAATGTACTTTTTC CTTTTTACGCAGATAAAACAAGGGAGCTGGAAATGAGAGTAAAAGTGGCG GAAGACTCCGCTGAAAATTCACAAAAGGAATTGAAAGAATATAAAGACAA AGCTGCTCGTATTCTTCAGGTATTCTTGCCAACTCGGTTGATGTAATTGT TTTCCAGTTTAAATCCACTCAAATGTAATGAGTGGAGTAGGATTTTATCG ACGTTTAATTTTGACTTTTCTCCAGGCAGGGCTAGTGTTTCAGTCAGTAA AGAAGCTGGTCAATAGCGAAAAATCTTTATGTGTGTGACGTTAAGGTATG AGGCGAAATATAGTTTCGATTTTAAATTGATTCTACTAAATGTATCGCGG AGATGAGAAATCTCACGATAAACATTTGAAATTGAAGATGGAATTGACTT TTTAGGATAGCAGTTTTTTTTCTCCGGTCAAATATTTCCTCAGCAATTTG ACTGAGGGTAGTGATAAATTTTTTGCAAAGTGACTAAATTTTCCCCGACT AAGAGAAATCTCGACTTTTTTTCTCCCCAATAAAGTTCTCTCTGTCATTA TAGGCCAAAGAGAAGTTGATAGCGTCATTACGTCAAGGGAGTGATTCCAC CTCAGACGTTTCACCGACTTTACTATCGGAACTGGAAGAATTGCGACAAG ACCGAGACATGGTGCGCGACGAACTTCAACAAAACAAATATAAGATGGAA CAACTGCGACAAGAATATCTGGTGAGTAAAGAAACAAACGAAAGTCAATT AAGCGTACATTTTTGCTACACTGTCGAAACCGCTCTCTAGGGAATTAGTC TAAATTCAAAAAAAGGTATGCTCTTAAAGCGAGTGAACCTGAAACTACGC TTACATGTTCACATTTTGGATAAAGGACTCCAAATTAGGCTATACTCATA TGTTTAGTCTGAAAAAGGATAACTGACTTCTAGCCAGGGTTTTTCAGCGA GTTTATGTATGTGTGTTTTTCAACGACGGAGACGGTAAGATTCTAATTTG ACTAGAGATCCTGACTGACTGAGGACGACGGATTTTTACTGTCCTCGATT TTGCGGTTCAAAACTGCTGGTTATTCCAAATCGCTTCAGTCATTTCGCCG TCCTTAAAAGTGCGAATACATAAATTTGCTAGTTATTGCCGGTCGCTTTA GTCTTTCAACAGAATTCCTTTTTTCGTGAATGATGTTACGGATCGACTTT TCTTATCAGAGTATCTAGATTCATAGCCAGCATGTCCCCACAAAAACGGA ACAAACCAAATTTTTTATTTGTTTTAAACTACGTTAAAAAGCGATTTCCG TCTAACAGGCTACTTTATCGGGGGAAAAAAATGTCTGAGTTTTATTTAGT CGGGGTTTTTTTTCGTTGGGGGAAAGTTTCATCACCCCCTCAAAATTTTC GTCACTTTCCCGCGACATTTTTTCCCCTACTAAATTCATACCGATCCGTA AAATCATCAGTCTAAGAATTTTTTTTTCTTGTGTTTGAATGTAGGATTTG GATATGTTGCATAAGAACGATTCAGATGATAATCAAGACAAAATCGAGAC ACTTCAATCCTCTTTACAAGATGAAGTTCAAAAGAGACAAACGGCTGAAG AAGACATGAAAAGATATATTCAGGTGAAATATTTTTCATCTACTTGTTTC ATAGTCTAAAACAAGTAGTAGAGAAACATGCACTTTGATTACTAGCTTCG CTTTTTATATTACCGATATAGATACCAATCGCTTAAGCATGAAGTAAATG CAAGATAGTTGGTTTACGAAACTTCGATTGATCTAACTCACATGCCAAAA AAGTATTCCAGAATAGGTTATGTATATTCTCTTTGTTATGGTTAATAGGA ATTACACTTCACTCGTGAGGAAATACATAGCTTGAAGAAATCTCAAATCA GCAAAAATCAGGTATGAGAGAATGTTGTATACTTTCCACGTGACACTCAT TTCGTTTACAATAAAACAACCCAACTAACTGTTCAACAAATCGATACTCC AATGAAACCCGTCTTTTCTTGCTTTGGTTCAGGGAAAAGTTTTTGAACAA AGTCCCAATTGAGTTTCCGATTTAATTGGCTACCAGCTTGGGCTAGGGAA AACAAAAAATTGCCACACAAATTTGTTTTTTTTCAGTTAGTAATGGGTAA CCTATGGGTTCTGTTTTGGTACCACTTTTCATACTTATGCCTTTACCCTA TTTATTTCAGGAATACGAAGCTGAAGTAAAACGCCTTCAAAATCAAGTAA GTCATTCATTCCTGCTTAGCATCTACTAATCTCTTGCATTATTTCTGAGG TTCACTCAATACTAGGAAGGAGTTTTATTTTATTTTATTTTGTATATCAA TAAAAATTTTTACTTAGCACATTAATTCATTTTTCATATCACTTTTCTTA TTTTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNCTTGTACATTATAACAATAATATT TATTTTAAACTTTAAATTTTATATGTGGCGAATATGGGCTCACGCCTAAT GCTACTTAATTAAATAGATAGATAGATAGATTCATAAAACTCAAATAAGC ATTTTTGAACTGGGGTCTACAATACCTTAAGTGAAGAAATTTTTGCGGGA AGAAATTTTCGTGGAATTTAATTTCGCGGTTGAGAGAACTTTTTGTTTAC AATATGGCCTATTTCGTCTAAAATAACCAATTTTCAATCCTGAGAATATT CGTGTTTGGCGGAATTTAATTTTGCGGATTTGTCTGGATTTGTCAAAAAA CCGCGAAAATTTCTTCTCTTAAGGTAGAATAACCATAGACTTGATTATAG CTGTTATTGTCGACACTTTTTGGAGGCCTCGTTTACCTTGACTTGCGTCG AATGCTCCATATTTCGAACACGCACGGACGGGGAAAAAAAATTACTCGAC TTTATAGATGATCTCTTGGTCAATGAAAATTAAGTCACCAAAAACAAATC TTACTTTACAAAAACCTTGTGAGTGTTAAGAAGGTCATATGTGGTAATGT TTATGTTTCTTTGAGTTGTTTTGGCGTGAGAATTTTATTAACTCGTTTTT GTGTAGGTTAACGTGAAAGCAAGTTCATCATCCTCGCAAGAAGAACTGGA GAATCGAATTAGAACGTTGACAGACAGCCTCATACACAAACAAACTGTTG TCGAAGCGCTCAGCACTGAAAAGAATTCACTCAATTTACAGCTGGAGCGA CTAGAGGTTTGTAATACACGTTTTTTTTATAAGAACAAACTATATAAGAA CATAAGGCTTCAATAGTCAAAATGTTAAGAACAAGTTAAGAACATTTCAA GGCTTTGCAGACTCTAAAATGGCCTTTTTCTTAGGAAAATGGTCAAAAAT ACTCACAAAACGGTTAAAATAAGAACTTGTTTTAAAAAACATTTTTAGGC TTAAAACTCAAAAAGTAAAGAACATCCGAAGACTTCAAAAATTTTGGATG TTCTTATAAAAAAAACGTGTAAAGGAATACGTTTGGCGTTGAAATTACAC ACAATCTTGTTGGTAAATTCTCAGCCATGTAGGATATGTTTCTACTACAT TACACAGCTTAGCTTGTTTGGAAAATCTCAAACTGCGAGCAGACAGGCGA TGATGGTCAACAGTTTCACTTTGACGTTCTCACAAAAAAATTCAAATCTG TTACTTTTCTTGAACTCATAGAAACAATACAAAGACATTCAGAACAGTTT GATCAAGCGAAATAAATCAACCGATATCGAAGATGGCACTGGAGGTAATC AGTAGTTTTACAGCTAATTTATTTTGATGTTTTTAGTGAAGAGCAAGCCC TGCCTCACGCCTGCCATTAATTCTAAATAACGTCACTAAAATACCGGCGT AAAAAGTGCTGAAGTTGTTAAATGTTTCAGTACAGTTGACGCTCTCTAAT TCGAGGTTCTTCTATTCGATACCATAGTTTCTCCCCCCCCCCCCCCCANN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAA GTTTCTATCGCGTTTTTTAAATTAAACTGACGGAGATGGAAAAGTCACTG AAACGTGGTGATAATTCATTCAACCTTTCTTTTAATTTTCAGAAGCGAAA TTACTACCGATGAATACCATTATGCCGAAACAAATTACTGGGAATGTTCG CTGGAGGTCCACCGTCAACGAAATTGATAAATTCAGGTAAGCTTGATCAC AATTTGCCTCGTCTTTTAAATGCCTTGAAAAAAACCCCGGCTGAAACATG GTTGAATTCTCTAGAACCTAATGATGTTTATGTGTCGATTCTCCTTCCAA TATTTCAAAACTACTACTTAACAATATCCTTTGATAATGAGAGATAAATT CAAGAATTTAGGCCATTCATTACCTCACTCTCCTTTCGCTTCGGTTTAAA TCCTTATTTTGTTGTTGCTTTTTTCAGTATACGACTCGGTGTCTTCCTGC GACGCTACCCGATTGCTCGTCTTATGGTCATCTTTTATATGGTAAGTCTG TCTGAAGAAGCTAATTCTACAGTTGATCGCTCTCAATATTGGGCTTTTCT ATTTAATTATCCATACAAGGAATGGACGAACCCTGCCAAGCCAGAAATAT GGAAATTTTTAGGATATCGTCTAGAAAAATGCCAAAGTTTCCGATCCAAA AATCCAAAACCCTGACAAAAAAGATATCTATTGCCCTTGAAAAATTCTAC ACAGTAAAGTTAGGGTGGACAAACCCTTACTCCTTGGTAATTTCAGATTA ACCTTTATAACTCCCTGGAAAACATTTCTTTCTTTCTTTCTTGCAGCTCC TACTCCACTTGTGGGTAACTTTTGTCATTTTGACGTACACTCCTGAAATA CACAACCACGACTTCACGCCAGAATCGCCCAAATAAATCTTTGTTTTTAA ATGTAATTGTATAGTGGAATTTTATAGACCATTTTTTTAGATAATTTTCT TTTTCTTTTCTATTGAAATGTCTCTAGTAAACATTTGACCAAACTTCGCA TACTGGTAAGCCGTACTTTCAGATGCCCAATAAACGGGGGTTGAAATTCG CGAATTTTGGTATACGGGGGCCTTAATTACCAGGGGTTTGGAAGTTCTAC TTGTAAGTACAAATAAAGTATTCTTACTCTAAAATCACGCTTTTTGGATC ATAATAATAAGGGACCTTGATTGAGAAAAAATAATAAACAGGGAAGCCTA ATAAGGGGGGTCTGGAAAAATATACAGAAATCAAAAACCGGGGGCGTACT GAAAGTGGCCGCCAAGAATGTGAGGTATCTTGAAGCTTAATGGGAATACT TCAGGGATAAATCGAAATCGATGTCCAACCCATCCCTACGCCCTGGTGTT CATTTATAATTCATTGTTGGAAATACTGATGTATGATTGGTCCATAAAAT AGAAGCGTGGTATGTTTCTTATTTTTTATCCTCGCAAATTAGTTTTTTTC CCTAAGGGTGGGCTCGAATAAAATATTAGATCTAGTAGTTTAAAGTTATT GTCACGAGAAAAAAGTTTGAAAATTGCTTGTTTGAATAAGTAATTCGTGC AAAGATAAGAAATCTATCCCAAACTCATTCCCAAACAAATCGCTACGCTA TATTACCCTAGCATCATTGTTGTAAAATAAATTCGACTGCTTTTTTGAAT ATTTTTGAACGTGTATTATTTATTATATGTTGCATGGAAAAAGGAATTTA TATTTTTTCAATTTAGTATCAATCAGGTGAATGTATGGAATCGGATCAAA TAATATATAATAAGAACCGCAAAGCTGTCTAACTTTTCCCTCTAAGAATG CTAGAATTATTCGAAACTATTTGTTGGTCTAGGTAGTGTTTTGTCAACCA ATGTTTCGATTTCAA

Coding sequence (CDS) from alignment at sc0000011:592890..624504-

>TCONS_00001682 ID=TCONS_00001682|Name=TCONS_00001682|organism=Clytia hemisphaerica|type=CDS|length=36384bp|location=Sequence derived from alignment at sc0000011:592890..624504- (Clytia hemisphaerica)
CTCCTACTCCACTTGTGGGTAACTTTTGTCATTTTGACGTACACTCCTGA
AATACACAACCACGACTTCACGCCAGAATCGCCCAAATAATATACGACTC
GGTGTCTTCCTGCGACGCTACCCGATTGCTCGTCTTATGGTCATCTTTTA
TATGAAGCGAAATTACTACCGATGAATACCATTATGCCGAAACAAATTAC
TGGGAATGTTCGCTGGAGGTCCACCGTCAACGAAATTGATAAATTCAGAA
ACAATACAAAGACATTCAGAACAGTTTGATCAAGCGAAATAAATCAACCG
ATATCGAAGATGGCACTGGAGGTTAACGTGAAAGCAAGTTCATCATCCTC
