Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001672 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001672
Unique NameTCONS_00001672
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4829

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001672 ID=TCONS_00001672|Name=TCONS_00001672|organism=Clytia hemisphaerica|type=transcript|length=4829bp
aagATATTAAGACTTAAAAAAAAAGCTTGATGAAGAGGAGAACATTGGAT
CATCCGACGTCTCCCTTCTCCCTCCGTCAGCCAATGAGATGGGTTCATTG
AAAAATAACGTCACCgacaaccaatcagattgcgtcATTGAAGATCCCAA
TCAACCAGATTACGTCATTGTTGAAGATGGTAACAACCAATGTGATTGTC
CGGTGTCGAATTCTAGCCAATCAGAGGAGACCAATGAACCGCTATTTAAA
TACAGCACCCAATCAATTTCACCAGAGATTGTGGTCATTCCAACAGACAC
TCCAGAGTTAATCAAAAGATTCCCAAGACGTCGCAGCTCTTCACCTTGTC
TCGGGAAAATGTCAAACCTAAGAGTCAGGAAGAGAAGAAGACGAGGAGGA
GCTCATCACCATGTTTTGGACGAAGAAACGAGTTTATGGTTTACAGGGAG
CAACGATTGTCATTTTTCTCATCAGAAGCTACTTCAAGAGGAAGGTCTTA
CAGCCAGCGTTATGATTTGTGTTCCAGTCCACGATTGGCTGAAGTTTGTT
CACCACGTGCTCGATCCAAAACATTTGACACAATCAACGAACATCCGAAG
CGAGACTCCAACTCACCAGTCGCACGTCGACGTCGAATCTCAGTCAAAAG
CACAGCCGTCCGAAAACATTCAAGTCGCTCCACAACACCACGACAGCGTC
GCAAGACTGTCTCTACATACACGCCAGCATTTAACCAATACAATGGCTCT
GATGGTCACCTTTCATCGGCTGTTACACCGTCACGCCGATTATCTGTTGC
TGTTGGACGTAAAACATCAACGACTTTCCAAAGAAAACAGAGACGATGCA
GTGAGCCTTTCCTGTTAGATTCATTATCCTTGCAAGGTCTTGGAGGTGCT
GGTAACAACAAATGGAATCGAAAACAATCGACATCAAATGGTCGAGTAAA
ACGACGTTTATCCACAGCTGGAGTCTTACCAGCatcaagcaaacaaaaac
tACAAGCACTAGCTAAAGATGAATTATTGGCTAGTTTGAATGTACCGCTA
TCGAATGCACCTGAAATCACGGTCGACGATGAAGAGGTCTTGGACGAGTT
GGTTGATTCTGAAAACGAGGCTATCGAAGAAAGCGATGAGAAGAAAGcac
aaattgaaaaagaaaggaGGGAAACGAAACGATTATTGATCATCGAGGAA
ATCTTGGAGACGGAAAAGAATTATATTTCTTGTTTGGGAACTCTCGATTT
GGTCTTCAGATCACACTTAAAAGATGCCAACATCATCACCGAGAAAGACT
TGAACTCATTATTCCCATCACACTTGCAAGACATCAAACAAGCACATGCT
CTCTTCATGGAAGATCTCGAAGAACGAATGAATAACGATGATTGGCGAGG
AATTATCGGTGATATTTTCGCTAAAATGACGTCAGCGTCGGTCAATCTTC
TCGAGATGTATACAATGTATGTGAATTCGTTCCCCAAAGCCATCAGCACA
TTGAGTAAATGTACAAGATCGTCTGGCAAATTCCGCAAATTTCTAGAGGA
TTGTTATGAGAATCCGGTGGTGGAAAGATTAGATCTGCCATCTTTCTTAC
TCTCTCCTGTACAACGGTTACCAAGATACATCTTATTACTTCGAGAATTA
TTAAAATACACAGACGAAGATCATCCAGATTGTTACTTCATTAGTCAAGC
CATGAAAGAAATGGAATCTCTCATATCCTCACTTAACAGTTCAATCCACC
AATCAATGGAATTCTACTCGGCAAGTGAAACCAGGCGTAAAAAGATGTCA
AGGCAGTTcacttctaagaaaagaaaacaaagagcGTCTTCCACCATTTT
AAGGAACAACAAAAACATGAAACCAGTTTCCGAAAATAAATCCGATAACG
ACCAAGGTTATTGTAGTTTTGGTGAACGGAAAGATGAATCACCCGAAGAT
GAATCCGGACGGAAGCCCCGATCATCATCAACACTTAAAAACCATCCCGG
TAAACGCTCAATGTCGGTCATTTCGAACGCCAGTGATGACTCAACAAAAC
AAGTCATTCGACGTAAAAATGATTTACAACTAACAGGGCGAAATACAGAC
ACCAGAAAATCATGGCGACGTTCGATCGGTGCAGTCTTTTCACATCTCTG
GTCAAATAAAGATGGCGAAGAAACTTCCTCACAAATGGATACTTCAGACA
ATTTAGACNCTCTGGTCAAACAAAGATGGCGAAGAAACTTCCTCACAAAT
GGATACTTCAGACAATTTAGACATTACGTCATTAAATGAAAATAGAGGTT
CACAGGACCATATAGACGGAATCCCGTCAAATTCTACGCCGTATAACCGT
AAGAACAGTTCGGTAAAACGTAAACACGCAATCGCGTTACCGTCGCCGAT
GATCGAGGAAGTCGATTCTTCTTCCGATTCGCCGAGACTTGCGATGGAAA
ATTCTGTATTAGACGGAAATGAGAATATACAACAGATAAATACTTTAGTT
GAAAACACGACATTAAACGATACGGAAATATCGACGTCTCCGGTCGGTGA
AATGGATATTCCGCTTTGCGTCGTATCCGATGACGACTGTGACCGTAAAA
ATTCGACGGAATCGGAACGTTCTAATACTGCATCGCCTTCTTCACTAAAG
ACCCCTCCCTCTCCGCAAAACTTTCGTCGAAACGGCCGTCTACGTGGTAG
CGCTGGTCCCGTGTTTAAATCTATATTTCAAAAGAACAGTACTAAAATGC
AGAAAACAGTTTCCATGGATGCGTTAAATACAAACAAATACAGTGAACAG
GACGATAAAAAGAAACAGCGGGCGCTTAAAAAGCGGAACAAAGAACTACA
TAAGAGTGCAACAGTTATCGCACAAAGGACTACAGTTGAGAGTGGTTATC
CAATAGTAAAATCTTTGTCTTCATGTAACATCTCACACGAAGATAGCCAA
TCGGTGTCCTCCTCAGAGACTATTTCAAGTAAAACATCAGGCAGTGTTAA
AGAAGAGCAAGACGGTGGAGAGAATTACGTCAtcactgaaaataataaca
aatttgTGAAATCAAAGACTGAAcgtaaaagtaaaattttcaaaacacta
AAATCGTTTGTTGGGAAGAAATGAATGGTATTTTTTATGAATGAATAGTT
GATAGTTTATTATATTACACGCGAGAAAGCAATTTTGATAGTACGAACAG
ATTATGCATCAATCCCTGTTCTAGGCAATTAATAACGCAATATCTGATCA
AATGACATATCATAGAATACTTGGTTTACCATAGAAACACAAGGCTGACT
AAGTAATGGGTTTACCAAACCATATTTGTATAAATTTTAGAGTGAATTTT
ACGGTCTTCCTTTCTCTTTTCTTGGATGAATGAAAGgttcgaaaacaaag
aaatgactTAGAAAAGCTTAGTTTTAGTTTTCGTTACATCATGTTGAACT
ATCAATTACGGCTTTCAATATCAAAATCTTGTTAATACAAatacattttt
cagaatatttttttttgataatttatagTTTAAAGAATTATATACGATAA
AGCTGGCCCTGtcgtaaagttttttcttcACAAAAGGGTTTTTATTCAAG
TCGTTTTTAGTATATAGGAATGCTACGTGTTCTTCATTTCCNATCGGAAC
GTTCTAATACTGCATCGCCTTCTTCACTAAAGACCCCTCCCTCTCCGCAA
AACTTTCGTCGAAACGGCCGTCTACGTGGTAGCGCTGGTCCCGTGTTTAA
ATCTATATTTCAAAAGAACAGTACTAAAATGCAGAAAACAGTTTCCATGG
ATGCGTTAAATACAAACAAATACAGTGAACAGGACGATAAAAAGAAACAG
CGGGCGCTTAAAAAGCGGAACAAAGAACTACATAAGAGTGCAACAGTTAT
CGCACAAAGGACTACAGTTGAGAGTGGTTATCCAATAGTAAAATCTTTGT
CTTCGTGTAACATCTCACACGAAGATAGCCAATCGGTGTCCTCCTCAGAG
ACTATTTCAAGTAAAACATCAGGCAGTGTTAAAGAAGAGCAAGACGGTGG
AGAGAATTACGTCAtcactgaaaataataacaaatttgTGAAATCAAAGA
