Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001682-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001682-protein
Unique NameTCONS_00001682-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length757

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001682-protein ID=TCONS_00001682-protein|Name=TCONS_00001682-protein|organism=Clytia hemisphaerica|type=polypeptide|length=757bp
MSWLSDFTSKAENLLTKFDQTAAQTLNESGIQDTLHNVTQPAPTTASPSY
EQESPVTTASSKEYQNASHLFGGTQNERKSLPTNPASTSTYTPVASVSTT
TRPPVLTNKPLQQVSSSATNSPNMSRSSSSSSLKKEEDMLFEFLNSNPPP
ATAIKGHTRNLSGPKTSTPRRPSATTASTIPVSQTTTTVSTRPEGPAIDT
VPPLSAKPSISPVNIDTVDAVPVIEKPTTTTQKEPLIHQMNSKESKDGES
RVSSLNLENTLLKNELQSLHEELATLSSKLKEQQKETEKYRTRYENRRNQ
QNEDYERVRAGFENREADLNEALKAKDSQLAVLRVRIQETDAELQGKTKS
LEDVQKQNEQLLRDHSEASGVQGTVMSNLRQKMEELENELRKEKLENSSM
KNELLNVNTKLETEQQQYAVNIKDLHSKQTQGKDKTRELEMRVKVAEDSA
ENSQKELKEYKDKAARILQAKEKLIASLRQGSDSTSDVSPTLLSELEELR
QDRDMVRDELQQNKYKMEQLRQEYLDLDMLHKNDSDDNQDKIETLQSSLQ
DEVQKRQTAEEDMKRYIQELHFTREEIHSLKKSQISKNQEYEAEVKRLQN
QVNVKASSSSSQEELENRIRTLTDSLIHKQTVVEALSTEKNSLNLQLERL
EKQYKDIQNSLIKRNKSTDIEDGTGEAKLLPMNTIMPKQITGNVRWRSTV
NEIDKFSIRLGVFLRRYPIARLMVIFYMLLLHLWVTFVILTYTPEIHNHD
FTPESPK
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000875XLOC_000875Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001682TCONS_00001682Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR019177Golgin_subfamily_A_member_5
Vocabulary: Biological Process
TermDefinition
GO:0007030Golgi organization
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007030 Golgi organization
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 252..300
NoneNo IPR availableCOILSCoilCoilcoord: 302..322
NoneNo IPR availableCOILSCoilCoilcoord: 337..364
NoneNo IPR availableCOILSCoilCoilcoord: 542..608
NoneNo IPR availableCOILSCoilCoilcoord: 633..667
NoneNo IPR availableCOILSCoilCoilcoord: 496..523
NoneNo IPR availableCOILSCoilCoilcoord: 436..477
NoneNo IPR availableCOILSCoilCoilcoord: 376..417
NoneNo IPR availableGENE3D1.20.58.60coord: 106..324
e-value: 2.7E-4
score: 20.6
NoneNo IPR availableGENE3D1.20.5.340coord: 593..669
e-value: 0.06
score: 12.6
NoneNo IPR availableGENE3D1.20.1170.10coord: 373..592
e-value: 6.9E-6
score: 24.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 31..205
IPR019177Golgin subfamily A member 5PFAMPF09787Golgin_A5coord: 450..748
e-value: 8.4E-97
score: 324.2

Blast
BLAST of TCONS_00001682-protein vs. Swiss-Prot (Human)
Match: GOGA5 (Golgin subfamily A member 5 OS=Homo sapiens GN=GOLGA5 PE=1 SV=3)