GCAAGAAGAACTGGAGAATCGAATTAGAACGTTGACAGACAGCCTCATAC
ACAAACAAACTGTTGTCGAAGCGCTCAGCACTGAAAAGAATTCACTCAAT
TTACAGCTGGAGCGACTAGAGGAATACGAAGCTGAAGTAAAACGCCTTCA
AAATCAAGAATTACACTTCACTCGTGAGGAAATACATAGCTTGAAGAAAT
CTCAAATCAGCAAAAATCAGGATTTGGATATGTTGCATAAGAACGATTCA
GATGATAATCAAGACAAAATCGAGACACTTCAATCCTCTTTACAAGATGA
AGTTCAAAAGAGACAAACGGCTGAAGAAGACATGAAAAGATATATTCAGG
CCAAAGAGAAGTTGATAGCGTCATTACGTCAAGGGAGTGATTCCACCTCA
GACGTTTCACCGACTTTACTATCGGAACTGGAAGAATTGCGACAAGACCG
AGACATGGTGCGCGACGAACTTCAACAAAACAAATATAAGATGGAACAAC
TGCGACAAGAATATCTGATAAAACAAGGGAGCTGGAAATGAGAGTAAAAG
TGGCGGAAGACTCCGCTGAAAATTCACAAAAGGAATTGAAAGAATATAAA
GACAAAGCTGCTCGTATTCTTCAGAACGAACTACTGAATGTCAACACGAA
ATTAGAAACAGAACAACAACAGTACGCTGTCAACATCAAAGATCTCCACA
GTAAACAAACGCAAGGAAAAGGTTGCTAAGAGACCACAGTGAAGCATCGG
GTGTCCAAGGGACGGTCATGAGTAATTTACGTCAAAAGATGGAAGAACTG
GAAAATGAACTTCGAAAAGAAAAACTCGAAAATAGTTCCATGAAGAAACG
GAGAAATATCGAACACGTTACGAGAACCGTCGTAACCAACAGAACGAAGA
TTACGAGCGCGTAAGAGCTGGTTTCGAGAATCGCGAAGCTGATCTGAACG
AAGCTTTGAAAGCGAAAGACTCGCAACTGGCTGTGCTTCGTGTTCGTATA
CAGGAAACTGATGCTGAGTTACAAGGGAAGACGAAATCATTGGAAGATGT
CCAAAAACAAAACGAACACCATAGACACTGTCCCTCCACTATCAGCAAAA
CCGTCAATCTCTCCTGTAAACATTGATACAGTTGACGCAGTCCCCGTCAT
TGAAAAACCGACGACGACAACTCAGAAAGAACCACTCATCCACCAAATGA
ATAGTAAAGAGAGCAAGGATGGAGAAAGCCGAGTTTCTAGTCTAAATCTT
GAAAATACGTTACTAAAGAATGAATTACAATCGTTGCATGAGGAGTTGGC
AACCTTGTCGTCGAAATTGAAAGAACAACAGAAAGCTTCCACGAGTACTT
ACACACCTGTAGCTTCAGTCTCAACAACCACCAGACCACCAGTATTGACC
AACAAACCTTTACAGCAAGTTTCATCCTCTGCAACAAACTCACCAAACAT
GAGTCGCTCATCTAGTTCATCTTCTCTCAAGAAGGAGGAGGACATGTTGT
TCGAATTCCTCAACTCCAACCCACCACCAGCAACCGCTATCAAAGGTCAT
ACTAGAAATCTATCAGGTCCCAAAACCTCGACACCACGACGTCCTTCCGC
TACGACCGCTTCCACAATCCCAGTCAGCCAAACTACAACGACAGTTTCCA
CCAGACCAGAAGGACCAGATGTCCTGGCTATCAGATTTCACGTCCAAGGC
TGAAAACTTGTTGACCAAGTTCGATCAAACTGCTGCACAAACGTTAAATG
AATCTGGCATACAAGACACACTACATAATGTCACACAACCAGCACCGACC
ACAGCTTCACCTTCTTACGAACAAGAATCACCAGTCACTACTGCTTCTTC
CAAAGAATATCAGAATGCATCACATCTCTTTGGTGGAACTCAAAACGAAC
GGAAATCACTACCTACGAACCCAGCTCCTACTCCACTTGTGGGTAACTTT
TGTCATTTTGACGTACACTCCTGAAATACACAACCACGACTTCACGCCAG
AATCGCCCAAATAATATACGACTCGGTGTCTTCCTGCGACGCTACCCGAT
TGCTCGTCTTATGGTCATCTTTTATATGAAGCGAAATTACTACCGATGAA
TACCATTATGCCGAAACAAATTACTGGGAATGTTCGCTGGAGGTCCACCG
TCAACGAAATTGATAAATTCAGAAACAATACAAAGACATTCAGAACAGTT
TGATCAAGCGAAATAAATCAACCGATATCGAAGATGGCACTGGAGGTTAA
CGTGAAAGCAAGTTCATCATCCTCGCAAGAAGAACTGGAGAATCGAATTA
GAACGTTGACAGACAGCCTCATACACAAACAAACTGTTGTCGAAGCGCTC
AGCACTGAAAAGAATTCACTCAATTTACAGCTGGAGCGACTAGAGGAATA
CGAAGCTGAAGTAAAACGCCTTCAAAATCAAGAATTACACTTCACTCGTG
AGGAAATACATAGCTTGAAGAAATCTCAAATCAGCAAAAATCAGGATTTG
GATATGTTGCATAAGAACGATTCAGATGATAATCAAGACAAAATCGAGAC
ACTTCAATCCTCTTTACAAGATGAAGTTCAAAAGAGACAAACGGCTGAAG
AAGACATGAAAAGATATATTCAGGCCAAAGAGAAGTTGATAGCGTCATTA
CGTCAAGGGAGTGATTCCACCTCAGACGTTTCACCGACTTTACTATCGGA
ACTGGAAGAATTGCGACAAGACCGAGACATGGTGCGCGACGAACTTCAAC
AAAACAAATATAAGATGGAACAACTGCGACAAGAATATCTGATAAAACAA
GGGAGCTGGAAATGAGAGTAAAAGTGGCGGAAGACTCCGCTGAAAATTCA
CAAAAGGAATTGAAAGAATATAAAGACAAAGCTGCTCGTATTCTTCAGAA
CGAACTACTGAATGTCAACACGAAATTAGAAACAGAACAACAACAGTACG
CTGTCAACATCAAAGATCTCCACAGTAAACAAACGCAAGGAAAAGGTTGC
TAAGAGACCACAGTGAAGCATCGGGTGTCCAAGGGACGGTCATGAGTAAT
TTACGTCAAAAGATGGAAGAACTGGAAAATGAACTTCGAAAAGAAAAACT
CGAAAATAGTTCCATGAAGAAACGGAGAAATATCGAACACGTTACGAGAA
CCGTCGTAACCAACAGAACGAAGATTACGAGCGCGTAAGAGCTGGTTTCG
AGAATCGCGAAGCTGATCTGAACGAAGCTTTGAAAGCGAAAGACTCGCAA
CTGGCTGTGCTTCGTGTTCGTATACAGGAAACTGATGCTGAGTTACAAGG
GAAGACGAAATCATTGGAAGATGTCCAAAAACAAAACGAACACCATAGAC
ACTGTCCCTCCACTATCAGCAAAACCGTCAATCTCTCCTGTAAACATTGA
TACAGTTGACGCAGTCCCCGTCATTGAAAAACCGACGACGACAACTCAGA
AAGAACCACTCATCCACCAAATGAATAGTAAAGAGAGCAAGGATGGAGAA
AGCCGAGTTTCTAGTCTAAATCTTGAAAATACGTTACTAAAGAATGAATT
ACAATCGTTGCATGAGGAGTTGGCAACCTTGTCGTCGAAATTGAAAGAAC
AACAGAAAGCTTCCACGAGTACTTACACACCTGTAGCTTCAGTCTCAACA
ACCACCAGACCACCAGTATTGACCAACAAACCTTTACAGCAAGTTTCATC
CTCTGCAACAAACTCACCAAACATGAGTCGCTCATCTAGTTCATCTTCTC
TCAAGAAGGAGGAGGACATGTTGTTCGAATTCCTCAACTCCAACCCACCA
CCAGCAACCGCTATCAAAGGTCATACTAGAAATCTATCAGGTCCCAAAAC
CTCGACACCACGACGTCCTTCCGCTACGACCGCTTCCACAATCCCAGTCA
GCCAAACTACAACGACAGTTTCCACCAGACCAGAAGGACCAGATGTCCTG
GCTATCAGATTTCACGTCCAAGGCTGAAAACTTGTTGACCAAGTTCGATC
AAACTGCTGCACAAACGTTAAATGAATCTGGCATACAAGACACACTACAT
AATGTCACACAACCAGCACCGACCACAGCTTCACCTTCTTACGAACAAGA
ATCACCAGTCACTACTGCTTCTTCCAAAGAATATCAGAATGCATCACATC
TCTTTGGTGGAACTCAAAACGAACGGAAATCACTACCTACGAACCCAGCT
CCTACTCCACTTGTGGGTAACTTTTGTCATTTTGACGTACACTCCTGAAA
TACACAACCACGACTTCACGCCAGAATCGCCCAAATAATATACGACTCGG
TGTCTTCCTGCGACGCTACCCGATTGCTCGTCTTATGGTCATCTTTTATA
TGAAGCGAAATTACTACCGATGAATACCATTATGCCGAAACAAATTACTG
GGAATGTTCGCTGGAGGTCCACCGTCAACGAAATTGATAAATTCAGAAAC
AATACAAAGACATTCAGAACAGTTTGATCAAGCGAAATAAATCAACCGAT
ATCGAAGATGGCACTGGAGGTTAACGTGAAAGCAAGTTCATCATCCTCGC
AAGAAGAACTGGAGAATCGAATTAGAACGTTGACAGACAGCCTCATACAC
AAACAAACTGTTGTCGAAGCGCTCAGCACTGAAAAGAATTCACTCAATTT
ACAGCTGGAGCGACTAGAGGAATACGAAGCTGAAGTAAAACGCCTTCAAA
ATCAAGAATTACACTTCACTCGTGAGGAAATACATAGCTTGAAGAAATCT
CAAATCAGCAAAAATCAGGATTTGGATATGTTGCATAAGAACGATTCAGA
TGATAATCAAGACAAAATCGAGACACTTCAATCCTCTTTACAAGATGAAG
TTCAAAAGAGACAAACGGCTGAAGAAGACATGAAAAGATATATTCAGGCC
AAAGAGAAGTTGATAGCGTCATTACGTCAAGGGAGTGATTCCACCTCAGA
CGTTTCACCGACTTTACTATCGGAACTGGAAGAATTGCGACAAGACCGAG
ACATGGTGCGCGACGAACTTCAACAAAACAAATATAAGATGGAACAACTG
CGACAAGAATATCTGATAAAACAAGGGAGCTGGAAATGAGAGTAAAAGTG
GCGGAAGACTCCGCTGAAAATTCACAAAAGGAATTGAAAGAATATAAAGA
CAAAGCTGCTCGTATTCTTCAGAACGAACTACTGAATGTCAACACGAAAT
TAGAAACAGAACAACAACAGTACGCTGTCAACATCAAAGATCTCCACAGT
AAACAAACGCAAGGAAAAGGTTGCTAAGAGACCACAGTGAAGCATCGGGT
GTCCAAGGGACGGTCATGAGTAATTTACGTCAAAAGATGGAAGAACTGGA
AAATGAACTTCGAAAAGAAAAACTCGAAAATAGTTCCATGAAGAAACGGA
GAAATATCGAACACGTTACGAGAACCGTCGTAACCAACAGAACGAAGATT
ACGAGCGCGTAAGAGCTGGTTTCGAGAATCGCGAAGCTGATCTGAACGAA
GCTTTGAAAGCGAAAGACTCGCAACTGGCTGTGCTTCGTGTTCGTATACA
GGAAACTGATGCTGAGTTACAAGGGAAGACGAAATCATTGGAAGATGTCC
AAAAACAAAACGAACACCATAGACACTGTCCCTCCACTATCAGCAAAACC
GTCAATCTCTCCTGTAAACATTGATACAGTTGACGCAGTCCCCGTCATTG
AAAAACCGACGACGACAACTCAGAAAGAACCACTCATCCACCAAATGAAT
AGTAAAGAGAGCAAGGATGGAGAAAGCCGAGTTTCTAGTCTAAATCTTGA
AAATACGTTACTAAAGAATGAATTACAATCGTTGCATGAGGAGTTGGCAA
CCTTGTCGTCGAAATTGAAAGAACAACAGAAAGCTTCCACGAGTACTTAC
ACACCTGTAGCTTCAGTCTCAACAACCACCAGACCACCAGTATTGACCAA
CAAACCTTTACAGCAAGTTTCATCCTCTGCAACAAACTCACCAAACATGA
GTCGCTCATCTAGTTCATCTTCTCTCAAGAAGGAGGAGGACATGTTGTTC
GAATTCCTCAACTCCAACCCACCACCAGCAACCGCTATCAAAGGTCATAC
TAGAAATCTATCAGGTCCCAAAACCTCGACACCACGACGTCCTTCCGCTA
CGACCGCTTCCACAATCCCAGTCAGCCAAACTACAACGACAGTTTCCACC
AGACCAGAAGGACCAGATGTCCTGGCTATCAGATTTCACGTCCAAGGCTG
AAAACTTGTTGACCAAGTTCGATCAAACTGCTGCACAAACGTTAAATGAA
TCTGGCATACAAGACACACTACATAATGTCACACAACCAGCACCGACCAC
AGCTTCACCTTCTTACGAACAAGAATCACCAGTCACTACTGCTTCTTCCA
AAGAATATCAGAATGCATCACATCTCTTTGGTGGAACTCAAAACGAACGG
AAATCACTACCTACGAACCCAGCTCCTACTCCACTTGTGGGTAACTTTTG