CTGAAcgtaaaagtaaaattttcaaaacactaAAATCGTTTGTTGGGAAG
AAATGAATGGTATTTTTTATGAATGAATAGTTGATAGTTTATTATATTAC
ACGCGAGAAAGCAATTTTGATAGTACGAACAGATTATGCATCAATCCCTG
TTCTAGGCAATTAATAACGCAATATCTGATCAAATGACATATCATAGAAT
ACTTGGTTTACCATAGAAACACAAGGCTGACTAAGTAATGGGTTTACCAA
ACCATATTTGTATAAATTTTAGAGTGAATTTTACGGTCTTCCTTTCTCTT
TTCTTGGATGAATGAAAGgttcgaaaacaaagaaatgactTAGAAAAGCT
TAGTTTTAGTTTTCGTTACATCATGTTGAACTATCAATTACGGCTTTCAA
TATCAAAATCTTGTTAATACAAatacatttttcagaatattttttttttt
tgataatttgtagtttaaaaaattatattgtacGATAAAGCTGGCCCTGt
cgtaaagttttttcttcACAAAAAGGGTTTTTATTCAAGTCGTTTTTAGT
ATATAGGAATGCTACGTGTTCTTCATTTCTGAGGAAAAATTATTACCCTA
GTAAAATTAGAAAGTTATTAGTTTTTCGACGATTTTTTCCACCTTTTTga
gaatagaaaatattttttattactaAAAACCAAGTGTACAGTATATATTA
TATGTTATAAATATTGCAAAACAGTCAAA
Run BLAST on NCBI

protein sequence of TCONS_00001672-protein

>TCONS_00001672-protein ID=TCONS_00001672-protein|Name=TCONS_00001672-protein|organism=Clytia hemisphaerica|type=polypeptide|length=617bp
MVYREQRLSFFSSEATSRGRSYSQRYDLCSSPRLAEVCSPRARSKTFDTI
NEHPKRDSNSPVARRRRISVKSTAVRKHSSRSTTPRQRRKTVSTYTPAFN
QYNGSDGHLSSAVTPSRRLSVAVGRKTSTTFQRKQRRCSEPFLLDSLSLQ
GLGGAGNNKWNRKQSTSNGRVKRRLSTAGVLPASSKQKLQALAKDELLAS
LNVPLSNAPEITVDDEEVLDELVDSENEAIEESDEKKAQIEKERRETKRL
LIIEEILETEKNYISCLGTLDLVFRSHLKDANIITEKDLNSLFPSHLQDI
KQAHALFMEDLEERMNNDDWRGIIGDIFAKMTSASVNLLEMYTMYVNSFP
KAISTLSKCTRSSGKFRKFLEDCYENPVVERLDLPSFLLSPVQRLPRYIL
LLRELLKYTDEDHPDCYFISQAMKEMESLISSLNSSIHQSMEFYSASETR
RKKMSRQFTSKKRKQRASSTILRNNKNMKPVSENKSDNDQGYCSFGERKD
ESPEDESGRKPRSSSTLKNHPGKRSMSVISNASDDSTKQVIRRKNDLQLT
GRNTDTRKSWRRSIGAVFSHLWSNKDGEETSSQMDTSDNLDXLVKQRWRR
NFLTNGYFRQFRHYVIK
Run BLAST on NCBI

transcript from alignment at sc0000011:416724..488978-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001672 ID=TCONS_00001672|Name=TCONS_00001672|organism=Clytia hemisphaerica|type=transcript|length=72255bp|location=Sequence derived from alignment at sc0000011:416724..488978- (Clytia hemisphaerica)
AAGATATTAAGACTTAAAAAAAAAGGTATACAATTCATTTTTGTTCTTTG TTTGAAAGATTGGAAACTGTTGATTATTGATGATGAAATTTAAACTCTTT AATATTGACCTTCATTTCTTTTCATCAAAACCTTCTTTACCTTTTATTTT CAATAAAGTCTCTAAATTTTTACAATTTTTGATTAACATGTCTGATGTTA GCGGTATGTAATATGAAATTTTAAGGAGGGGGACGAGTGGTGAGAGAATT GGAAAACATGGTATGGAAGCGTTCTGATCTGTACTCACTTATTGAGGTAT TTCATTTTTTTTTTCATTTTTATCATTATAGTGTGTTCTGAAAATGTTTG ACAGTTCGTGCTTAATAACATTGCTCTTAAGGGAAAAATATAATTAAAAG TAATATTTCGTTGGAAAGATAATTTTTGTACTAGTGTAATAATTTTTTAA ACATTTGAACATGAAAGGAAGCATTTTTACAAACGTTCTTCCTTGAAGAG TTCAATCCAAGTTTGGATTATAGAAAGATTCGGATAATAGAAGTTCGAAT TAATGAGAGTCCAATGTATAACTTTAAGAGGCTGATTTCAAATATATATT CTGATTCATATCTCTTTTCCAATTGTCTTTGCAATGGGTTTATTCGACGT TTTTATCAATTCATCACCAATTGAAACTTTTTTGTCGGAGGACTATGACT TTTGAAAATTGTAGACCTTAGTATTCATGATATGCACCACTGGAGAGCCC TCCAAGAATTTTCAAAAATTTCCACCGAATACGTCACACTTCTTCTATTT TTTAAGTGACGTATTATGCTATTCTCATATGATTTGAGAGTTGAGTGTTT GTGGACGAAGCGAACACGTTTCTTTCCTCTCGATGATGTCCGTTCATTTT GAGATTTGACCGTAATTTCTCTCCACGGTCTTATACATAATGAAACGCAA TTGTTGATCCAATCAGAAACGAGCAAGGTATTAAAATTTCCTTAACTAAT ATATCTACAAAACTGTTCAAATCAGCGACAATGAAGTGTCAGGTCCGTTG AAAGTGATGTATCATCAAACGTCCCCATATGCATCCAAATTTAATAACTT ATATACCACTAAATGACGGTTATTGTGGTAGACCTAACCTAATTTGCATT GTTAATTATCTTAAGCCTAATCAGGTTTCGGTACCAAATGATTAGGTTTT AATGGTTCACTTTAATCGTTTTTGCCCTGGTTACGACGTTGAAATTGATG TATCGCCAAACGTCCCCATATGCATCCAAATTTAATAACTTATATACCAC TAAATGACGGTTATTGTGGTAGACCTAACCTAATTTGCATTGTTAATTAT TTTAAGCCTAATCAGGTTTCGGTACCAAATAATTAGGTTTTAATGGTTCA CTTTAATCGTTTTTGCCCTGGTTACGACGTTGAAATTGATGTATCGCCAA ACGTCCCCATATGCATTCAAATTTAATAACTTATATACCACTAAATGACG GTTATTGTGGTAGACCTAACCTAATTTGAACTTAAGCCTAATCAGGTTTC GGTACCAAATGATTAGGTTTTAATGGTTCACTTTAATCGTTTTTGCCCTG GTTACGACGACAAGTCACTCTCCAATATATTTTGTTGGGTATATTTGTGA TAACGATCATGAATTTTTGTCAGAAGTCTTTTGTTGTATGACGAGAAAAG TTGAGTTTTTTGTATTTTCTGGTTGTACAATCTTTCCAAAATAAGTGAAC TTGAGTCTTCAAAGGTGATTATTTTATTGCATTTTCGACCAAGTAGCTGT GCCACATCTATTATAAAGTTATTCTCAAAATTAAGGAAAAATTAAAGGTT GTAATTAAAACTAAAGGCTTAAAAATGGGCTTTGTCCTTTCCGTACAAGA GGGCTGGGTTACATGGGAATTATGATATTAGACTGGCGTTTAAAACAATG TGCCAACATGCATGGACTGTGATTGGATTCATGGATATTGTATTCTTATT GTTCAAACTGTAATCAAGAAGAAAATCGATAACTGCCGGTCCGATTTGAA TGAACGTCTCTTACTTAAAAGAGACTGCTTTACATAAGAATGTACGAATG CTCAATATTCCCTCAATCTCCTCTTAAACTGATGTCGAACATCTGACGTC AATATAGCTACAATCAGTGGCGTTGTGGCAGGAGGGGGGCGGTTGCCATG GCCCCCCCAGCGGAGCTTTTTTGAAGGGGCGCCGAAGAGCAAGGGGCGCC AAAAGAGATTTTTTAAACGCCCCAATCTAAAAAATCATACTTTATGCACC TTAAATTGCGCCCAGGACCAATTTTACTGACATAATTTTAAAATACTTGC AATTTTTTTCGCTCGCTTCGCTCGCAATACAGTTAATTGGTAACTTTTTT GTAATATAGCTAATTTACAAGTTTTTTGTGTATAATATAGCATTATTAAA TGAAAATCGAACTGCGCCTCAAGAACAATATGCTGACAACAATATTGAAA TCATAAAACATCAATTTTTTCGCTCGCTTCGCTCGCATACATAACATATT GTTTCTTTAAGTTTCTTTTCACTCTAGCAAGGGTTAAATTTGTCTATTTT