HSP 1 Score: 344.739 bits (883), Expect = 1.340e-107
Identity = 263/768 (34.24%), Postives = 416/768 (54.17%), Query Frame = 0
Query:    1 MSWLSDFTSKAENLLTKFDQTAAQTLNESGIQDTLHNVTQPAPTTASPSYEQESPVTTASSKEYQNA---SHLFGGTQNERKSLPTNPASTSTYTPVASVSTTTRPPVLTNKPLQQVSSSATNSPNMSRSSSSSSLKKEEDMLFEFLNSNPPPATAIKGHTRNLSGPKTSTPRRPSATTASTIPVSQTTTTVSTRPEG--------PAIDTVPPLSAKPSISPVNIDTVDAVPVIEKPTTTTQKEPLIHQMNSKESKDGESR-VSSLNLENTLLKNELQSLHEELATLSSKLKEQQKETEKYRTRYENRRNQQNEDYERVRAGFENREADLNEALKAKDSQLAVLRVRIQETDAELQGKTKSLEDVQKQNEQLLRDHSEASGVQGTVMSNLRQKMEELENELRKEKLENSSMKNELLNVNTKLETEQQQYAVNIKDLHSKQTQGKDKTRELEMRVKVAEDSAENSQKELKEYKDKAARILQAKEKLIASLRQGSDSTSDVSPTLLS-ELEELRQDRDMVRDELQQNKYKMEQLRQEYLDLDMLHKNDSDDNQDKIETLQSSLQDEVQKRQTAEEDMKRYIQELHFTREEIHSLKKSQISKNQEYEAEVKRLQNQVNVKASSSSSQEELENRIRTLTDSLIHKQTVVEALSTEKNSLNLQLERLEKQYKDIQNSLIKRNKSTDIEDGTGEAKLLPMNTIMPKQITGNV-----RWRSTVNEIDKFSIRLGVFLRRYPIARLMVIFYMLLLHLWVTFVILTYTPEIHNHD 750
            MSW  D   KAE+LL + DQ AA  L+    +D   N+     T  +  ++Q + +       YQ     +++     N R    T  A T      A+V   +R PV  + P++  S    +S  + R  S    + ++++LF+FLNS+    T        +   K  TP   S+ T+S   V+ + TT+ T  E          A ++      +   S  N+ +  A P    PT                + DG+S  +S+L LEN LL+NE+QSL++E+A+L  + KE Q+E  K R R E + N  +   +R+  G   +  DL EA+ AKDSQLAVL+VR+QE D  L  +T++LE +Q +  ++++D SE + +Q   +   ++++ E +  L++E+     M++E      K+E E+Q  A  I     K +  K +  EL+ +VK+ + + E+S++EL +YK KA RILQ+KEKLI SL++GS      S T  S ELEELR +++M R+E+Q+   ++ QLR E  D++    N+++  +++++ L   +  +   +Q  E +++R  QE H+  E+++  K +  S+ ++ + E+++L+NQ+  K  S+SSQ ELENR+  LT++LI KQT++E+LSTEKNSL  QLERLE+Q      S    +         GE   L    ++      N+     + R   + ID+FSIRLG+FLRRYPIAR+ VI YM LLHLWV  V+LTYTPE+H HD
Sbjct:    1 MSWFVDLAGKAEDLLNRVDQGAATALSR---KDNASNIY-SKNTDYTELHQQNTDLI------YQTGPKSTYISSAADNIRNQKATILAGT------ANVKVGSRTPVEASHPVENASVPRPSSHFVRRKKS----EPDDELLFDFLNSSQKEPTG----RVEIRKEKGKTPVFQSSQTSSVSSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACP-DHTPTP---------------NDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVE-KWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTFQERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDELQQQVKLYKLNLESSKQELIDYKQKATRILQSKEKLINSLKEGSGFEGLDSSTASSMELEELRHEKEMQREEIQKLMGQIHQLRSELQDMEAQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNSASGSSSNGSSINMSGIDNGEGTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYTPEMH-HD 726          
The following BLAST results are available for this feature:
BLAST of TCONS_00001682-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GOGA51.340e-10734.24Golgin subfamily A member 5 OS=Homo sapiens GN=GOL... [more]
back to top