TCATTTTGACGTACACTCCTGAAATACACAACCACGACTTCACGCCAGAA
TCGCCCAAATAATATACGACTCGGTGTCTTCCTGCGACGCTACCCGATTG
CTCGTCTTATGGTCATCTTTTATATGAAGCGAAATTACTACCGATGAATA
CCATTATGCCGAAACAAATTACTGGGAATGTTCGCTGGAGGTCCACCGTC
AACGAAATTGATAAATTCAGAAACAATACAAAGACATTCAGAACAGTTTG
ATCAAGCGAAATAAATCAACCGATATCGAAGATGGCACTGGAGGTTAACG
TGAAAGCAAGTTCATCATCCTCGCAAGAAGAACTGGAGAATCGAATTAGA
ACGTTGACAGACAGCCTCATACACAAACAAACTGTTGTCGAAGCGCTCAG
CACTGAAAAGAATTCACTCAATTTACAGCTGGAGCGACTAGAGGAATACG
AAGCTGAAGTAAAACGCCTTCAAAATCAAGAATTACACTTCACTCGTGAG
GAAATACATAGCTTGAAGAAATCTCAAATCAGCAAAAATCAGGATTTGGA
TATGTTGCATAAGAACGATTCAGATGATAATCAAGACAAAATCGAGACAC
TTCAATCCTCTTTACAAGATGAAGTTCAAAAGAGACAAACGGCTGAAGAA
GACATGAAAAGATATATTCAGGCCAAAGAGAAGTTGATAGCGTCATTACG
TCAAGGGAGTGATTCCACCTCAGACGTTTCACCGACTTTACTATCGGAAC
TGGAAGAATTGCGACAAGACCGAGACATGGTGCGCGACGAACTTCAACAA
AACAAATATAAGATGGAACAACTGCGACAAGAATATCTGATAAAACAAGG
GAGCTGGAAATGAGAGTAAAAGTGGCGGAAGACTCCGCTGAAAATTCACA
AAAGGAATTGAAAGAATATAAAGACAAAGCTGCTCGTATTCTTCAGAACG
AACTACTGAATGTCAACACGAAATTAGAAACAGAACAACAACAGTACGCT
GTCAACATCAAAGATCTCCACAGTAAACAAACGCAAGGAAAAGGTTGCTA
AGAGACCACAGTGAAGCATCGGGTGTCCAAGGGACGGTCATGAGTAATTT
ACGTCAAAAGATGGAAGAACTGGAAAATGAACTTCGAAAAGAAAAACTCG
AAAATAGTTCCATGAAGAAACGGAGAAATATCGAACACGTTACGAGAACC
GTCGTAACCAACAGAACGAAGATTACGAGCGCGTAAGAGCTGGTTTCGAG
AATCGCGAAGCTGATCTGAACGAAGCTTTGAAAGCGAAAGACTCGCAACT
GGCTGTGCTTCGTGTTCGTATACAGGAAACTGATGCTGAGTTACAAGGGA
AGACGAAATCATTGGAAGATGTCCAAAAACAAAACGAACACCATAGACAC
TGTCCCTCCACTATCAGCAAAACCGTCAATCTCTCCTGTAAACATTGATA
CAGTTGACGCAGTCCCCGTCATTGAAAAACCGACGACGACAACTCAGAAA
GAACCACTCATCCACCAAATGAATAGTAAAGAGAGCAAGGATGGAGAAAG
CCGAGTTTCTAGTCTAAATCTTGAAAATACGTTACTAAAGAATGAATTAC
AATCGTTGCATGAGGAGTTGGCAACCTTGTCGTCGAAATTGAAAGAACAA
CAGAAAGCTTCCACGAGTACTTACACACCTGTAGCTTCAGTCTCAACAAC
CACCAGACCACCAGTATTGACCAACAAACCTTTACAGCAAGTTTCATCCT
CTGCAACAAACTCACCAAACATGAGTCGCTCATCTAGTTCATCTTCTCTC
AAGAAGGAGGAGGACATGTTGTTCGAATTCCTCAACTCCAACCCACCACC
AGCAACCGCTATCAAAGGTCATACTAGAAATCTATCAGGTCCCAAAACCT
CGACACCACGACGTCCTTCCGCTACGACCGCTTCCACAATCCCAGTCAGC
CAAACTACAACGACAGTTTCCACCAGACCAGAAGGACCAGATGTCCTGGC
TATCAGATTTCACGTCCAAGGCTGAAAACTTGTTGACCAAGTTCGATCAA
ACTGCTGCACAAACGTTAAATGAATCTGGCATACAAGACACACTACATAA
TGTCACACAACCAGCACCGACCACAGCTTCACCTTCTTACGAACAAGAAT
CACCAGTCACTACTGCTTCTTCCAAAGAATATCAGAATGCATCACATCTC
TTTGGTGGAACTCAAAACGAACGGAAATCACTACCTACGAACCCAGCTCC
TACTCCACTTGTGGGTAACTTTTGTCATTTTGACGTACACTCCTGAAATA
CACAACCACGACTTCACGCCAGAATCGCCCAAATAATATACGACTCGGTG
TCTTCCTGCGACGCTACCCGATTGCTCGTCTTATGGTCATCTTTTATATG
AAGCGAAATTACTACCGATGAATACCATTATGCCGAAACAAATTACTGGG
AATGTTCGCTGGAGGTCCACCGTCAACGAAATTGATAAATTCAGAAACAA
TACAAAGACATTCAGAACAGTTTGATCAAGCGAAATAAATCAACCGATAT
CGAAGATGGCACTGGAGGTTAACGTGAAAGCAAGTTCATCATCCTCGCAA
GAAGAACTGGAGAATCGAATTAGAACGTTGACAGACAGCCTCATACACAA
ACAAACTGTTGTCGAAGCGCTCAGCACTGAAAAGAATTCACTCAATTTAC
AGCTGGAGCGACTAGAGGAATACGAAGCTGAAGTAAAACGCCTTCAAAAT
CAAGAATTACACTTCACTCGTGAGGAAATACATAGCTTGAAGAAATCTCA
AATCAGCAAAAATCAGGATTTGGATATGTTGCATAAGAACGATTCAGATG
ATAATCAAGACAAAATCGAGACACTTCAATCCTCTTTACAAGATGAAGTT
CAAAAGAGACAAACGGCTGAAGAAGACATGAAAAGATATATTCAGGCCAA
AGAGAAGTTGATAGCGTCATTACGTCAAGGGAGTGATTCCACCTCAGACG
TTTCACCGACTTTACTATCGGAACTGGAAGAATTGCGACAAGACCGAGAC
ATGGTGCGCGACGAACTTCAACAAAACAAATATAAGATGGAACAACTGCG
ACAAGAATATCTGATAAAACAAGGGAGCTGGAAATGAGAGTAAAAGTGGC
GGAAGACTCCGCTGAAAATTCACAAAAGGAATTGAAAGAATATAAAGACA
AAGCTGCTCGTATTCTTCAGAACGAACTACTGAATGTCAACACGAAATTA
GAAACAGAACAACAACAGTACGCTGTCAACATCAAAGATCTCCACAGTAA
ACAAACGCAAGGAAAAGGTTGCTAAGAGACCACAGTGAAGCATCGGGTGT
CCAAGGGACGGTCATGAGTAATTTACGTCAAAAGATGGAAGAACTGGAAA
ATGAACTTCGAAAAGAAAAACTCGAAAATAGTTCCATGAAGAAACGGAGA
AATATCGAACACGTTACGAGAACCGTCGTAACCAACAGAACGAAGATTAC
GAGCGCGTAAGAGCTGGTTTCGAGAATCGCGAAGCTGATCTGAACGAAGC
TTTGAAAGCGAAAGACTCGCAACTGGCTGTGCTTCGTGTTCGTATACAGG
AAACTGATGCTGAGTTACAAGGGAAGACGAAATCATTGGAAGATGTCCAA
AAACAAAACGAACACCATAGACACTGTCCCTCCACTATCAGCAAAACCGT
CAATCTCTCCTGTAAACATTGATACAGTTGACGCAGTCCCCGTCATTGAA
AAACCGACGACGACAACTCAGAAAGAACCACTCATCCACCAAATGAATAG
TAAAGAGAGCAAGGATGGAGAAAGCCGAGTTTCTAGTCTAAATCTTGAAA
ATACGTTACTAAAGAATGAATTACAATCGTTGCATGAGGAGTTGGCAACC
TTGTCGTCGAAATTGAAAGAACAACAGAAAGCTTCCACGAGTACTTACAC
ACCTGTAGCTTCAGTCTCAACAACCACCAGACCACCAGTATTGACCAACA
AACCTTTACAGCAAGTTTCATCCTCTGCAACAAACTCACCAAACATGAGT
CGCTCATCTAGTTCATCTTCTCTCAAGAAGGAGGAGGACATGTTGTTCGA
ATTCCTCAACTCCAACCCACCACCAGCAACCGCTATCAAAGGTCATACTA
GAAATCTATCAGGTCCCAAAACCTCGACACCACGACGTCCTTCCGCTACG
ACCGCTTCCACAATCCCAGTCAGCCAAACTACAACGACAGTTTCCACCAG
ACCAGAAGGACCAGATGTCCTGGCTATCAGATTTCACGTCCAAGGCTGAA
AACTTGTTGACCAAGTTCGATCAAACTGCTGCACAAACGTTAAATGAATC
TGGCATACAAGACACACTACATAATGTCACACAACCAGCACCGACCACAG
CTTCACCTTCTTACGAACAAGAATCACCAGTCACTACTGCTTCTTCCAAA
GAATATCAGAATGCATCACATCTCTTTGGTGGAACTCAAAACGAACGGAA
ATCACTACCTACGAACCCAGCTCCTACTCCACTTGTGGGTAACTTTTGTC
ATTTTGACGTACACTCCTGAAATACACAACCACGACTTCACGCCAGAATC
GCCCAAATAATATACGACTCGGTGTCTTCCTGCGACGCTACCCGATTGCT
CGTCTTATGGTCATCTTTTATATGAAGCGAAATTACTACCGATGAATACC
ATTATGCCGAAACAAATTACTGGGAATGTTCGCTGGAGGTCCACCGTCAA
CGAAATTGATAAATTCAGAAACAATACAAAGACATTCAGAACAGTTTGAT
CAAGCGAAATAAATCAACCGATATCGAAGATGGCACTGGAGGTTAACGTG
AAAGCAAGTTCATCATCCTCGCAAGAAGAACTGGAGAATCGAATTAGAAC
GTTGACAGACAGCCTCATACACAAACAAACTGTTGTCGAAGCGCTCAGCA
CTGAAAAGAATTCACTCAATTTACAGCTGGAGCGACTAGAGGAATACGAA
GCTGAAGTAAAACGCCTTCAAAATCAAGAATTACACTTCACTCGTGAGGA
AATACATAGCTTGAAGAAATCTCAAATCAGCAAAAATCAGGATTTGGATA
TGTTGCATAAGAACGATTCAGATGATAATCAAGACAAAATCGAGACACTT
CAATCCTCTTTACAAGATGAAGTTCAAAAGAGACAAACGGCTGAAGAAGA
CATGAAAAGATATATTCAGGCCAAAGAGAAGTTGATAGCGTCATTACGTC
AAGGGAGTGATTCCACCTCAGACGTTTCACCGACTTTACTATCGGAACTG
GAAGAATTGCGACAAGACCGAGACATGGTGCGCGACGAACTTCAACAAAA
CAAATATAAGATGGAACAACTGCGACAAGAATATCTGATAAAACAAGGGA
GCTGGAAATGAGAGTAAAAGTGGCGGAAGACTCCGCTGAAAATTCACAAA
AGGAATTGAAAGAATATAAAGACAAAGCTGCTCGTATTCTTCAGAACGAA
CTACTGAATGTCAACACGAAATTAGAAACAGAACAACAACAGTACGCTGT
CAACATCAAAGATCTCCACAGTAAACAAACGCAAGGAAAAGGTTGCTAAG
AGACCACAGTGAAGCATCGGGTGTCCAAGGGACGGTCATGAGTAATTTAC
GTCAAAAGATGGAAGAACTGGAAAATGAACTTCGAAAAGAAAAACTCGAA
AATAGTTCCATGAAGAAACGGAGAAATATCGAACACGTTACGAGAACCGT
CGTAACCAACAGAACGAAGATTACGAGCGCGTAAGAGCTGGTTTCGAGAA
TCGCGAAGCTGATCTGAACGAAGCTTTGAAAGCGAAAGACTCGCAACTGG
CTGTGCTTCGTGTTCGTATACAGGAAACTGATGCTGAGTTACAAGGGAAG
ACGAAATCATTGGAAGATGTCCAAAAACAAAACGAACACCATAGACACTG
TCCCTCCACTATCAGCAAAACCGTCAATCTCTCCTGTAAACATTGATACA
GTTGACGCAGTCCCCGTCATTGAAAAACCGACGACGACAACTCAGAAAGA
ACCACTCATCCACCAAATGAATAGTAAAGAGAGCAAGGATGGAGAAAGCC
GAGTTTCTAGTCTAAATCTTGAAAATACGTTACTAAAGAATGAATTACAA
TCGTTGCATGAGGAGTTGGCAACCTTGTCGTCGAAATTGAAAGAACAACA
GAAAGCTTCCACGAGTACTTACACACCTGTAGCTTCAGTCTCAACAACCA
CCAGACCACCAGTATTGACCAACAAACCTTTACAGCAAGTTTCATCCTCT
GCAACAAACTCACCAAACATGAGTCGCTCATCTAGTTCATCTTCTCTCAA
GAAGGAGGAGGACATGTTGTTCGAATTCCTCAACTCCAACCCACCACCAG
CAACCGCTATCAAAGGTCATACTAGAAATCTATCAGGTCCCAAAACCTCG
ACACCACGACGTCCTTCCGCTACGACCGCTTCCACAATCCCAGTCAGCCA
AACTACAACGACAGTTTCCACCAGACCAGAAGGACCAGATGTCCTGGCTA