TATTTAGTGATTTAGGGTATCTTGGCAGTTGATTTAAAAAAATTTTCTAG TCGGCCCTAACCATGGTGGGGCCTGTTTTTCCCTTTTCCATTCATCAAAG ATAAATCTACTCTTCTCCACTAAATATTTCCTTCCTCATTATGCCTAGGC AAATGAATTTAGTAAAAGTTTAGAAAATGGTGGGTGGCATGGGGACACCA CTTTGGAAAATTGGAGGGGGGGGGCGCCATTTAGAAAAAAATGACTTTGG CCCCTACAGAAAAATTTTCCCACAACGCCACTGGCTACAATCGTCGCCAA TATATTATGGCACATTTCCGGTGATCAAATTTAGATAAATTTCAATAACC TCCCCCTCCCCGCCCCTCCGAACAATGTTGGTGGGAAAAAATATTGCTTT GCCGGTCCTTAGCTCGCCCGACAACATTGTTTGGGGGTGAAGAGGGGGCT TTACGCCATAAGTTTTGTCAATGATTGTAGTTAGGAATTAGTCGTTGGAT AATGGTTCCAAAAATTTCTTGCAAACCTTACGTAACCTATTCTTATTTGA CTCTTTGAAAGATTTAAGAGAAGTCTTCATTTCGATTGTATTAGTGAAGA AATTACCTTTTGTTTTTCGAAACATGATTTAATTTTTTGGTATATACAAC TTCAGAGAAAAAAATAGAAGAACAATTTGAAAAAATGGAATTGAAAGTAA TTGCCGTTTTCAAAAAAATAAGCTTTTTTCATATATTCGTCTTTTTGTAT CTTTCATACATCAATTATCGTCAAAACAAATAAGAAAAATTTAGTCTGAT AGGTCGTCTCACGTTAAGGTCGCAGATTGATAGCGTAGGTTTTTTTCTGA CTGATCGGCTCCCACTAGCAAATTTTTGCTTGGTCATTTTGTAGAACTCG TCGTCGTCGAAAGAAATTTTAAAGAAGGCAGAACATGTTCGTTCATGTGA TTTTGATTCTGTATCCATTGATCATCACTGTCAATAATTTTCTTATTGAC AACGAGCAAGGATACATTTCATCTCAAGATATCTCAATCATCAAAGAAAT CAGTAATGTCCAATCACAAATGAATTGTCTTCACAAATGTGTTCGCATTT CAACGAAAGTTAAAGTCTTTTACAACCGCGAAAATATTTGTATTTGTTTT GAAGAAAAGACTGGGAACAAGAATATTGTGAAGAGGAATGGGGACGAATT ATATGGGAGAATCATGTCAGTTATAAAGGTATGAAATATCATTTTTGTCA AGAATCTCTAGAATTTTAGCGAGTCTGCGTTATAATATTCCTCAAATCTC TCTAATTTTATCGTATCTCGTCTAAAGATATTGTGTTATAGCTTGTCAAG AATGAATTAATTCGCTTGATTCCAGGCTATTAACTTATATCATGGCCAAG TTATAGGTGTGATTAAGTCAGCTATTCGATTAAGAGGGTTCGAATGGCTC TGGCAAATCTGACGTCTGCATAATTGTCTTCGATTATGAATTGTCGCATC ATTTTCATTTTTCCATTTTTATAGGCTCAAGAAATAAATCCAGTAGTCAA TGGTCCATCTCGTATTATGACGACAAGCCAATTAACTACTGCGATTGCTC AAATAACTACGACGGCCGCCTCACTAACTATAACGACGGCTGCTCAACGA AAGATTACAACGACCACCGCTCAACTAAAGATTACAACGACCACCGCTCA ACTAAAGATTACAACGATGCCATTCGAGGTCTTGCGATCATCAACAGGAG CTAGTGGATCATTTAGCTTGATCAGTGACACCAATCTGACAACGTGCTTT TATACACAAATAGTGGATGATCCATATGTCGTTTTCCGACTTAACGTCCC TGTTTTAGAAGTCATTGTCACTGTCATCCGACCTGAATCTGTTATATCGC TTGGATCTAGTAGTAAAGAAGATTTCCAAATATATTCATTTGCTAACGGA AATTTAGATAAATGTTCAAATAAAGTTGATGTCCACACAACCACACCTGT TTTTAACTTAACATGTTCAACTGATGATGTTACCAAAGCTTTCAGTAAAA TAAAAATTGTCAAAGAGGAGGATTCACGTGCTTTGATGTTGTGTGAGATA GCAGTCATCCTCGTTCGATCTGTTCATTAAACCAATCACAATCGCGACCA GCTAAAGACTTCCGCAAACTAAACTATAGACTAAAGAAGAAGAGAAAACT AAAATCTAGTTGTAATTGTAGAAATAGATGATACTATTTCACACCCCTGT GTCACAGACCCGCTGGGACCCCAGCCCACTGAAAAATTTGGCCAAAATTT CGTCCCTGGTGGACAAAAAACATACCGTGTAATTTCAGCCCCACTGGGAA ATTGACTTTGATTTCATCCCCATTCGAAATTCAATGCAAAAATTTACTGT CCAAAACCATCCCAACTGGATATTTTAAACGCGGGAACAATAGAATTTTT ATCCCCATTGGGATTTCGATAGACCGGGGCTGTGAGACAGGGGTGTTATT TCAAATATTTACAATATGTTCAAAAAAAAAGTACATTTCTCCAAAAACTT TGGATGCTCTCATAAAAAATGGGGGAGGGTACCTAGGCAAGTGAAGGGTA CGGCAATGTGCCGGCCTTAAGGGTGTTCTTAAGGTTCCATTTGTGGAACG GGGTAATCTCTGTAAGTTCCATGAAGGGTCAGAAAATAGGAAAATTTAAA CTTTTTCCCCTAAAAGCTGCAAATTAGTCCCATCAAGTGTCGTTAAATTC ATAAAATTTTCAATTTTTTTCTCTTTTTTAGTCCCGCTAAGGGTCCGATG GTCGAAGGTCATACGCGTCAGCTTGTAACCAGGGCCCACGCCATGAATTT GAAAGTGGGGGGGGGGCAATAAATATAGAGTCTAAGGAGGCGCAACCATG GTTGCTTTACTTTGCAGAAATGTGGGGGGCTGGTAACCCTAGTACCCCTA GGTATCGAGTAGAAACTCTTTGTTCGCTCAAAGCATACTTTCCCTATTCC CATGATGAAATAATAGGTTTATCAGAAACGGAAATAATGTTCGTTAATTT TATTCCACTTTTTATCGGACAAAAACAAAACTCGACCCTCTTTAATACGA ACCTCTATTGTCCGAATCTCTCTGTAATCCTAAGAATAATTCGTCTCCTC AGCTTGCATAGTCTTATTAGTGACTGTTTATAATTTAAAAGCTATCTCTC TCTAATTCGAAAAATATTTTTCTTATGAAGACCGAATTAATGAAATTTAA TTCTATATTGAACGAAGGATCGAGACAAAAATACCATTAGATTTAATAAA TTTAAAAAAAAGTTAACCCGTATGTATTGGAAAATGAATTGTTATGCTTG CTCGTTCAAAAATCAGCAAATTTGTAAACAAAAGCATAAGTCAGCAGGGG TTTTGTTTTGTTTTTGGTAGGCTGGCGAATGAAAAATTAACTCTGGTGAT TTCTAGATTCTAGGCCGGCGAATTCTTAGCAAGCGCAGTGTATTGATTAG CATAATAATGTACTTGAGGCGGCGAACCGAACTTTTCGAACGGCAAATTG TAATAATTTTCGTGCCTTGGACCGGCGAAATTAGCCGTTCGCTGGGCCTA AATAAGACCCCTGATGCAGTGTAGGCCATATTCTTTGTTTACACGTATGG AAGTCGGCTAAGTCATAGTCATTATAAAAAACCCCAGTCTGGCAATGTAT TGTTTTAGCTTTTTGTTCAAATTTCTTTTGTTACAAACAAAAGACAAGTT GCGATTTTCATACTTTTTGATTACGTTACCAAAATCTCCTCTTGGGATTG GTCTATTTTCTAATCACATGATCAAAAAGTTTGCAAAATAAATCGATTTT GGTACGTATAGTAAGCTCTATCTTTCAACAATAAAAAGAGACAAAAGCCT TCCAGACCAGTATTCTTATAATGACTATGGCTAAGTATAATTGCCAAATT AACACTGATTTACATTGTAAATACTTAAAGAAATTCCCTTATGAAACGTT GAAGTTTGAACATTTTCTCTTCATGCCATCTTCTTGCTATTTTTCACGTA CCTTTCATTATACCTTGAGTGTGATTTTTTAAGCTTCTTGGTTTACTGTA GGTTGCTTTGTGGGTAGTTGTGCGGAGATGTTTTGAATGTTGTTTTTTTA TTCTTAAAAAAAATATTGTTTGTTTATTTGTTTGTTTGTTTGTTCCATCC TTTAAAATGAAGGTGAACCCTGGTTTTTAACCAGGTGCATATAGCCATTT GTTAATTTATCACAATTTTCCATCAACCAATAGAATTGGGCTTTTCCAGA AAAAAAACGTACACCCCCTGTTGAGGAGCTCCAATCTTTTGTGAACTACC CCCTTGGAATTCCAGGCAATTTTAGGATCATACCCCTCTGGAATTCGGAA TTACAGATTTTCAATCATTACCCCAATGGAAATCCACTTATTTTTGGCGG