TCAGATTTCACGTCCAAGGCTGAAAACTTGTTGACCAAGTTCGATCAAAC
TGCTGCACAAACGTTAAATGAATCTGGCATACAAGACACACTACATAATG
TCACACAACCAGCACCGACCACAGCTTCACCTTCTTACGAACAAGAATCA
CCAGTCACTACTGCTTCTTCCAAAGAATATCAGAATGCATCACATCTCTT
TGGTGGAACTCAAAACGAACGGAAATCACTACCTACGAACCCAGCTCCTA
CTCCACTTGTGGGTAACTTTTGTCATTTTGACGTACACTCCTGAAATACA
CAACCACGACTTCACGCCAGAATCGCCCAAATAATATACGACTCGGTGTC
TTCCTGCGACGCTACCCGATTGCTCGTCTTATGGTCATCTTTTATATGAA
GCGAAATTACTACCGATGAATACCATTATGCCGAAACAAATTACTGGGAA
TGTTCGCTGGAGGTCCACCGTCAACGAAATTGATAAATTCAGAAACAATA
CAAAGACATTCAGAACAGTTTGATCAAGCGAAATAAATCAACCGATATCG
AAGATGGCACTGGAGGTTAACGTGAAAGCAAGTTCATCATCCTCGCAAGA
AGAACTGGAGAATCGAATTAGAACGTTGACAGACAGCCTCATACACAAAC
AAACTGTTGTCGAAGCGCTCAGCACTGAAAAGAATTCACTCAATTTACAG
CTGGAGCGACTAGAGGAATACGAAGCTGAAGTAAAACGCCTTCAAAATCA
AGAATTACACTTCACTCGTGAGGAAATACATAGCTTGAAGAAATCTCAAA
TCAGCAAAAATCAGGATTTGGATATGTTGCATAAGAACGATTCAGATGAT
AATCAAGACAAAATCGAGACACTTCAATCCTCTTTACAAGATGAAGTTCA
AAAGAGACAAACGGCTGAAGAAGACATGAAAAGATATATTCAGGCCAAAG
AGAAGTTGATAGCGTCATTACGTCAAGGGAGTGATTCCACCTCAGACGTT
TCACCGACTTTACTATCGGAACTGGAAGAATTGCGACAAGACCGAGACAT
GGTGCGCGACGAACTTCAACAAAACAAATATAAGATGGAACAACTGCGAC
AAGAATATCTGATAAAACAAGGGAGCTGGAAATGAGAGTAAAAGTGGCGG
AAGACTCCGCTGAAAATTCACAAAAGGAATTGAAAGAATATAAAGACAAA
GCTGCTCGTATTCTTCAGAACGAACTACTGAATGTCAACACGAAATTAGA
AACAGAACAACAACAGTACGCTGTCAACATCAAAGATCTCCACAGTAAAC
AAACGCAAGGAAAAGGTTGCTAAGAGACCACAGTGAAGCATCGGGTGTCC
AAGGGACGGTCATGAGTAATTTACGTCAAAAGATGGAAGAACTGGAAAAT
GAACTTCGAAAAGAAAAACTCGAAAATAGTTCCATGAAGAAACGGAGAAA
TATCGAACACGTTACGAGAACCGTCGTAACCAACAGAACGAAGATTACGA
GCGCGTAAGAGCTGGTTTCGAGAATCGCGAAGCTGATCTGAACGAAGCTT
TGAAAGCGAAAGACTCGCAACTGGCTGTGCTTCGTGTTCGTATACAGGAA
ACTGATGCTGAGTTACAAGGGAAGACGAAATCATTGGAAGATGTCCAAAA
ACAAAACGAACACCATAGACACTGTCCCTCCACTATCAGCAAAACCGTCA
ATCTCTCCTGTAAACATTGATACAGTTGACGCAGTCCCCGTCATTGAAAA
ACCGACGACGACAACTCAGAAAGAACCACTCATCCACCAAATGAATAGTA
AAGAGAGCAAGGATGGAGAAAGCCGAGTTTCTAGTCTAAATCTTGAAAAT
ACGTTACTAAAGAATGAATTACAATCGTTGCATGAGGAGTTGGCAACCTT
GTCGTCGAAATTGAAAGAACAACAGAAAGCTTCCACGAGTACTTACACAC
CTGTAGCTTCAGTCTCAACAACCACCAGACCACCAGTATTGACCAACAAA
CCTTTACAGCAAGTTTCATCCTCTGCAACAAACTCACCAAACATGAGTCG
CTCATCTAGTTCATCTTCTCTCAAGAAGGAGGAGGACATGTTGTTCGAAT
TCCTCAACTCCAACCCACCACCAGCAACCGCTATCAAAGGTCATACTAGA
AATCTATCAGGTCCCAAAACCTCGACACCACGACGTCCTTCCGCTACGAC
CGCTTCCACAATCCCAGTCAGCCAAACTACAACGACAGTTTCCACCAGAC
CAGAAGGACCAGATGTCCTGGCTATCAGATTTCACGTCCAAGGCTGAAAA
CTTGTTGACCAAGTTCGATCAAACTGCTGCACAAACGTTAAATGAATCTG
GCATACAAGACACACTACATAATGTCACACAACCAGCACCGACCACAGCT
TCACCTTCTTACGAACAAGAATCACCAGTCACTACTGCTTCTTCCAAAGA
ATATCAGAATGCATCACATCTCTTTGGTGGAACTCAAAACGAACGGAAAT
CACTACCTACGAACCCAGCTCCTACTCCACTTGTGGGTAACTTTTGTCAT
TTTGACGTACACTCCTGAAATACACAACCACGACTTCACGCCAGAATCGC
CCAAATAATATACGACTCGGTGTCTTCCTGCGACGCTACCCGATTGCTCG
TCTTATGGTCATCTTTTATATGAAGCGAAATTACTACCGATGAATACCAT
TATGCCGAAACAAATTACTGGGAATGTTCGCTGGAGGTCCACCGTCAACG
AAATTGATAAATTCAGAAACAATACAAAGACATTCAGAACAGTTTGATCA
AGCGAAATAAATCAACCGATATCGAAGATGGCACTGGAGGTTAACGTGAA
AGCAAGTTCATCATCCTCGCAAGAAGAACTGGAGAATCGAATTAGAACGT
TGACAGACAGCCTCATACACAAACAAACTGTTGTCGAAGCGCTCAGCACT
GAAAAGAATTCACTCAATTTACAGCTGGAGCGACTAGAGGAATACGAAGC
TGAAGTAAAACGCCTTCAAAATCAAGAATTACACTTCACTCGTGAGGAAA
TACATAGCTTGAAGAAATCTCAAATCAGCAAAAATCAGGATTTGGATATG
TTGCATAAGAACGATTCAGATGATAATCAAGACAAAATCGAGACACTTCA
ATCCTCTTTACAAGATGAAGTTCAAAAGAGACAAACGGCTGAAGAAGACA
TGAAAAGATATATTCAGGCCAAAGAGAAGTTGATAGCGTCATTACGTCAA
GGGAGTGATTCCACCTCAGACGTTTCACCGACTTTACTATCGGAACTGGA
AGAATTGCGACAAGACCGAGACATGGTGCGCGACGAACTTCAACAAAACA
AATATAAGATGGAACAACTGCGACAAGAATATCTGATAAAACAAGGGAGC
TGGAAATGAGAGTAAAAGTGGCGGAAGACTCCGCTGAAAATTCACAAAAG
GAATTGAAAGAATATAAAGACAAAGCTGCTCGTATTCTTCAGAACGAACT
ACTGAATGTCAACACGAAATTAGAAACAGAACAACAACAGTACGCTGTCA
ACATCAAAGATCTCCACAGTAAACAAACGCAAGGAAAAGGTTGCTAAGAG
ACCACAGTGAAGCATCGGGTGTCCAAGGGACGGTCATGAGTAATTTACGT
CAAAAGATGGAAGAACTGGAAAATGAACTTCGAAAAGAAAAACTCGAAAA
TAGTTCCATGAAGAAACGGAGAAATATCGAACACGTTACGAGAACCGTCG
TAACCAACAGAACGAAGATTACGAGCGCGTAAGAGCTGGTTTCGAGAATC
GCGAAGCTGATCTGAACGAAGCTTTGAAAGCGAAAGACTCGCAACTGGCT
GTGCTTCGTGTTCGTATACAGGAAACTGATGCTGAGTTACAAGGGAAGAC
GAAATCATTGGAAGATGTCCAAAAACAAAACGAACACCATAGACACTGTC
CCTCCACTATCAGCAAAACCGTCAATCTCTCCTGTAAACATTGATACAGT
TGACGCAGTCCCCGTCATTGAAAAACCGACGACGACAACTCAGAAAGAAC
CACTCATCCACCAAATGAATAGTAAAGAGAGCAAGGATGGAGAAAGCCGA
GTTTCTAGTCTAAATCTTGAAAATACGTTACTAAAGAATGAATTACAATC
GTTGCATGAGGAGTTGGCAACCTTGTCGTCGAAATTGAAAGAACAACAGA
AAGCTTCCACGAGTACTTACACACCTGTAGCTTCAGTCTCAACAACCACC
AGACCACCAGTATTGACCAACAAACCTTTACAGCAAGTTTCATCCTCTGC
AACAAACTCACCAAACATGAGTCGCTCATCTAGTTCATCTTCTCTCAAGA
AGGAGGAGGACATGTTGTTCGAATTCCTCAACTCCAACCCACCACCAGCA
ACCGCTATCAAAGGTCATACTAGAAATCTATCAGGTCCCAAAACCTCGAC
ACCACGACGTCCTTCCGCTACGACCGCTTCCACAATCCCAGTCAGCCAAA
CTACAACGACAGTTTCCACCAGACCAGAAGGACCAGATGTCCTGGCTATC
AGATTTCACGTCCAAGGCTGAAAACTTGTTGACCAAGTTCGATCAAACTG
CTGCACAAACGTTAAATGAATCTGGCATACAAGACACACTACATAATGTC
ACACAACCAGCACCGACCACAGCTTCACCTTCTTACGAACAAGAATCACC
AGTCACTACTGCTTCTTCCAAAGAATATCAGAATGCATCACATCTCTTTG
GTGGAACTCAAAACGAACGGAAATCACTACCTACGAACCCAGCTCCTACT
CCACTTGTGGGTAACTTTTGTCATTTTGACGTACACTCCTGAAATACACA
ACCACGACTTCACGCCAGAATCGCCCAAATAATATACGACTCGGTGTCTT
CCTGCGACGCTACCCGATTGCTCGTCTTATGGTCATCTTTTATATGAAGC
GAAATTACTACCGATGAATACCATTATGCCGAAACAAATTACTGGGAATG
TTCGCTGGAGGTCCACCGTCAACGAAATTGATAAATTCAGAAACAATACA
AAGACATTCAGAACAGTTTGATCAAGCGAAATAAATCAACCGATATCGAA
GATGGCACTGGAGGTTAACGTGAAAGCAAGTTCATCATCCTCGCAAGAAG
AACTGGAGAATCGAATTAGAACGTTGACAGACAGCCTCATACACAAACAA
ACTGTTGTCGAAGCGCTCAGCACTGAAAAGAATTCACTCAATTTACAGCT
GGAGCGACTAGAGGAATACGAAGCTGAAGTAAAACGCCTTCAAAATCAAG
AATTACACTTCACTCGTGAGGAAATACATAGCTTGAAGAAATCTCAAATC
AGCAAAAATCAGGATTTGGATATGTTGCATAAGAACGATTCAGATGATAA
TCAAGACAAAATCGAGACACTTCAATCCTCTTTACAAGATGAAGTTCAAA
AGAGACAAACGGCTGAAGAAGACATGAAAAGATATATTCAGGCCAAAGAG
AAGTTGATAGCGTCATTACGTCAAGGGAGTGATTCCACCTCAGACGTTTC
ACCGACTTTACTATCGGAACTGGAAGAATTGCGACAAGACCGAGACATGG
TGCGCGACGAACTTCAACAAAACAAATATAAGATGGAACAACTGCGACAA
GAATATCTGATAAAACAAGGGAGCTGGAAATGAGAGTAAAAGTGGCGGAA
GACTCCGCTGAAAATTCACAAAAGGAATTGAAAGAATATAAAGACAAAGC
TGCTCGTATTCTTCAGAACGAACTACTGAATGTCAACACGAAATTAGAAA
CAGAACAACAACAGTACGCTGTCAACATCAAAGATCTCCACAGTAAACAA
ACGCAAGGAAAAGGTTGCTAAGAGACCACAGTGAAGCATCGGGTGTCCAA
GGGACGGTCATGAGTAATTTACGTCAAAAGATGGAAGAACTGGAAAATGA
ACTTCGAAAAGAAAAACTCGAAAATAGTTCCATGAAGAAACGGAGAAATA
TCGAACACGTTACGAGAACCGTCGTAACCAACAGAACGAAGATTACGAGC
GCGTAAGAGCTGGTTTCGAGAATCGCGAAGCTGATCTGAACGAAGCTTTG
AAAGCGAAAGACTCGCAACTGGCTGTGCTTCGTGTTCGTATACAGGAAAC
TGATGCTGAGTTACAAGGGAAGACGAAATCATTGGAAGATGTCCAAAAAC
AAAACGAACACCATAGACACTGTCCCTCCACTATCAGCAAAACCGTCAAT
CTCTCCTGTAAACATTGATACAGTTGACGCAGTCCCCGTCATTGAAAAAC
CGACGACGACAACTCAGAAAGAACCACTCATCCACCAAATGAATAGTAAA
GAGAGCAAGGATGGAGAAAGCCGAGTTTCTAGTCTAAATCTTGAAAATAC
GTTACTAAAGAATGAATTACAATCGTTGCATGAGGAGTTGGCAACCTTGT
CGTCGAAATTGAAAGAACAACAGAAAGCTTCCACGAGTACTTACACACCT
GTAGCTTCAGTCTCAACAACCACCAGACCACCAGTATTGACCAACAAACC
TTTACAGCAAGTTTCATCCTCTGCAACAAACTCACCAAACATGAGTCGCT
CATCTAGTTCATCTTCTCTCAAGAAGGAGGAGGACATGTTGTTCGAATTC
CTCAACTCCAACCCACCACCAGCAACCGCTATCAAAGGTCATACTAGAAA
TCTATCAGGTCCCAAAACCTCGACACCACGACGTCCTTCCGCTACGACCG
CTTCCACAATCCCAGTCAGCCAAACTACAACGACAGTTTCCACCAGACCA
GAAGGACCAGATGTCCTGGCTATCAGATTTCACGTCCAAGGCTGAAAACT
TGTTGACCAAGTTCGATCAAACTGCTGCACAAACGTTAAATGAATCTGGC
ATACAAGACACACTACATAATGTCACACAACCAGCACCGACCACAGCTTC
ACCTTCTTACGAACAAGAATCACCAGTCACTACTGCTTCTTCCAAAGAAT
ATCAGAATGCATCACATCTCTTTGGTGGAACTCAAAACGAACGGAAATCA
CTACCTACGAACCCAGCTCCTACTCCACTTGTGGGTAACTTTTGTCATTT
TGACGTACACTCCTGAAATACACAACCACGACTTCACGCCAGAATCGCCC
AAATAATATACGACTCGGTGTCTTCCTGCGACGCTACCCGATTGCTCGTC
TTATGGTCATCTTTTATATGAAGCGAAATTACTACCGATGAATACCATTA
TGCCGAAACAAATTACTGGGAATGTTCGCTGGAGGTCCACCGTCAACGAA
ATTGATAAATTCAGAAACAATACAAAGACATTCAGAACAGTTTGATCAAG
CGAAATAAATCAACCGATATCGAAGATGGCACTGGAGGTTAACGTGAAAG
CAAGTTCATCATCCTCGCAAGAAGAACTGGAGAATCGAATTAGAACGTTG
ACAGACAGCCTCATACACAAACAAACTGTTGTCGAAGCGCTCAGCACTGA
AAAGAATTCACTCAATTTACAGCTGGAGCGACTAGAGGAATACGAAGCTG
AAGTAAAACGCCTTCAAAATCAAGAATTACACTTCACTCGTGAGGAAATA
CATAGCTTGAAGAAATCTCAAATCAGCAAAAATCAGGATTTGGATATGTT
GCATAAGAACGATTCAGATGATAATCAAGACAAAATCGAGACACTTCAAT
CCTCTTTACAAGATGAAGTTCAAAAGAGACAAACGGCTGAAGAAGACATG
AAAAGATATATTCAGGCCAAAGAGAAGTTGATAGCGTCATTACGTCAAGG
GAGTGATTCCACCTCAGACGTTTCACCGACTTTACTATCGGAACTGGAAG
AATTGCGACAAGACCGAGACATGGTGCGCGACGAACTTCAACAAAACAAA
TATAAGATGGAACAACTGCGACAAGAATATCTGATAAAACAAGGGAGCTG
GAAATGAGAGTAAAAGTGGCGGAAGACTCCGCTGAAAATTCACAAAAGGA
ATTGAAAGAATATAAAGACAAAGCTGCTCGTATTCTTCAGAACGAACTAC
TGAATGTCAACACGAAATTAGAAACAGAACAACAACAGTACGCTGTCAAC
ATCAAAGATCTCCACAGTAAACAAACGCAAGGAAAAGGTTGCTAAGAGAC
CACAGTGAAGCATCGGGTGTCCAAGGGACGGTCATGAGTAATTTACGTCA
AAAGATGGAAGAACTGGAAAATGAACTTCGAAAAGAAAAACTCGAAAATA
GTTCCATGAAGAAACGGAGAAATATCGAACACGTTACGAGAACCGTCGTA
ACCAACAGAACGAAGATTACGAGCGCGTAAGAGCTGGTTTCGAGAATCGC
GAAGCTGATCTGAACGAAGCTTTGAAAGCGAAAGACTCGCAACTGGCTGT
GCTTCGTGTTCGTATACAGGAAACTGATGCTGAGTTACAAGGGAAGACGA
AATCATTGGAAGATGTCCAAAAACAAAACGAACACCATAGACACTGTCCC
TCCACTATCAGCAAAACCGTCAATCTCTCCTGTAAACATTGATACAGTTG
ACGCAGTCCCCGTCATTGAAAAACCGACGACGACAACTCAGAAAGAACCA
CTCATCCACCAAATGAATAGTAAAGAGAGCAAGGATGGAGAAAGCCGAGT
TTCTAGTCTAAATCTTGAAAATACGTTACTAAAGAATGAATTACAATCGT
TGCATGAGGAGTTGGCAACCTTGTCGTCGAAATTGAAAGAACAACAGAAA
GCTTCCACGAGTACTTACACACCTGTAGCTTCAGTCTCAACAACCACCAG
ACCACCAGTATTGACCAACAAACCTTTACAGCAAGTTTCATCCTCTGCAA
CAAACTCACCAAACATGAGTCGCTCATCTAGTTCATCTTCTCTCAAGAAG
GAGGAGGACATGTTGTTCGAATTCCTCAACTCCAACCCACCACCAGCAAC
CGCTATCAAAGGTCATACTAGAAATCTATCAGGTCCCAAAACCTCGACAC
CACGACGTCCTTCCGCTACGACCGCTTCCACAATCCCAGTCAGCCAAACT
ACAACGACAGTTTCCACCAGACCAGAAGGACCAGATGTCCTGGCTATCAG
ATTTCACGTCCAAGGCTGAAAACTTGTTGACCAAGTTCGATCAAACTGCT
GCACAAACGTTAAATGAATCTGGCATACAAGACACACTACATAATGTCAC
ACAACCAGCACCGACCACAGCTTCACCTTCTTACGAACAAGAATCACCAG
TCACTACTGCTTCTTCCAAAGAATATCAGAATGCATCACATCTCTTTGGT
GGAACTCAAAACGAACGGAAATCACTACCTACGAACCCAGCTCCTACTCC
ACTTGTGGGTAACTTTTGTCATTTTGACGTACACTCCTGAAATACACAAC
CACGACTTCACGCCAGAATCGCCCAAATAATATACGACTCGGTGTCTTCC
TGCGACGCTACCCGATTGCTCGTCTTATGGTCATCTTTTATATGAAGCGA
AATTACTACCGATGAATACCATTATGCCGAAACAAATTACTGGGAATGTT
CGCTGGAGGTCCACCGTCAACGAAATTGATAAATTCAGAAACAATACAAA
GACATTCAGAACAGTTTGATCAAGCGAAATAAATCAACCGATATCGAAGA
TGGCACTGGAGGTTAACGTGAAAGCAAGTTCATCATCCTCGCAAGAAGAA
CTGGAGAATCGAATTAGAACGTTGACAGACAGCCTCATACACAAACAAAC
TGTTGTCGAAGCGCTCAGCACTGAAAAGAATTCACTCAATTTACAGCTGG
AGCGACTAGAGGAATACGAAGCTGAAGTAAAACGCCTTCAAAATCAAGAA
TTACACTTCACTCGTGAGGAAATACATAGCTTGAAGAAATCTCAAATCAG
CAAAAATCAGGATTTGGATATGTTGCATAAGAACGATTCAGATGATAATC
AAGACAAAATCGAGACACTTCAATCCTCTTTACAAGATGAAGTTCAAAAG
AGACAAACGGCTGAAGAAGACATGAAAAGATATATTCAGGCCAAAGAGAA
GTTGATAGCGTCATTACGTCAAGGGAGTGATTCCACCTCAGACGTTTCAC
CGACTTTACTATCGGAACTGGAAGAATTGCGACAAGACCGAGACATGGTG
CGCGACGAACTTCAACAAAACAAATATAAGATGGAACAACTGCGACAAGA
ATATCTGATAAAACAAGGGAGCTGGAAATGAGAGTAAAAGTGGCGGAAGA
CTCCGCTGAAAATTCACAAAAGGAATTGAAAGAATATAAAGACAAAGCTG
CTCGTATTCTTCAGAACGAACTACTGAATGTCAACACGAAATTAGAAACA
GAACAACAACAGTACGCTGTCAACATCAAAGATCTCCACAGTAAACAAAC
GCAAGGAAAAGGTTGCTAAGAGACCACAGTGAAGCATCGGGTGTCCAAGG
GACGGTCATGAGTAATTTACGTCAAAAGATGGAAGAACTGGAAAATGAAC
TTCGAAAAGAAAAACTCGAAAATAGTTCCATGAAGAAACGGAGAAATATC
GAACACGTTACGAGAACCGTCGTAACCAACAGAACGAAGATTACGAGCGC
GTAAGAGCTGGTTTCGAGAATCGCGAAGCTGATCTGAACGAAGCTTTGAA
AGCGAAAGACTCGCAACTGGCTGTGCTTCGTGTTCGTATACAGGAAACTG
ATGCTGAGTTACAAGGGAAGACGAAATCATTGGAAGATGTCCAAAAACAA
AACGAACACCATAGACACTGTCCCTCCACTATCAGCAAAACCGTCAATCT
CTCCTGTAAACATTGATACAGTTGACGCAGTCCCCGTCATTGAAAAACCG
ACGACGACAACTCAGAAAGAACCACTCATCCACCAAATGAATAGTAAAGA
GAGCAAGGATGGAGAAAGCCGAGTTTCTAGTCTAAATCTTGAAAATACGT
TACTAAAGAATGAATTACAATCGTTGCATGAGGAGTTGGCAACCTTGTCG
TCGAAATTGAAAGAACAACAGAAAGCTTCCACGAGTACTTACACACCTGT
AGCTTCAGTCTCAACAACCACCAGACCACCAGTATTGACCAACAAACCTT
TACAGCAAGTTTCATCCTCTGCAACAAACTCACCAAACATGAGTCGCTCA
TCTAGTTCATCTTCTCTCAAGAAGGAGGAGGACATGTTGTTCGAATTCCT
CAACTCCAACCCACCACCAGCAACCGCTATCAAAGGTCATACTAGAAATC
TATCAGGTCCCAAAACCTCGACACCACGACGTCCTTCCGCTACGACCGCT
TCCACAATCCCAGTCAGCCAAACTACAACGACAGTTTCCACCAGACCAGA
AGGACCAGATGTCCTGGCTATCAGATTTCACGTCCAAGGCTGAAAACTTG
TTGACCAAGTTCGATCAAACTGCTGCACAAACGTTAAATGAATCTGGCAT
ACAAGACACACTACATAATGTCACACAACCAGCACCGACCACAGCTTCAC
CTTCTTACGAACAAGAATCACCAGTCACTACTGCTTCTTCCAAAGAATAT
CAGAATGCATCACATCTCTTTGGTGGAACTCAAAACGAACGGAAATCACT
ACCTACGAACCCAGCTCCTACTCCACTTGTGGGTAACTTTTGTCATTTTG
ACGTACACTCCTGAAATACACAACCACGACTTCACGCCAGAATCGCCCAA
ATAATATACGACTCGGTGTCTTCCTGCGACGCTACCCGATTGCTCGTCTT
ATGGTCATCTTTTATATGAAGCGAAATTACTACCGATGAATACCATTATG
CCGAAACAAATTACTGGGAATGTTCGCTGGAGGTCCACCGTCAACGAAAT
TGATAAATTCAGAAACAATACAAAGACATTCAGAACAGTTTGATCAAGCG
AAATAAATCAACCGATATCGAAGATGGCACTGGAGGTTAACGTGAAAGCA
AGTTCATCATCCTCGCAAGAAGAACTGGAGAATCGAATTAGAACGTTGAC
AGACAGCCTCATACACAAACAAACTGTTGTCGAAGCGCTCAGCACTGAAA
AGAATTCACTCAATTTACAGCTGGAGCGACTAGAGGAATACGAAGCTGAA
GTAAAACGCCTTCAAAATCAAGAATTACACTTCACTCGTGAGGAAATACA
TAGCTTGAAGAAATCTCAAATCAGCAAAAATCAGGATTTGGATATGTTGC
ATAAGAACGATTCAGATGATAATCAAGACAAAATCGAGACACTTCAATCC
TCTTTACAAGATGAAGTTCAAAAGAGACAAACGGCTGAAGAAGACATGAA
AAGATATATTCAGGCCAAAGAGAAGTTGATAGCGTCATTACGTCAAGGGA
GTGATTCCACCTCAGACGTTTCACCGACTTTACTATCGGAACTGGAAGAA
TTGCGACAAGACCGAGACATGGTGCGCGACGAACTTCAACAAAACAAATA
TAAGATGGAACAACTGCGACAAGAATATCTGATAAAACAAGGGAGCTGGA
AATGAGAGTAAAAGTGGCGGAAGACTCCGCTGAAAATTCACAAAAGGAAT
TGAAAGAATATAAAGACAAAGCTGCTCGTATTCTTCAGAACGAACTACTG
AATGTCAACACGAAATTAGAAACAGAACAACAACAGTACGCTGTCAACAT
CAAAGATCTCCACAGTAAACAAACGCAAGGAAAAGGTTGCTAAGAGACCA
CAGTGAAGCATCGGGTGTCCAAGGGACGGTCATGAGTAATTTACGTCAAA
AGATGGAAGAACTGGAAAATGAACTTCGAAAAGAAAAACTCGAAAATAGT
TCCATGAAGAAACGGAGAAATATCGAACACGTTACGAGAACCGTCGTAAC
CAACAGAACGAAGATTACGAGCGCGTAAGAGCTGGTTTCGAGAATCGCGA
AGCTGATCTGAACGAAGCTTTGAAAGCGAAAGACTCGCAACTGGCTGTGC
TTCGTGTTCGTATACAGGAAACTGATGCTGAGTTACAAGGGAAGACGAAA
TCATTGGAAGATGTCCAAAAACAAAACGAACACCATAGACACTGTCCCTC