ATTTTTGTCTACTGCTATGGAATTCCACTGCATTTAAACCATACTCCCTT GGAATGGAAATGGACCTCCTCAACAGGGGGTGCACGGTTTTTTTCTGGAA AAGCCCATTAATGAATAATACGAGATGTAAAAGTTCAAAGCCCTAAATTA ATGATCCTTTTTTAAATGACTTATTTTAGTCATACCCAACAGACCTTGAA ACTTTTAAACAAAGAATTACTTTATTATTAGAAAATGACAATGTGTCATT GTCTCAAGATTTTAGGGTCACATCTAGAGGGATGGCGTGAGTTTTGACTA AACTATACCTAACTTTTAGTAACATTGAGGGTGAAAAGTGTGGGGTATTT TTCTAATTGGAGACGTGTTTTTAGTAAAAGCTCTTCTTTTCACAGCTTGA TGAAGAGGAGAACATTGGATCATCCGACGTCTCCCTTCTCCCTCCGTCAG CCAATGAGATGGGTTCATTGAAAAATAACGTCACCGACAACCAATCAGAT TGCGTCATTGAAGATCCCAATCAACCAGATTACGTCATTGTTGAAGATGG TAACAACCAATGTGATTGTCCGGTGTCGAATTCTAGCCAATCAGAGGAGA CCAATGAACCGCTATTTAAATACAGCACCCAATCAATTTCACCAGAGATT GTGGTCATTCCAACAGACACTCCAGAGTTAATCAAAAGATTCCCAAGACG TCGCAGCTCTTCACCTTGTCTCGGGAAAATGTCAAACCTAAGAGTCAGGT ATGGCTCAAGATCATCAAACGATGACGTCAATTCGAGCCAATCAGATTGC TCGACCGAAACAATCAGCCAATCAGATTTGTCGACGTATTTGGTGATTGA GAGCCAGGAAGAGAAGAAGACGAGGAGGAGCTCATCACCATGTTTTGGAC GAAGAAACGAGTTTATGGTTTACAGGGAGCAACGATTGTCATTTTTCTCA TCAGAAGCTACTTCAAGAGGAAGGTAAGAACCTTTATCATTTTTTAACTT TTTTTACTTGTTATTCTTGTGTGCTTAATTTTAAACAGGGGAATAAGCAG GGGTCGGGTANAGTTGATACTTTGATACTCTCTAGTTCGATTTTCAAGCA TCTTCATCGAATAAGAAGGGAGTTTATTGTGAATAGTAGAGTGTCGCGTA GGAGATTTTCTTGTTGACGGTGATTTTCAATATTTTCAAACAATAGAGCG TATCGAATAGTAGAACGTCGAATTAGAGGGCGTCAAATGTTTTTTTTACT CGTTACGTTTTTAAAACGTTCCAAAGACGTTTTCTTTAGGTCGGTGTTCA CATTTGATACGGTGTTTTATTTGAATCGGTTCCGTTTCATTCTGATGAAA GGACTAGCGAGTTTATGTACAGCGGAGTGACTGAAACGATTTGGAACAAC CTGCAGCCCTTACCTGCAAAAACGAGGACCGTAAAAGTGCTGATTTACCA ACGTCAGCCATTCAATCAGGATTTAAACAAATCAGAACCTAACCGTTTCC GGCGCGAAAAAAACACTTACACCAAACTTGATGAAAGTAGAGCAAAAGTA ACGGTCCATCTCACTCCCATCCTGTACCAACTCCCATGGACTTTATTGCG TCCAAAGAAGAGTTTTTGCATTCATGATCAGAATCTAAACTCAGTGAACC ATCTGCAACCTGTCGGTTCTAGAGCGATATAATAACTGATTCGATCTTGA GAATCTTTCTTAAAAAATCAGAAGTTCGAACTAACATTGCATATAATACT CGTAAGCAATGCTTACCTCAAGCAATAAAAAGTAAATTGACCTCCCCCTG TGCTTATTCTTGCACCAAAATAAAATGTAATTTGAATGTTCTATGAATGT TATGATTTTCATATTGGCCTGTGGTCAGTTTTTAACCTATACCGATGGCT ATATTGATGGCTAAAAATTACTATATTGGTTCAAGTTATAAGAATGTTAA GGCTAGAAAGATGCTACGGTATCTGATTAGTCATTAAGATACTATCAACT TTCTCTATTATTCAAATCTTTACGTTTTCGAACTGAAATATTGGTGCCCA CAGACGGAAATTGGTTTAAATTCTCTGTGATTCAAGTCTTTCTCTTATTT TGGATAAAATATTTTGTCCCTTGAAGATCGAATTAAAGGGTATCAACTGT ATTTCTAAATGTAAGTAACCTTGGTATAGTCCCACTTTAATTCATTTGTA GAATCATAATCACTTTGAAACACAAAATGATAAACTATTCTTATAGAAAG TCGCTTGCATCGGTATTTTGTCGATTTCAGATATCCGAGCACAGAGGTGG TATTTATGTTTGTCCAAATTGTAACTTTCAGGCTGACTTTTTCGGTTAGA GTACATACCTTTTTAAAATGTTCTCTGGAAAAGATATTTGTATGTTATTT TGGGATGTCATTCGTAGTGGTGTACTGTATATCTAGCTTGCGCAAACGTT TTTTCTACGTCAATCCAACGTTATATCGTATTAGCAAGTTTATGTATTCG AGATAAATCGAAGAAGACAGTATAAATCAAAATTGACAATGTCGCCAAAA TCGTAGTCTAGCAAGCTAGACGACTAATTCAGACATATTAGAAATAAAGC AAAAAAGTAAATTTTAGTCGTCTAGAAACCTTTGTGCACTAACTCCAAAC AAAAAAAAGTGTCAATATCGCAATTAAAATTTTTTCCCGCTCAAAAAAAA TTCTTGAAAATAAAATGTGTGTGGATGTGTGTGTTAAAAATGTTTCATTT GTGTTGATTTTATTTTGAGAGTTTGTTGTTGCTGAATAAATTGTTTTCTC GCTACGCAAGTTTCTGCGTAGCTAGGCCCAGTATCTATAAGGCTGGAACA CCGGATTCTTCCAGTCGTTTATACAAACTAAATCCCGTATCATTATTTGT GTTTATTATTAGTAATACATGCATTATAAACGACTCCAGTCTACCAAAAT CACCGTCCACTTTGCTCTACGACAGTAAAAACATCAAAATACCGTCGTCT TTTTAGATGAGCAAAGGCGATATAGAGCCGTACATCAACTATCGAATTTC TTTTATGTCGACTTCACTTACCGTCGCCCTCGATATCCTCCAATACATAA ACTCACAGAACTTGTAGAGGTCTGTGATTCAGACTATGATACCCTCCGAT ACCTAATCTCGCTTTTGATGTTATACGGTTGACGATTGGTGTGGCAGAAT TGGGTTTCCAGGGCTTTTCTTTGGACACCATTAACATTCTTAGTGAAAAT ACCACCGCTAATTAACATGTGGCTGAAATGTGGGATTACTCCAATTTTTG ACAATCTCAATTAAGTAAGGTATTCCAGTTTATTAATATTCCGAAAGTTT CTCTCAGTGGAGGATATAGTGTTTGGTGAGTTGTTTTTGTTAGTTAGACA AAATGTGTGTGAATACTGTTTGAAAGAAGTTGGTGTGCCTCCGTTGTTAG TTAGTCATATTACATCGAGTTTTATAGTTNGTTAGTTAGACAAAAATGTG TGCGAATACTGTTTGAGGGAAATTGGTATGCCTCCGTTGTTAGTTAGACA TATTAAATCGAGTTTTATAGTTTCAGTTTTAGGCAATAATGTCCATCTCG TTTTGAACCTCACTGGTGTTGAGTGTATTGAGCAAAAGTAAAGCGCCTGC TAAAATGTATGATTCATTTTTCATTTTTCAAATAAACATGGCGTATTTTT CTGTTATTTCATTGCTGTTCTGATTCAGAAAACATTGACACTTTCAGCGA TATCGTAGTATATCTAACCCATTGGAGTCCTTTTTTGCTATACATTAAGT TGGTTGGCTTTGATTAATCGGTTGCTAGACAGTTTAATTTTATGAAACTG TCTTGAATCATGTTAACTATCGCGTCTATAAGTATATAACTCACTGATGA TGTAGAGTAACTGTAAGAGAAACGTAATTCATACTTTGTGGTTTACGCAT TTCTTATTGTATTTTCATACGTACGAAGTAGATCAGTTTCTTTGTAACAA ACGGCATTCAAGATGATCACAAGGGTATTTTGTCTGGAAATGATCACCGA GATGAAAATTGATGATAGATACTATTCATAACTATCCATCATCGAATTAT TGAACGAAAGAAGTTTACGAATTTCTTTTAGGTATTTTTTACGTACGAAG TAGATGATTCAAGATGGTATTTTGTCTGGAAATTATTGATGATAGATACT ATTCATAACTATCCATCATTGAATTATTGAGCAAGACAAAGACATCATCA ACATCAGTTTTATTTTTTGAAACGAGTTTGTACATTGATACCGTCAATTC TGACTTGATGTTGCTTTTACACCGCATTTTTGATTTGTTTAGTACACTAC CTTGTCTTAGCTTGGATGCTCTAATATCCTCTGACAAACCGTTTTTATAT CAACTGAGGTTTTGTAGGGGTCGTGATTCACAAACCATGCGATTGCAGGG AATCTAATAACGAGGCTAGTAGCTAACTCTCTCCCGGGAGAAAATATTAC TTTTTTTGTTTATTTTGATCTTCTATTGGTTTGACCGCCTTCCTTTGGGT TTTAAATTTACTCTAAATACTCTTTTTTCTCAGTTTTAAGTGGTTTAAAG TAGATGCAGATTATTTTTCATTATTTTTTTTAAACCTTTCCTTTTAACAT TGGGTTAACTTTGAGAGTTTTTATGAGATTTTTACGATAGGTTACTCTTT TCTGAATTGCTGATAAGTCATAATAAGGCGAGACCAATTTGATTATTTGT TTTACGGGCCCAACCGACCCTGAAATTCCAAAAATGGATATAAAAATAAA ATTTATTTTGGTAGTACGTTGTTATTTTCATTGCTTTACTGACTGCCAAA TTTTCAGTTTTTTCCAAGGTTTTGAGAATTTCAATTTTTCATTGTATCCA TGAATTTGAGGTTTTAATGTGTTTGTATTTTCTATTTTGCATTTTTTCAA GATGTAGTAGTTTTTGCTGTCTTTTTAGGCGAGATTTTATAAGTGAAATT CTACTTTTATTTTTATTTTTTTGTCGACCGATCGACCCTCTTTTTTGGGT ACTTTAAGGGCAGAAACTTTCGTGTTTTTCGCGATTTTGATCCTTTTACG CGAAAGTTTCTGCCAGGTAAAAGTTAAACCTGAAAAACGCGAAAGTTTTT TTTCGCGAAAAATAAACTTCTCTACTCAGTTTTGCACTATTTGCTAAATT TTAGCATGTTTTATGAGTTTTTGTTACTAAAAAAGAAACTTTCTGCCCTT AAAGTAGCTTGGCTTGTAAAACAACAAATTAAATGGTCCCCGTCTAATGT CTTTAAGATTTCTTGGTAGATTTGAGCAAGTAGAGAATGATAATCCTCGT TTTCCTACTAATCAAATCAAATCTTCGTTTTTGAAGCATTGTGAAAAATC AGTTTCCTGAATGTACCAGTCAATTATAGAGGTATTAAATTCTCTTTACT TTAAAGGAGACACGGTATTACCGGGGAAAGAAATTCACAGCAATACGCTA AGAAAATACAAAAAGATAATCTTCGCTTGTTATATTATATATCTCTCATG TTACATTTTCTTATTACTGTTACTGTAATTGATGTTATGAATTGTTTGCA TAACACTCTAATTACACGGAGGAGGCTACAATATGTTGGTTTTCTTATGA TTTTTGAATGATAGAGCTTTTCTTTTGTTTTAGGATTTTTAGTCTGAGTC TTTTTTTAGATGGTGAATGATTGCTGGTACATTTTCCTATCATATTATGA ATTTTCGAATTTTCACAAAAATTATCAGAATAATTTGATTTAGGCTTTTA AAACATAATGGTTGAGACAAACACAGCTTTGTGTGTATTTACAAGAAACT TGTATTGTAGCCAGTTTATGAAGTTTTGTTTGTTTTCGTGAGAGACAATT TCATTTTCATTTCAGCGATATATTTTGGGTACGCAAATTTGGAAGTTTAC TACGGCTAAGGGATCGTCAAACCTCTCTTCAATTATAGAATAGGAAAATA GAGAAAAAAATTTTATTCTGACAGTCCCTGTATCAAATAGCGAGCTAATG TGTTTGCACTTTCGAGGCTGGTGGAGTGACTGAGATGATTTTTGTTCGAT GCCATGATTGTTCTGACCTTCAGTGGTTTGCTTGAATGCGTGATTATTTG GCTTTTTAACTTGCGTGAATGCGTAAATTTGAAAAAAAAACTGTGTGGTT GCGTGGATTGAAGGTCCGCTGGGGGGCCTCCAAAATCGAGGACGGTAAAA GTGCTGATTTACCGTCGTCCTCAGTCAATCAGGATCTAGATAAACTAAAA GCTTACCGTCTCCGTGGCAAAAAAAACAACAAAAATACATAAAACTCGTT GATACTTTTTAGGGAACTGTCATCAACGAGACTTTGAAATCACACTAAAT AAAGATTGCGACGTCGAAGTTGGCCAATATGATTCAGTATTGAAATCTAT CCAAGTCATCAGTGATATATTTTTATGATATATTATGTTTTGTTTCTTCG GCTGAGAAACTTTTATACTCGTGTCTATCAGACAAGAAGCAATTACTTCA CCTACAAATTACATTTAGTCAATCGGAACTAAAGTCTATTCAAGGCATTG CTTAGAGGCGTGGAATGTCTTGACCTTCGGAAGTTCTTTAAATGCCTAAA TGACAAGTTCAAGGAAAAAGTAGGTTCGTCTCGTTTACCCCAAACACAAT TAAGAGGCTTTTGTATGGAGAGGAATGAGCGAATGCGGTTTTTTAGAACT GTCATCTTATGCGTGGGTTCTTAAGGGCTCTGACCATAGTGAATTTTTCA TAATTGCCGTGTTTAAAATGTGTTTTCTGACTGGTGTAACCAACAAAACT ATGGCATGTTATNGTCGTCCTCAGTCAATCAGGATCTAGATAAACTAGAA GCTTACCGTCTCTGTGGCAAAAAAAACAACAAAGATACATAAAACTCGTT GATACTTTTTAGGGGACTGTCATCAACGAGACTTTGAGATCACACTAAAT AAGATTGCGACGTCGAAGTTTGGCCAATATGATATTGAAATCCATCCAAG TCATCAGTGATATGAAATGTTATTACATGTTATGTTTCTTCGGCTGAGAA ATTTTATGCTCGTGTCTATCAGCAACGTTGCTATCAGAAAGGAAGCAATT ACTTCATCTACAAATTACATTTAGTCAATCGGAACCAAATTCTTTTCAAG GCACCACTGAGAGGCGTGGAATATCTTGACCTTCGGAAGTTCTTTAAATG CCTACATGACAAGTTCAAGGAAAAAGTAGGTTTGTCTCGTTTACCCCAAA CACAATTAAGAGGTTTTTCTATGGAGAGGAATGAACGAATGCGGTTTTTC AGAACTGTCATCTTATGCGTGGGTTCTTAAAATGTCGTATATGATGTGTT TTTTTTCGAAAACTTCTTCGGCTTTAAACGTCAGCTTATTATGTCAGGAG TATTAAGACATGTTGTTGGGGTTTATTAGATCTGAGGTTTTCTCTCGATT TTCGATTTCCAAATTCTTTTCTAACATTCATGCAGTCTCTTCTACTCAAC ATTTTCTGTTTTTCAACTTTTTCTCTTTTCCTGGAACTTTTGGGTCTGGG TCATGAAAATATGTAGGTTCGATCTTATATCTTGAAAAGATTATGAGCTC GAGATAGAAATAGTGGGATCTTGCATAAGGGTTGTATAAGTAACAAGTAC GGCTAAAGGTCTGTGAAATTAAAACTAAGGTAGTAGAGAGAGACTATGAC AGTTAAGCCTATGTTTTGATGTGGTGTTGCTTATATCCCGTGGAGAAGGG CTTGCACTTGGAACAAAGGAAGATATGACGTAGCCTAATGAATCTATGGG GTACTATGGGTATTTCGTTTGTTTTCTTCGTTGGTTTCATCATGCATTTA TCAAATCTCGCAGTTTTCTGTCTTCACAGGGAACAGTTACGTTTGGCGAA CAGCAGTACCTTATTTTAATTTTATTGGTGAGTTTTGAGCAAAACAAAAT TGAAGATATTTCAATGACCCGGCCTATTTTTCTATTCTTGCCAAATTTAG GTTGTTTTTGATGTACACAGGCTAACAGTGATTGTATATAATTGTTTTAA TTTGGGGAAGGTTGTATTTATAATTTGTAGCCGGTATTATTTTCTCATGG TTTGCAAACTGTAACAACGATGTTGGATGGATTGCAGAAAGGTCTGCTTT CAAAATTTGGTTGCCTTTTGCATAATATTTGAAGAAGTGCTAAAATTTAG GGCACAATTTTACTATTTTTAGCTTTGGTAATGCTATAACGTATATTGAG GTGATAAAAGTTTTTGCAGTTACTTGAATTTCAAATATTTTGCAGTTGAT GTTCAATTTCGCCACTCACATGTCAACTTTACACTTGATTAGGTTCTTAG ACTTTCATAACCGCTTGACATTTTTTTGGTTTTTTGACGAAGAAATGACC TTGTTTTTTCTATCTGTAGACATGGCTCTTGTAGAATGCGTCGTGAGGTA CTTTTTACACACCTATAAGTCGTGGGTTACTGAAAATCTTTCCTGTTATT CAATGTAACTTTTTTCAGAAGTGTTAAAATTATTTGGTCCTCAAAACCGA AGGCGTCGCGTGAGATTAAAAGGGGTTGGTATTCTAGGCTATTTTGAAGA GATCTGTGGTTTTTGAACCTTATTCCACAAACGATTTTGATTAGAGAGTC CATACTGTGTATCGAATCGTATTTATTTGAAAATAAGGATACTTACTGTT TGATATGGAAAAGAATGATCAAAGATGTATTTCGATTGATTTGGTGAATT TTCTAATGATATTAGGATATAGAATTTGTTGTAATTTATCTTTTTGACTG GCGGATGAGAAATTTTTAATATACAGTACCGTATTTGGCCCCCAAAACGG