CACTATCAGCAAAACCGTCAATCTCTCCTGTAAACATTGATACAGTTGAC
GCAGTCCCCGTCATTGAAAAACCGACGACGACAACTCAGAAAGAACCACT
CATCCACCAAATGAATAGTAAAGAGAGCAAGGATGGAGAAAGCCGAGTTT
CTAGTCTAAATCTTGAAAATACGTTACTAAAGAATGAATTACAATCGTTG
CATGAGGAGTTGGCAACCTTGTCGTCGAAATTGAAAGAACAACAGAAAGC
TTCCACGAGTACTTACACACCTGTAGCTTCAGTCTCAACAACCACCAGAC
CACCAGTATTGACCAACAAACCTTTACAGCAAGTTTCATCCTCTGCAACA
AACTCACCAAACATGAGTCGCTCATCTAGTTCATCTTCTCTCAAGAAGGA
GGAGGACATGTTGTTCGAATTCCTCAACTCCAACCCACCACCAGCAACCG
CTATCAAAGGTCATACTAGAAATCTATCAGGTCCCAAAACCTCGACACCA
CGACGTCCTTCCGCTACGACCGCTTCCACAATCCCAGTCAGCCAAACTAC
AACGACAGTTTCCACCAGACCAGAAGGACCAGATGTCCTGGCTATCAGAT
TTCACGTCCAAGGCTGAAAACTTGTTGACCAAGTTCGATCAAACTGCTGC
ACAAACGTTAAATGAATCTGGCATACAAGACACACTACATAATGTCACAC
AACCAGCACCGACCACAGCTTCACCTTCTTACGAACAAGAATCACCAGTC
ACTACTGCTTCTTCCAAAGAATATCAGAATGCATCACATCTCTTTGGTGG
AACTCAAAACGAACGGAAATCACTACCTACGAACCCAGCTCCTACTCCAC
TTGTGGGTAACTTTTGTCATTTTGACGTACACTCCTGAAATACACAACCA
CGACTTCACGCCAGAATCGCCCAAATAATATACGACTCGGTGTCTTCCTG
CGACGCTACCCGATTGCTCGTCTTATGGTCATCTTTTATATGAAGCGAAA
TTACTACCGATGAATACCATTATGCCGAAACAAATTACTGGGAATGTTCG
CTGGAGGTCCACCGTCAACGAAATTGATAAATTCAGAAACAATACAAAGA
CATTCAGAACAGTTTGATCAAGCGAAATAAATCAACCGATATCGAAGATG
GCACTGGAGGTTAACGTGAAAGCAAGTTCATCATCCTCGCAAGAAGAACT
GGAGAATCGAATTAGAACGTTGACAGACAGCCTCATACACAAACAAACTG
TTGTCGAAGCGCTCAGCACTGAAAAGAATTCACTCAATTTACAGCTGGAG
CGACTAGAGGAATACGAAGCTGAAGTAAAACGCCTTCAAAATCAAGAATT
ACACTTCACTCGTGAGGAAATACATAGCTTGAAGAAATCTCAAATCAGCA
AAAATCAGGATTTGGATATGTTGCATAAGAACGATTCAGATGATAATCAA
GACAAAATCGAGACACTTCAATCCTCTTTACAAGATGAAGTTCAAAAGAG
ACAAACGGCTGAAGAAGACATGAAAAGATATATTCAGGCCAAAGAGAAGT
TGATAGCGTCATTACGTCAAGGGAGTGATTCCACCTCAGACGTTTCACCG
ACTTTACTATCGGAACTGGAAGAATTGCGACAAGACCGAGACATGGTGCG
CGACGAACTTCAACAAAACAAATATAAGATGGAACAACTGCGACAAGAAT
ATCTGATAAAACAAGGGAGCTGGAAATGAGAGTAAAAGTGGCGGAAGACT
CCGCTGAAAATTCACAAAAGGAATTGAAAGAATATAAAGACAAAGCTGCT
CGTATTCTTCAGAACGAACTACTGAATGTCAACACGAAATTAGAAACAGA
ACAACAACAGTACGCTGTCAACATCAAAGATCTCCACAGTAAACAAACGC
AAGGAAAAGGTTGCTAAGAGACCACAGTGAAGCATCGGGTGTCCAAGGGA
CGGTCATGAGTAATTTACGTCAAAAGATGGAAGAACTGGAAAATGAACTT
CGAAAAGAAAAACTCGAAAATAGTTCCATGAAGAAACGGAGAAATATCGA
ACACGTTACGAGAACCGTCGTAACCAACAGAACGAAGATTACGAGCGCGT
AAGAGCTGGTTTCGAGAATCGCGAAGCTGATCTGAACGAAGCTTTGAAAG
CGAAAGACTCGCAACTGGCTGTGCTTCGTGTTCGTATACAGGAAACTGAT
GCTGAGTTACAAGGGAAGACGAAATCATTGGAAGATGTCCAAAAACAAAA
CGAACACCATAGACACTGTCCCTCCACTATCAGCAAAACCGTCAATCTCT
CCTGTAAACATTGATACAGTTGACGCAGTCCCCGTCATTGAAAAACCGAC
GACGACAACTCAGAAAGAACCACTCATCCACCAAATGAATAGTAAAGAGA
GCAAGGATGGAGAAAGCCGAGTTTCTAGTCTAAATCTTGAAAATACGTTA
CTAAAGAATGAATTACAATCGTTGCATGAGGAGTTGGCAACCTTGTCGTC
GAAATTGAAAGAACAACAGAAAGCTTCCACGAGTACTTACACACCTGTAG
CTTCAGTCTCAACAACCACCAGACCACCAGTATTGACCAACAAACCTTTA
CAGCAAGTTTCATCCTCTGCAACAAACTCACCAAACATGAGTCGCTCATC
TAGTTCATCTTCTCTCAAGAAGGAGGAGGACATGTTGTTCGAATTCCTCA
ACTCCAACCCACCACCAGCAACCGCTATCAAAGGTCATACTAGAAATCTA
TCAGGTCCCAAAACCTCGACACCACGACGTCCTTCCGCTACGACCGCTTC
CACAATCCCAGTCAGCCAAACTACAACGACAGTTTCCACCAGACCAGAAG
GACCAGATGTCCTGGCTATCAGATTTCACGTCCAAGGCTGAAAACTTGTT
GACCAAGTTCGATCAAACTGCTGCACAAACGTTAAATGAATCTGGCATAC
AAGACACACTACATAATGTCACACAACCAGCACCGACCACAGCTTCACCT
TCTTACGAACAAGAATCACCAGTCACTACTGCTTCTTCCAAAGAATATCA
GAATGCATCACATCTCTTTGGTGGAACTCAAAACGAACGGAAATCACTAC
CTACGAACCCAGCTCCTACTCCACTTGTGGGTAACTTTTGTCATTTTGAC
GTACACTCCTGAAATACACAACCACGACTTCACGCCAGAATCGCCCAAAT
AATATACGACTCGGTGTCTTCCTGCGACGCTACCCGATTGCTCGTCTTAT
GGTCATCTTTTATATGAAGCGAAATTACTACCGATGAATACCATTATGCC
GAAACAAATTACTGGGAATGTTCGCTGGAGGTCCACCGTCAACGAAATTG
ATAAATTCAGAAACAATACAAAGACATTCAGAACAGTTTGATCAAGCGAA
ATAAATCAACCGATATCGAAGATGGCACTGGAGGTTAACGTGAAAGCAAG
TTCATCATCCTCGCAAGAAGAACTGGAGAATCGAATTAGAACGTTGACAG
ACAGCCTCATACACAAACAAACTGTTGTCGAAGCGCTCAGCACTGAAAAG
AATTCACTCAATTTACAGCTGGAGCGACTAGAGGAATACGAAGCTGAAGT
AAAACGCCTTCAAAATCAAGAATTACACTTCACTCGTGAGGAAATACATA
GCTTGAAGAAATCTCAAATCAGCAAAAATCAGGATTTGGATATGTTGCAT
AAGAACGATTCAGATGATAATCAAGACAAAATCGAGACACTTCAATCCTC
TTTACAAGATGAAGTTCAAAAGAGACAAACGGCTGAAGAAGACATGAAAA
GATATATTCAGGCCAAAGAGAAGTTGATAGCGTCATTACGTCAAGGGAGT
GATTCCACCTCAGACGTTTCACCGACTTTACTATCGGAACTGGAAGAATT
GCGACAAGACCGAGACATGGTGCGCGACGAACTTCAACAAAACAAATATA
AGATGGAACAACTGCGACAAGAATATCTGATAAAACAAGGGAGCTGGAAA
TGAGAGTAAAAGTGGCGGAAGACTCCGCTGAAAATTCACAAAAGGAATTG
AAAGAATATAAAGACAAAGCTGCTCGTATTCTTCAGAACGAACTACTGAA
TGTCAACACGAAATTAGAAACAGAACAACAACAGTACGCTGTCAACATCA
AAGATCTCCACAGTAAACAAACGCAAGGAAAAGGTTGCTAAGAGACCACA
GTGAAGCATCGGGTGTCCAAGGGACGGTCATGAGTAATTTACGTCAAAAG
ATGGAAGAACTGGAAAATGAACTTCGAAAAGAAAAACTCGAAAATAGTTC
CATGAAGAAACGGAGAAATATCGAACACGTTACGAGAACCGTCGTAACCA
ACAGAACGAAGATTACGAGCGCGTAAGAGCTGGTTTCGAGAATCGCGAAG
CTGATCTGAACGAAGCTTTGAAAGCGAAAGACTCGCAACTGGCTGTGCTT
CGTGTTCGTATACAGGAAACTGATGCTGAGTTACAAGGGAAGACGAAATC
ATTGGAAGATGTCCAAAAACAAAACGAACACCATAGACACTGTCCCTCCA
CTATCAGCAAAACCGTCAATCTCTCCTGTAAACATTGATACAGTTGACGC
AGTCCCCGTCATTGAAAAACCGACGACGACAACTCAGAAAGAACCACTCA
TCCACCAAATGAATAGTAAAGAGAGCAAGGATGGAGAAAGCCGAGTTTCT
AGTCTAAATCTTGAAAATACGTTACTAAAGAATGAATTACAATCGTTGCA
TGAGGAGTTGGCAACCTTGTCGTCGAAATTGAAAGAACAACAGAAAGCTT
CCACGAGTACTTACACACCTGTAGCTTCAGTCTCAACAACCACCAGACCA
CCAGTATTGACCAACAAACCTTTACAGCAAGTTTCATCCTCTGCAACAAA
CTCACCAAACATGAGTCGCTCATCTAGTTCATCTTCTCTCAAGAAGGAGG
AGGACATGTTGTTCGAATTCCTCAACTCCAACCCACCACCAGCAACCGCT
ATCAAAGGTCATACTAGAAATCTATCAGGTCCCAAAACCTCGACACCACG
ACGTCCTTCCGCTACGACCGCTTCCACAATCCCAGTCAGCCAAACTACAA
CGACAGTTTCCACCAGACCAGAAGGACCAGATGTCCTGGCTATCAGATTT
CACGTCCAAGGCTGAAAACTTGTTGACCAAGTTCGATCAAACTGCTGCAC
AAACGTTAAATGAATCTGGCATACAAGACACACTACATAATGTCACACAA
CCAGCACCGACCACAGCTTCACCTTCTTACGAACAAGAATCACCAGTCAC
TACTGCTTCTTCCAAAGAATATCAGAATGCATCACATCTCTTTGGTGGAA
CTCAAAACGAACGGAAATCACTACCTACGAACCCAGCTCCTACTCCACTT
GTGGGTAACTTTTGTCATTTTGACGTACACTCCTGAAATACACAACCACG
ACTTCACGCCAGAATCGCCCAAATAATATACGACTCGGTGTCTTCCTGCG
ACGCTACCCGATTGCTCGTCTTATGGTCATCTTTTATATGAAGCGAAATT
ACTACCGATGAATACCATTATGCCGAAACAAATTACTGGGAATGTTCGCT
GGAGGTCCACCGTCAACGAAATTGATAAATTCAGAAACAATACAAAGACA
TTCAGAACAGTTTGATCAAGCGAAATAAATCAACCGATATCGAAGATGGC
ACTGGAGGTTAACGTGAAAGCAAGTTCATCATCCTCGCAAGAAGAACTGG
AGAATCGAATTAGAACGTTGACAGACAGCCTCATACACAAACAAACTGTT
GTCGAAGCGCTCAGCACTGAAAAGAATTCACTCAATTTACAGCTGGAGCG
ACTAGAGGAATACGAAGCTGAAGTAAAACGCCTTCAAAATCAAGAATTAC
ACTTCACTCGTGAGGAAATACATAGCTTGAAGAAATCTCAAATCAGCAAA
AATCAGGATTTGGATATGTTGCATAAGAACGATTCAGATGATAATCAAGA
CAAAATCGAGACACTTCAATCCTCTTTACAAGATGAAGTTCAAAAGAGAC
AAACGGCTGAAGAAGACATGAAAAGATATATTCAGGCCAAAGAGAAGTTG
ATAGCGTCATTACGTCAAGGGAGTGATTCCACCTCAGACGTTTCACCGAC
TTTACTATCGGAACTGGAAGAATTGCGACAAGACCGAGACATGGTGCGCG
ACGAACTTCAACAAAACAAATATAAGATGGAACAACTGCGACAAGAATAT
CTGATAAAACAAGGGAGCTGGAAATGAGAGTAAAAGTGGCGGAAGACTCC
GCTGAAAATTCACAAAAGGAATTGAAAGAATATAAAGACAAAGCTGCTCG
TATTCTTCAGAACGAACTACTGAATGTCAACACGAAATTAGAAACAGAAC
AACAACAGTACGCTGTCAACATCAAAGATCTCCACAGTAAACAAACGCAA
GGAAAAGGTTGCTAAGAGACCACAGTGAAGCATCGGGTGTCCAAGGGACG
GTCATGAGTAATTTACGTCAAAAGATGGAAGAACTGGAAAATGAACTTCG