AGACGGCCCCCAAAACGGAGACGGCCCCCAAAACGGAGGTCGTCATTAAA ATGAGGATTCTGACTTGTAGATTTATCAGAATTAAACAATTTTTGTTTAT TTTGAAAGAATGATGGTTATACTTAAAAATGAGCATGTTTTTGATGGTTT GAGACAGATTCAAAATAACATATTTGCGCCTGAAGGGAATATTTTAACAC CAAAATTAGATAAAAATTGCATATAACTCACTCTAGCTCCTTAGATATTG AAAATAAGTTATGAAAATGGGAAAACAAATAGGAAACTTTCTACACCTAA TGCCGTTCAGAAAATGCAGATACATCCGTGACTTTAGAGAATGAGTAAAA GATATAGCATCTTAAAGGTCAATCAGTATTTTGGGGTCCTAGAACCAGCA TTGATAAAACCGAACATTCTAAATATGAGAAACAGCAAAATATCTTGGAA TTCCATTCCCATCAGCTAGAGTTAAAAGCTTATAACAAAAAATTAACACT ATGTATAAAATTTTTCGCTGAATCAGCAAAACCGGCAAATTCTGTCATTC TTTTGCAAAATATAGGAGAAAAATACCTTTAAAGCTTAATATTTTCAGTT TCAGTTGAGCTTTTTTTCTAAAATTTTCACAGCTTATTCCATAATGGAAC TATTTTCAAAAGAGATTGATTTTCAAAAACTTGTTTAAGACGTTTATTAA ATCAAAATTGTCATTTTGAAAATCCCTAAATTTTCAGTTTGGACTTTGCA AAATCGAAAATCTTGAAATATTTCATAAACATCATAAATTTTATTATCCA TCGGGTCGTAAATTTAAGGGTAAACACAAATATGTTCATAGTTTTTCCCC CTATTACCACTGGGCTTAATAATTTGATTTTAACTACACCTACGTATTGG GGGCCCCAAACCTCCATTTTGACAACCAGGAGTATACTTTAAAAATTTTA TCAAACAAATTTATGCCCAAAACCCTCTAAATCACATTTCCAAACTATGG TCAAAATTTTGTATTCATATCTTAAAGAGATCTCGAGAAATCGCTAAAAT TTCAAACCTCCGTTTTGGGGGCCATTAGAAAAAAGCTACCTATCTTTAAG CGATTGAAAAATATTGTTGAAATTGAAAATTTGGAAAAAGAACTGTCGGG AAATAAAGTAGAGATGTTAAAGTTTTTCATGCAGCAAAATTTTTTGTAAA ACCTCTTTTCCTCTAGATTTGAGAGAAATTTTAAATTTGATCGACGTTTT GGGGGCCACATACTGTAATGACAATTATTATTTTTTCCACTTTAACTTTT TGAAGCTAGTGCTCCTAGAAATAGTTCCTCTATTCGGAGGGTGTCTTTTT TAGAAAGTATATAGCAGCTGGAAGAAAAAGTCATACAACATAAACCATCT AACGTCCATTTGTTATATCCAGGTACCGTTAGATAAACATTCTTTGCTAG CTGGTAGAGTGGATTTTCGCTTATTCTTAGTTTCCCGGTAATGGGAAATC CTCGAAGAATACTTTTCTTTACTCGACTTCCTCTAAAAGTTCGAATTAGA GAGAGTTAGAGACTGTATTATAATCCAGTGATTATAGCATTCTTTACCAA GAACCTTTGTTTTCATTTTCAACGCAACAATCTATTTAAGTAGAATCGGG CAATATCCTGTTCATCAAATTCTTGTTTTGTTTGATTTGTTTTTTGTGTA TAATAATTCTTGGGTAATCGGGGTAATCTTATCACATCCACTTTGACAAT AATTTCGTTTTTCTTTTGTTGTTCCAGTTCTATGATTTGTAAAAACACGC CATTGTATGAATAAGATATCTGATAAACTTTGTGAAATAAAGGTTGAGGA TCTCCGAAAATGAGATGATCAGGGAGATTTCGGAAAATTCAGACCCTCCT GATGTTTACAGTATCCGAGTACCGCTTCCTTCATCCCGCTAGCTAGAAGA GTCTCAAGCTATGGTTCTGATGGAGAGCTCAGTTAGGAATCCAGTGATCT GTATAAGTATGTAAGTCAGAGGCGACATGAAGGCTCTTCTTTCGATAGCT ATCTACCCGAAGGTAGGGGAGGGTGCCACTCTTTCTCCCTGGATTTCTCC ACTTACCCCTGATTCTTCTCTTAATTGCTGAGCATCAAGCAGAGAGGTAT CAAGTACCAATTTGGAAATCTTTGGTATGACCCGGCTGGGATTTGAATCC ACAACCTTGCGCAGGTCAAGCTTGCTCGGCTTGCGATGACACGTCCTCTC CACTGTTGCCGATGTCCCGTGGTATTTGCAAGGTCTTCCTTTGAGCAGCC TGCATGTTTCAACGGCCACCTAAATTGCGTGGACTAGATGCGTGCCCCTT GAAAATATCTTTCCAACGATTTTCAATTGTATCTATATGAGTTTTGGTTC TTATAAAAAAAAGTTTTAACTGCTGACCGTAACTAACAACATCCTCAACA GTTATTGCCATCCTTCCCTTCTTAATACCGCGATGCAATCTGTTTGAAAC AGGATTAAGCGTCAGGCAAAATGTAAACATGTTGTATTTTCTTGATGCCA GAATAACGATGGATTATTTGCTTTAAAGTTTCGGTGTTTGTTTTTCCAAA TTGAAGAGATAGAGTTTTGGTTTCATTACAAATACCTTTTTCTGGTTGCA CTCGCTGACCATTAAATTGGCTCTGATATTTTGTATTTCTGGTCAAGAGA AATCGTCTCTTCTAAGTTAGTTCGTATTATTTAGGATCTTGACGAAAACG ATAGTTGTTTGAAAGTTTAAACTTTGTGTGTGGAAATGAAAGAATGAACG AATGAAAGAATGGTGTTTTGGTCTTTTGGAACTCGTGAAGCTAAAGGAAC CCTCTAACTTGATACACGTTTTTATGCCTTTTACGGATGTTCTTAACTTT TTTGAGTTTTGAGACTGAAATGTTTTTACAATGTTCTTAATTTCACCAAT TTTAATTATTTATGTGCAATTTAGAGTCCATAAAGCCTTAAAATGTTTTG GCCGTCGAAACCTTATGTTCTAATATAGTTTGTTCTCATAAAAAACTTAT AGTAGAGCAAAAAGGCTATCTTGTGAACACGGTCACGGATTTGGATCGGA ATCGTTCTTTTTTTCTTTCCATCTCTTGTATCTATTCAGAAGTTTCAATT TATTTTGATTTTGAGACGTTTTTTTCTCAAGAACGGACAAGTATACCTTA GGGTAATTTCGAGTGGAATTCATATCAATGATTTCCTCTCCAATATATTT TGATATTGATTTTCCGGTGACGTCTTATGCTACCCGTCGGGAATTCATGT GTAGAAAACCAACATGTCCATTTAAAAGAACAGTAAGAATTCTGAATAAA CAAACTAACATTTCATTCAATATTTAGTACTTATAGTTTCCTTCCTATGG TAGTAACCTCCAAGAGAGATTATTAAGCTAACATGGAAATTTTGCGATAA TGTAATTAGAATTACTTCTAAAAAGTGACGATTGAAAATGGATACAGTAT TTTACCATAAAGAACAGTTTTGAAATAGATTGTGCATGCTGGCCTGTGTC TACATCCTATATTTCTTCGCTCCAAGCGTGAAACTACTCTTCAAGAGTAA GGTCTAAATGCCTTCCTTGATCTTATTGTGTAAATTATTGTATATTGCAA AAGTTTAGATATTTGGGAAATCTTTAGTTCATCAGATGTCATCATTGTTC CCCAAAGTCCTAAACGACTGGAGCTATTAATTGTGTAGACATCTAATGTT ATATGCTAGACTAGACTTGTGATGTGGAAACTATTGCTCGATCTATCAAT ACTTGCAAATCGTTCATTCTAGTGGTTGGTGCTGATTTTTTATAATATCT CATTTTAGGAGCAATCTTTCTTCAGATTTTATAGTTAGAACATAGTCCCC AGTGGTGGGTTTGATAGAGGGTTTTCATTTCCTTGTAAGAAGTATGGCTA AATGAAACACTCTCCGTCATAAATTTTGTACCGTCAGATCCACCGCTGGT CTCAGCCAGCAAACATCCTACATAATGTTAGAAACATTAGATGGACGTCT CCTAGACGTCTGGTTAGATCCATTTGGTTTCTCATATTCTTATAAAAACT GCTCAAAACAAATTGCTCACACTTTATCGTTTCAGTCTGTCATATAAAAC TGTTTCTAACCCCCTACTTAATGCTCTTAAAACTTTTAGTGCGATACAGT AGATAAATTATTCAAATAATACACTCAATCTAGAGAGATTTTCGTATTCA AACAATCGTCTAAAACCAACATATTTGATACAAGAGAAGAGGTATATTGA TGGTATAGTCTATGGTTTATTGAATACCATATTGTTTTCTGAATTGAATG TTATTCGTGGAAACCTTTTTACATGGTCTACCATAATCTAATGATTTAGA AATCGTTGTTGGTTTTTCACTTTTGGAGTCTTGCTGCTCAGGATAAAAAG AAATCTTGGTGTTGTTTGGTTAACATTTGGGAATTTTTTGATCCCAATGG TTGGATATAGGATATAGTACATGGATTTTGAAATCTGTATTATTGGTATA GCCTGTAATATTATTCGTATGGCTATGAGAAATATAATGGGTTATCGTAC TACACCTGAACATCATAACATCATGCATCGACCATCATTCCGACGGTCTG TCGGCTGCACTTTAACTTCTCATCCTGCGTTGACGACAGGTGATTTATCT TTATCCAAGAAGATTTCATTATTTTCGTCGGCAAGCGAGGCGGATGATGA TGAGGAAGATGAACAGGATTTTGTGAACGCGCTACCTATTTGGATGCAAG AAGCGCAGGATAATATGAGGTAAGGTTAGGAAAGCAGGCATCTGCTCTGT AACCCATTCGCTGCAAAAGGACGATTATATCGGTCGAAATACCGAGGTAA CTTCAAATCGCCTACTTTTTCTACGGACATTTGTTTTTCCTCTTCTATTG CAAAAAGTTATTGGGAAACTAACTTTTATTGGGGTAACTATCAAGGACTG TTTCAACCGGGGAATATGAATATGGAACTGTGATATCCTTTATACAACCT TTTCAAAAAACGTATTTCAGCTTTGACATGTTACTTGCAGCAAAATATAC AGGGAGAATGATGATTGCAAATTAGCTGCTTAATTTTTCTTAACGTAAAA TAGGGAATATTCCTTAAATTGTTTATGTCTTCGTCTTCGGAGCCTCAAAT TGTCTGTTAAATATATTTTAAAATGTACAAGTTTTTTTTGACTGATAGTG GAAGTTATTCAATGTTCTTTTTAAAGAGACACGGCTGTCATGTAACATAC TGCAGTTGTTTTTGTTTATTTTACTTGCGGTTACTGAAAAAACCATAATT TGACTCAAAAAGCCATGCTTTGACTATAAATGGACATTTTTTCACGTGTT GTCATTTTATAGTTAGAGAGCTTATAGAGCATTCTTCTGCAAGAGTTCTT ACGGTTCTCTTTCTTTACCCAGAAACATCCAAGACTACCGAACTAGTCTG TTGATCAATCATGTCAGAAGGCGGGAAGATAAGGGTGGAGGGTGTTTGTT AAAATAGGAGCTGCGTAGGAGAACGAGCAAAAGTTGGTAAGAGGTTAGCC TTCAGCCCTTACCGCCAATAACTTTTCTTCCTACGCTTCCCTTAACTCTC ACACTCACTTTTCCCGCGTGATACCGTTCCAGCCCGGCTGGTGTGCCAGT CTACAATAGTGTTTTGCTCAAATGACTTTTTCTTAGTTGCCGAATACAGT ATGCAAACCTAGTTTTATGCCCCTGTCAAAATGTAAAATATAAAACGGCC GAAGAGGTAAATCAAGGAAATCTCTCTTTTTTAGCGGTATACCTCAATTT CTATAATGTATACAATCTCTGACGTCACATTATTTATACCAATACCGGCG AAATATTCAATAGAATGAATCAGACATTCAATAGATGTACCTGTTCACCC AATGTTCTTACGCAACTTGAATAATGGTATTATTGCGGTCAGGAAAACCT CGTCCTTTCGAAATTTTTCGATAGGTGCTAGCATCTTAATTCTTCGAATC CCGAAGGTCCCTTTGGTTAGAGCTTACACAATTCTGGACAAAAGGTTAGA GACTTTTCAAAAGTTCCCCAAAGTAGCGAAATAAGAGCATTTTAGGAACT GAGGGGTAATTGATGAAGCTGAAAGAAGAATTTGTTATGCTATTCAATTC GGAGCTTATAAAACTGGTGCTTCCTATTGTATGAAAAGGGAGACACTGGA CAAACAACGTAGGACTATTAACATTTTTCACGTTTTCTCGAGTTTTAGAA AGGAAAAAGTTCAAACATACTTTACTACGAAAACCTTTCCAAATTTTTTA CTCTAACCCATATCTCAGATTTGATTTTACAAAATCACGCGAGGCAATGG AAAACCAATAACAACAAATTATCATTCCGATGCTAAGCTTCCTTTAATGC AATAAACGATTTTCTAAACAAGATATTTAACAAATATTGCTAGATCTTAA AGACTTGAAGTTTCGTTTTGCCATGTGACCCAAAAACTTATGTTTGGTCA AAGTCTACTTAATCACACCTTAGGAAAACAGGGATATTGTTCGATTGTTG TTTTACGTGATTGGCGGCCGCCCACAGTCTAAAAATGTTTCAGTTGAACC TGCCAATCCCCCCAAAAACGAGGATTGGGGTTCAGGCCTACTGCTGCAAA ATTTATGACGTGGATCCAAACCTTTCAGATGTTGAAAATCGACTTTCAAA GCTTTAGTGTGTTGGAAAAAAGTGTCTACGTCGGGTGCCAGATCTTCGCA CGGATAATTTTGCACTCTATCTCTTCCTGGTCAATTCCAATTCTAGCCAA GAACTTGTTAATGGTGCTTGATGCTTAAGTGGCGCCTTTTGAATATCTCT CAAGGTTGAGCTTGGATTTTTGCTAAATTGCTGCGAATTTCCTTACCTGC CAGATTTATTGAAGGAATTAAAATGTCTGCTGCGACGTTAAGAGTTTTGA TGTGTAATCAGTAAGAGAATTCTTAGATCGCGTGCTACAGAGGATAAAAC TCAAAGCGATCCGTAACCATTTCTATCGTTCTTGTTATAGGTCTTACAGC CAGCGTTATGATTTGTGTTCCAGTCCACGATTGGCTGAAGTTTGTTCACC ACGTGCTCGATCCAAAACATTTGACACAATCAACGAACATCCGAAGCGAG ACTCCGTAAGTTTCCTTTTAAAATACATTATTACTTTTATTGTATAATTT TGGAATACAATATTCAGTTAGCAAATCAGCAAACTTTCCTTTAACATTGC TCGGTTTGGATTTAGTTGTCTTGGAAACTAACAGAAGAGTATCGTAATAT ATTGTCAATGACTATAGCAAAGATGGCTTTACTCGATAAATCTATCAGTT CCTTCTTATGATGAGAGAGCAAAGGTGGAGCGTTCGGCTACGGTGCGCAA GGTGGTGGGTTCATCCTAGGCCGGGCCAATGACTTCGTTCTTAGTACAAA AGGATACTTAATGCCTTTCTGCTAGACTCTCAGCAATTGAAAAGAAGGAT CAAGGGGGGTAGAGAGAGTGGTGCCCTTCCCTACCTTCGGGTAGATAGCT ATCGAAGAAGGAGAAGCCATCGAGTCGCCTCCGAATGCGGTTGAAGACTC ACTTACTACTAAGATGAGAATATCAAAATTTCACATTAAAAACTACAGCT GTATTACCCATGAAACATAATTGGATGGTTGTATAATGTTATCATATACA TATTGATAGCTTGTATCTTCTCATCGTTGTAGATCATGCAGTTAATGTAT CGTGATCATTAAAAACTCTCTCGCCAACTTATACAGTCTGCATTATGAAA CTAACGGCTTGTCAGCTTTAAGTTATCTGCGAAGTTTTTAATTAATTTGG ATTTAAATTTTTTTTGATATCTGATACAAAACAATAAGGATGGATTTGAT GCTTGTCACGAAAAGCTGTGATCCGATCTTCTTAACATTATTGATTAGAT TGGGAAGAGGTTTTCAGGTTTAAAGGAGTTTGATTATGAGTAACTGGTCA AACTCTTTGGAGACTGTGCGGTACTGAAATCGACTGTAAAGCTCAAGTGT TTAATCATATTCCGTATAAAAATCCCTGGTCTGGTAGCCAATTGTTGTAA CTTTTTGTTAACTTTTTCCTTTGTTAATAACGATTATAAAAATCGATTTG CTCAGTTTTTGATTACGTTACTAAAAGTTGCTTCAAAAGTTAATCACACG ATCAAAAAGTAAGCAAAACAAAATAATTTCTCAACGCAAAGTTCAAGTTC GCAACAATAAAAAGAAACAAAAGACTTCCAGACCGGGGTATCTTATACAG TTAATATATGGTTAATCGAACCTTTTTCTTTTAATACTTCATTCGGCATT AGAGCTAAGGCGCGCCTAGCACCTCGGCATATATTGCCTTCCTGCGTTTT TCTAAAAGAATTTTTTACGAACTGGGAAGTATATGTCGATTATATAACTC GATTTGTATATCGCACGTTCATTAAAAAATACTTAATGATACCTTCTAAC TAATCACCTCTAATTAGCAAGGTGCTTATCTCGTCTTTGCGCAATGTGCT AATTTTTCCTGAAAATTTTAATCTCATATCTTGATTAAAGTTATATTTTT AAAACCATTGAAAAAGTGTTTTTTTCATTCTTCGTTTACCAAGAACCTTA CAAAAAATGGATCCTTCACTTTTGGAATTGCTAAATATAATTTTCATTCA TTTCTACGATTTATTTACTTCAATATAAATGTTTTCTTAGTTTGGACTAT ACACGGTCATAACAATTATACCTGGTAATTATACAAAATTTCCTGCCTTG