AAAAGAAAAACTCGAAAATAGTTCCATGAAGAAACGGAGAAATATCGAAC
ACGTTACGAGAACCGTCGTAACCAACAGAACGAAGATTACGAGCGCGTAA
GAGCTGGTTTCGAGAATCGCGAAGCTGATCTGAACGAAGCTTTGAAAGCG
AAAGACTCGCAACTGGCTGTGCTTCGTGTTCGTATACAGGAAACTGATGC
TGAGTTACAAGGGAAGACGAAATCATTGGAAGATGTCCAAAAACAAAACG
AACACCATAGACACTGTCCCTCCACTATCAGCAAAACCGTCAATCTCTCC
TGTAAACATTGATACAGTTGACGCAGTCCCCGTCATTGAAAAACCGACGA
CGACAACTCAGAAAGAACCACTCATCCACCAAATGAATAGTAAAGAGAGC
AAGGATGGAGAAAGCCGAGTTTCTAGTCTAAATCTTGAAAATACGTTACT
AAAGAATGAATTACAATCGTTGCATGAGGAGTTGGCAACCTTGTCGTCGA
AATTGAAAGAACAACAGAAAGCTTCCACGAGTACTTACACACCTGTAGCT
TCAGTCTCAACAACCACCAGACCACCAGTATTGACCAACAAACCTTTACA
GCAAGTTTCATCCTCTGCAACAAACTCACCAAACATGAGTCGCTCATCTA
GTTCATCTTCTCTCAAGAAGGAGGAGGACATGTTGTTCGAATTCCTCAAC
TCCAACCCACCACCAGCAACCGCTATCAAAGGTCATACTAGAAATCTATC
AGGTCCCAAAACCTCGACACCACGACGTCCTTCCGCTACGACCGCTTCCA
CAATCCCAGTCAGCCAAACTACAACGACAGTTTCCACCAGACCAGAAGGA
CCAGATGTCCTGGCTATCAGATTTCACGTCCAAGGCTGAAAACTTGTTGA
CCAAGTTCGATCAAACTGCTGCACAAACGTTAAATGAATCTGGCATACAA
GACACACTACATAATGTCACACAACCAGCACCGACCACAGCTTCACCTTC
TTACGAACAAGAATCACCAGTCACTACTGCTTCTTCCAAAGAATATCAGA
ATGCATCACATCTCTTTGGTGGAACTCAAAACGAACGGAAATCACTACCT
ACGAACCCAGCTCCTACTCCACTTGTGGGTAACTTTTGTCATTTTGACGT
ACACTCCTGAAATACACAACCACGACTTCACGCCAGAATCGCCCAAATAA
TATACGACTCGGTGTCTTCCTGCGACGCTACCCGATTGCTCGTCTTATGG
TCATCTTTTATATGAAGCGAAATTACTACCGATGAATACCATTATGCCGA
AACAAATTACTGGGAATGTTCGCTGGAGGTCCACCGTCAACGAAATTGAT
AAATTCAGAAACAATACAAAGACATTCAGAACAGTTTGATCAAGCGAAAT
AAATCAACCGATATCGAAGATGGCACTGGAGGTTAACGTGAAAGCAAGTT
CATCATCCTCGCAAGAAGAACTGGAGAATCGAATTAGAACGTTGACAGAC
AGCCTCATACACAAACAAACTGTTGTCGAAGCGCTCAGCACTGAAAAGAA
TTCACTCAATTTACAGCTGGAGCGACTAGAGGAATACGAAGCTGAAGTAA
AACGCCTTCAAAATCAAGAATTACACTTCACTCGTGAGGAAATACATAGC
TTGAAGAAATCTCAAATCAGCAAAAATCAGGATTTGGATATGTTGCATAA
GAACGATTCAGATGATAATCAAGACAAAATCGAGACACTTCAATCCTCTT
TACAAGATGAAGTTCAAAAGAGACAAACGGCTGAAGAAGACATGAAAAGA
TATATTCAGGCCAAAGAGAAGTTGATAGCGTCATTACGTCAAGGGAGTGA
TTCCACCTCAGACGTTTCACCGACTTTACTATCGGAACTGGAAGAATTGC
GACAAGACCGAGACATGGTGCGCGACGAACTTCAACAAAACAAATATAAG
ATGGAACAACTGCGACAAGAATATCTGATAAAACAAGGGAGCTGGAAATG
AGAGTAAAAGTGGCGGAAGACTCCGCTGAAAATTCACAAAAGGAATTGAA
AGAATATAAAGACAAAGCTGCTCGTATTCTTCAGAACGAACTACTGAATG
TCAACACGAAATTAGAAACAGAACAACAACAGTACGCTGTCAACATCAAA
GATCTCCACAGTAAACAAACGCAAGGAAAAGGTTGCTAAGAGACCACAGT
GAAGCATCGGGTGTCCAAGGGACGGTCATGAGTAATTTACGTCAAAAGAT
GGAAGAACTGGAAAATGAACTTCGAAAAGAAAAACTCGAAAATAGTTCCA
TGAAGAAACGGAGAAATATCGAACACGTTACGAGAACCGTCGTAACCAAC
AGAACGAAGATTACGAGCGCGTAAGAGCTGGTTTCGAGAATCGCGAAGCT
GATCTGAACGAAGCTTTGAAAGCGAAAGACTCGCAACTGGCTGTGCTTCG
TGTTCGTATACAGGAAACTGATGCTGAGTTACAAGGGAAGACGAAATCAT
TGGAAGATGTCCAAAAACAAAACGAACACCATAGACACTGTCCCTCCACT
ATCAGCAAAACCGTCAATCTCTCCTGTAAACATTGATACAGTTGACGCAG
TCCCCGTCATTGAAAAACCGACGACGACAACTCAGAAAGAACCACTCATC
CACCAAATGAATAGTAAAGAGAGCAAGGATGGAGAAAGCCGAGTTTCTAG
TCTAAATCTTGAAAATACGTTACTAAAGAATGAATTACAATCGTTGCATG
AGGAGTTGGCAACCTTGTCGTCGAAATTGAAAGAACAACAGAAAGCTTCC
ACGAGTACTTACACACCTGTAGCTTCAGTCTCAACAACCACCAGACCACC
AGTATTGACCAACAAACCTTTACAGCAAGTTTCATCCTCTGCAACAAACT
CACCAAACATGAGTCGCTCATCTAGTTCATCTTCTCTCAAGAAGGAGGAG
GACATGTTGTTCGAATTCCTCAACTCCAACCCACCACCAGCAACCGCTAT
CAAAGGTCATACTAGAAATCTATCAGGTCCCAAAACCTCGACACCACGAC
GTCCTTCCGCTACGACCGCTTCCACAATCCCAGTCAGCCAAACTACAACG
ACAGTTTCCACCAGACCAGAAGGACCAGATGTCCTGGCTATCAGATTTCA
CGTCCAAGGCTGAAAACTTGTTGACCAAGTTCGATCAAACTGCTGCACAA
ACGTTAAATGAATCTGGCATACAAGACACACTACATAATGTCACACAACC
AGCACCGACCACAGCTTCACCTTCTTACGAACAAGAATCACCAGTCACTA
CTGCTTCTTCCAAAGAATATCAGAATGCATCACATCTCTTTGGTGGAACT
CAAAACGAACGGAAATCACTACCTACGAACCCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000875XLOC_000875Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001682-exon-sc0000011-1575043694:624474..624504TCONS_00001682-exon-sc0000011-1575043694:624474..624504Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:603491..603779TCONS_00001682-exon-sc0000011-1575043694:603491..603779Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:602848..603180TCONS_00001682-exon-sc0000011-1575043694:602848..603180Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:602390..602656TCONS_00001682-exon-sc0000011-1575043694:602390..602656Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:601603..601825TCONS_00001682-exon-sc0000011-1575043694:601603..601825Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:600888..601011TCONS_00001682-exon-sc0000011-1575043694:600888..601011Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:600446..600542TCONS_00001682-exon-sc0000011-1575043694:600446..600542Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:599786..599892TCONS_00001682-exon-sc0000011-1575043694:599786..599892Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:599184..599351TCONS_00001682-exon-sc0000011-1575043694:599184..599351Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:598282..598410TCONS_00001682-exon-sc0000011-1575043694:598282..598410Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:597994..598056TCONS_00001682-exon-sc0000011-1575043694:597994..598056Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:597659..597694TCONS_00001682-exon-sc0000011-1575043694:597659..597694Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:595999..596148TCONS_00001682-exon-sc0000011-1575043694:595999..596148Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:595461..595533TCONS_00001682-exon-sc0000011-1575043694:595461..595533Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:594569..594662TCONS_00001682-exon-sc0000011-1575043694:594569..594662Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:594264..594327TCONS_00001682-exon-sc0000011-1575043694:594264..594327Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1575043694:592890..593958TCONS_00001682-exon-sc0000011-1575043694:592890..593958Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:624474..624504TCONS_00001682-exon-sc0000011-1510915933:624474..624504Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:603491..603779TCONS_00001682-exon-sc0000011-1510915933:603491..603779Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:602848..603180TCONS_00001682-exon-sc0000011-1510915933:602848..603180Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:602390..602656TCONS_00001682-exon-sc0000011-1510915933:602390..602656Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:601603..601825TCONS_00001682-exon-sc0000011-1510915933:601603..601825Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:600888..601011TCONS_00001682-exon-sc0000011-1510915933:600888..601011Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:600446..600542TCONS_00001682-exon-sc0000011-1510915933:600446..600542Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:599786..599892TCONS_00001682-exon-sc0000011-1510915933:599786..599892Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:599184..599351TCONS_00001682-exon-sc0000011-1510915933:599184..599351Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:598282..598410TCONS_00001682-exon-sc0000011-1510915933:598282..598410Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:597994..598056TCONS_00001682-exon-sc0000011-1510915933:597994..598056Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:597659..597694TCONS_00001682-exon-sc0000011-1510915933:597659..597694Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:595999..596148TCONS_00001682-exon-sc0000011-1510915933:595999..596148Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:595461..595533TCONS_00001682-exon-sc0000011-1510915933:595461..595533Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:594569..594662TCONS_00001682-exon-sc0000011-1510915933:594569..594662Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:594264..594327TCONS_00001682-exon-sc0000011-1510915933:594264..594327Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1510915933:592890..593958TCONS_00001682-exon-sc0000011-1510915933:592890..593958Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:624474..624504TCONS_00001682-exon-sc0000011-1491911889:624474..624504Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:603491..603779TCONS_00001682-exon-sc0000011-1491911889:603491..603779Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:602848..603180TCONS_00001682-exon-sc0000011-1491911889:602848..603180Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:602390..602656TCONS_00001682-exon-sc0000011-1491911889:602390..602656Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:601603..601825TCONS_00001682-exon-sc0000011-1491911889:601603..601825Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:600888..601011TCONS_00001682-exon-sc0000011-1491911889:600888..601011Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:600446..600542TCONS_00001682-exon-sc0000011-1491911889:600446..600542Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:599786..599892TCONS_00001682-exon-sc0000011-1491911889:599786..599892Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:599184..599351TCONS_00001682-exon-sc0000011-1491911889:599184..599351Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:598282..598410TCONS_00001682-exon-sc0000011-1491911889:598282..598410Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:597994..598056TCONS_00001682-exon-sc0000011-1491911889:597994..598056Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:597659..597694TCONS_00001682-exon-sc0000011-1491911889:597659..597694Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:595999..596148TCONS_00001682-exon-sc0000011-1491911889:595999..596148Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:595461..595533TCONS_00001682-exon-sc0000011-1491911889:595461..595533Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:594569..594662TCONS_00001682-exon-sc0000011-1491911889:594569..594662Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:594264..594327TCONS_00001682-exon-sc0000011-1491911889:594264..594327Clytia hemisphaericaexon
TCONS_00001682-exon-sc0000011-1491911889:592890..593958TCONS_00001682-exon-sc0000011-1491911889:592890..593958Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001682-proteinTCONS_00001682-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:592890..624504 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
21.1291 20.8936 6.8759 5.01995 34.482 23.684 28.016 29.9653 13.8709 19.5881 14.9187 10.5976 10.1198 10.068 9.89771 11.2478 12.4339 12.8234 8.55473 10.1582 8.92865 10.1421 21.1112 20.276 45.8855 36.8281 13.0696 11.8435 25.7069 26.0493
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR019177Golgin_subfamily_A_member_5
Vocabulary: Biological Process
TermDefinition
GO:0007030Golgi organization
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007030 Golgi organization
Blast
BLAST of TCONS_00001682 vs. Swiss-Prot (Human)
Match: GOGA5 (Golgin subfamily A member 5 OS=Homo sapiens GN=GOLGA5 PE=1 SV=3)

HSP 1 Score: 309.686 bits (792), Expect = 1.413e-90
Identity = 265/769 (34.46%), Postives = 412/769 (53.58%), Query Frame = 2
Query:   65 MSWLSDFTSKAENLLTKFDQTAAQTL----NESGIQDTLHNVTQPAPTTASPSYEQESPVTTASSKEYQNASHLFGGTQNERKSLPTNPASTSTYTPVASVSTTTRPPVLTNKPLQQVXXXXXXXXXXXXXXXXXXLKKEEDMLFEFLNSNPPPATAIKGHTRNLSGPKTSTPRRPSATTASTIPVSQTTTTVSTRPEG--------PAIDTVPPLSAKPSISPVNIDTVDAVPVIEKPTTTTQKEPLIHQMNSKESKDGESR-VSSXXXXXXXXXXXXQSLHEELATLSSKLKEQQKETEKYRTRYENRRNQQNEDYERVRAGFENREADLNEALKAKDSQLAVLRVRIQETDAELQGKTKSLEDVQKQNEQLLRDHSEASGVQGTVMSNLRQKMXXXXXXXXXXXXXXSSMKNELLNVNTKLETEQQQYAVNIKDLHSKQTQGKDKTRELEMRVKVAEDSAENSQKELKEYKDKAARILQAKEKLIASLRQGSDSTSDVSPTLLS-ELEELRQDRDMVRDELQQNKYKMEQLRQEYLDLDMLHKNDSDDNQDKIETLQSSLQDEVQKRQTAEEDMKRYIQELHFTREEIHSLKKSQISKNQEYEAEVKRLQNQVNVKASSSSSQEELENRIRTLTDSLIHKQTVVEALSTEKNSLNLQLERLEKQYKDIQNSLIKRNKSTDIEDGTGEAKLLPMNTIMPKQITGNV-----RWRSTVNEIDKFSIRLGVFLRRYPIARLMVIFYMLLLHLWVTFVILTYTPEIHNHD 2314
            MSW  D   KAE+LL + DQ AA  L    N S I     + T+         Y Q  P +T          ++     N R    T  A T      A+V   +R PV  + P++  S    +S  + R  S    + ++++LF+FLNS+    T        +   K  TP   S+ T+S   V+ + TT+ T  E          A ++      +   S  N+ +  A P    PT                + DG+S  +S+L LEN LL+NE+QSL++E+A+L  + KE Q+E  K R R E + N  +   +R+  G   +  DL EA+ AKDSQLAVL+VR+QE D  L  +T++LE +Q +  ++++D SE + +Q   +   ++++ E +  L++E+     M++E      K+E E+Q  A  I     K +  K +  EL+ +VK+ + + E+S++EL +YK KA RILQ+KEKLI SL++GS      S T  S ELEELR +++M R+E+Q+   ++ QLR E  D++    N+++  +++++ L   +  +   +Q  E +++R  QE H+  E+++  K +  S+ ++ + E+++L+NQ+  K  S+SSQ ELENR+  LT++LI KQT++E+LSTEKNSL  QLERLE+Q      S    +         GE   L    ++      N+     + R   + ID+FSIRLG+FLRRYPIAR+ VI YM LLHLWV  V+LTYTPE+H HD
Sbjct:    1 MSWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIY-QTGPKST----------YISSAADNIRNQKATILAGT------ANVKVGSRTPVEASHPVENASVPRPSSHFVRRKKS----EPDDELLFDFLNSSQKEPTG----RVEIRKEKGKTPVFQSSQTSSVSSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACP-DHTPTP---------------NDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVE-KWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTFQERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDELQQQVKLYKLNLESSKQELIDYKQKATRILQSKEKLINSLKEGSGFEGLDSSTASSMELEELRHEKEMQREEIQKLMGQIHQLRSELQDMEAQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNSASGSSSNGSSINMSGIDNGEGTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYTPEMH-HD 726          
The following BLAST results are available for this feature:
BLAST of TCONS_00001682 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GOGA51.413e-9034.46Golgin subfamily A member 5 OS=Homo sapiens GN=GOL... [more]
back to top