AAAACTATTAGCGACATTACCAATATAACTTATGTTATAAGATTGTAATT GTAATGTAATGATGGTCGGTAGGTTGTTAATAAAGTATAATAAAGATTCT GCTGATGTGTTGTTAAATTTTGGTTTAAGGTTAATTTAAATTTTAAGGTT TCTTCTAAAAGCTTTTTGGATTTTTGTTGAAGTTTTACAGGTTTTTGAAA TTTTGTGATTAGATATCATGTATTGATGTTTTTGGTGAATTGTATTTATG TACTGGAATTGTCAATTCATGATAATCATTACGTAATGTTTTCTACGGAA AGACCCCGGTTTTTGCCAGCAGTGGCAAATTTTATACAACTTTTGTCTAG TTTAGATTAGCCACTATTGGCTAAAACCGTGGTATTTCCGTAGAAAACAT TACGTTATGAATATCATGAATTCTTTTGTTCTGCAATTTGCTCAAAACTG TGATGTAACACTTTTAATAGATGCTCGTAAATTTGAAAACTTAATTTTTG AATCTCTGTGAGAAGACTGCAGAGAAGGGAACTGTCTGAAATGAACACTC TAATGTTATTGGTCCCTCCTTAGTTATATTGAATATAAATAAATGCTTTG GGTTTTTCAGTTGTTTTTTTTGTTGAATACTACTGGTTACCGACAGGTAG TGAGAAGATTCTTTATCGATGAAAAGTATCTGCCTTCTAGAAGATTTTGA ACGGTTAAAAACCTTTGGGCATCTGTGAATCCGGACGTTCGCTGTTATCT GAATATGCTTCCCCTAATATGGATTTGGTTATTTTGTAGCGATTGATGGG TAGTATAACAAAAGCAGTGGCAATTTATTTGGTTCAAGTCTTAAATAATA TGAGTTTGAGTTTCATTTTTCATTGTTTTGTATCGTAAGGTCTTATAAAT GATTTGTAGTATTTGAAACTCCATCTTTTTTCATTGAAGTTTCCAAGCAA TTAAATGTCAGGATATTGAAAGGAAGTTAGTACTCAGAGTATAGCTCTCA GGAAATGATTTAGCATTAAGGGTAAAGGGTTAACTAGAAACCTAGTCTTT CTTGAGCCTTGTGTGCACTGACCTTTATACGCTATACATGCTACCATTAG GATGCCACTTTCCAAAAAAATTATTCGATGAAAAGATTTTTTTTTGGAAA ATGCCTCCAGGGTTTCTATAAAGGTCGCTTGAAATTCTCNNNNNNNNNNN NNNNNNNNNNNNNNNCCCCCCCCCCCTGGGGATACCTTTTTTGGACTTTC AAAGTCCCACTAAAGGGTAGGAAAAATAGGAAAGTTTTAACTTTTTGCCC CCAGAAAGATTGAAATTTGGTCAAATTAGTCCCAAAAAGAGTCGTAGAAT TCACAAAACTTTCTTTTTTCTATCTTTTTTAGTCCTGCTAAGGGGTCGAG GGTCGAAAGTAGAAGGAACCCCAACCCCGGGTCTTATAATTCATTTTCTT TCCCTTTTTTTCTTTTTTCCTTTGTCATGTATCTTCATGATTTTCGGTAG GTTAGGGGGTACTTGAATTTTCATTTGTTGATTTCTTCATTGTACTCACC CGAAAGTTCCTCCTTCATTTGTATTTCAGAATTTTTTCTCAGTTGGGAAA ACTTTGTTTAAATATTGGCAGATTATGCAGTGCGTGATTCAAACTGGCTT TAGACTAAACTAGCATTAACAGGCTATTTATTTACCGCAAAGTATTTATT TGAGTAGTAAATTTGGACGTGCGGCTATTTTGGACTAGCGTCTTTTATGA CGGATTTCACATTCGATAGTGATGATAGTTTCTAGTCTATCAACTTTCCT CTCTCGCCTCTGAAGATAGGCCTAGAGCCTAGATTAGTTTGTAGATAGGA TTTTTCTTGCATTTAAGGCAGAATCTTTTATTTAGATTTAGGATATGTAA ACTTTTTGAAGATATTTTTTCATCCTCAATGGGAGTTTGGGAAGATTACG TGCAACATCAGTCTTTGATACATCATTTAAACGTCATTTTTAACAAGTTT CAATCACGTTACAACGTCATAAACATCAAATGCTAAAAACAAACTTTATA CCATCGTTATGTTTGTCTAGAAGCTTTTTTGAATTTTCTTCTCTGTCACA TGCTAATTCCCTCATAACAAAAAGCCTGGCATTTGATTAGCATAAATTTG TAAAAAAAGGTGATCATTTCGTGATCTATGAGAAAAATCAAGTGATACAG TTTTTATTGTCAAATACAAATCTCAAACAAGCATTTTGAATACAAGGAGA CCTTTGGTTTCTTGGAATAATGGACGAGAATTATCCTAAATCACCGTATC CTAGATTGCGTAGTGGTTCCTTGGTAGCTGTTTTAAAGCATAAAAGAACT CGATTACTTGCGGCTCATGTTGAATATAGCTCGCTCCCAGGCTCCCACAA TGTAAGTGAATTATTTCGAATTTTATTATTTGAATTTCTGACCCTTTTGT ATTTTTAGAGGAATTTCTGACCGTAATTTCTTCACTGTCAATAATTTATG TTAATGTTCATGTACTTGTTTTTATCACTTCAAAACCTCAATACACGAAG ACAGAGTAAAAAGCTGCGTATGTATGGTCTAAGGTTGAGCAATGATAAGT TATTTTACATGACAAAAACTTTATGAATTATTTTAATAAAAAACAATGTT TAGGATTGGGAAATTTAAAGGAAACTTGCTTAAAGATTGTGTTGACATTT TGAAACATTATGTATCCCCTTAGTGGAAATAATGATTCAACGTCTCTTTA CTGCTATGATATTGTCTTTATTATTGTGATGAATTATAGTTATTTTCGGC TGTTGAAAAGACAACCAAGTATTAATAATCTGTAGTGTAAGAGAGCGCCC CCCTCCCCACTATCAATTCACGCAATCGCATATTTTTTACCCAAATTCAC GCATTCACGCAATGTGTTTTCGCAATTCACGCAATGTGTTTTCGCAATTC ACGCAATTTTTGTTCACGCAAAGCTTTCCAATTAACACATTCACGCAAGT GAAAAAGCCCATTCACGCTTTCACGCAAACTGCTGGGGCCCCATAAGACA TAGGAAAGATTGCGGGGGTAGGGGAGCTGATCATTCTGGTTAGCCAATCA TTATCTGGAATGATTTTTCAATCTCCAAATCTGTTGCTGATTTTTTATTA TTTGATCCAAATTTTCGATTGTCGAGTCCAGCATTTAAATCGATCATTGA ACGAATCTCATTGTTTGACTATGATTTTACAAATTTCTTATTTTTCACGG TTGATTTAATAGCAATACTCGCGGAGACCCGATAAATCAATCTTAGTATG CCTTCCCCATGTTCACATTAATCATCAGTGAAAATTTCTATAGGATTAGC TAATTATATTTAAGCCAAAGGTGATCCATTCATCTAACCCATATAACTCT TTAGAAGTAAATTTTCAGAAGAAAGTAACATAATCTATTCTTTAAGGTTG TTATAGACATGGCAAGGATATAGAACCGGATCTACTGGAATTTCTATATC TTCTCTTACCAGATAAATATAGCAATGTCATTTCATTTTTTTTTTCTTTT CGTTAAAAAAACTTCTTTTTGCTATCGTGATATTTCCGTCAGTCAATTTA ATGACAAGATTGAGGCTGAATTACTATAAAACGGGATCGAGGCTGAAAAA ATGTCATATGGTTATGGCACGCTTAAGTTCATAAACTGACTGATGATGGA GCTTACGAGTATTCAGTATTTAGTAAATTTGTGCTTGCTTTATGTTCAAA AAGGGGTGGGGTATAGTTAATGGTAGTATTGAAATGATCGCTAGCAAATA TTCTGTATGTAAATTGTTTCGAGATTTTCCGCTCAAATCTTACCAAATGC ACACCAGCAAAAGTTTGGGAATCACCTTTTCAATTTAAAATCTTTTACAG GCCCGGAGGAACAACCGTAACAGTGGGTAGGCTGAAGGCTCAAAATGATA TAAAATTCGCTAGGAATTCAAGGAAAAAAATCTCATTTGCTCAAAAGTGG GGTTGCTGAAGTGTCCCCAGTCTCCGCGCCTCTACCGGGCCTGTTTTAGC TTTAATTTACATCCATATGAAACCAACGCTCATACACTACTAGTTTTTGT CTATATGAGTTAATAAGTCAAGGTTGTCTAGACAACACACTAATAAATGA CGTAATGTCCTTGGCAAATCAGATTTTTACTAACAAAATCAAACTCATTG AATGCGCTGATTACACATTTACGTCTTTCGTATTGTAATTAGCATTTTCG GTTTACCGCAACGAATGCCGGTTATTTTCCTTTTCATCGTTTTTTTCTTT GATTATATTTCTCATTGAAAAGTCGCATATGAAGGTTTGGATAAGCGAGA CGAATCATTTGACTTTACTTTTTTGTTGGAGTACAGTAGGACCATACCGA AAATTTTTCTTGTTGAAAAGTCTCATATGAAGGTTTGGATAAGCGAGACG AATTTTTCGACTTTACTTATTTGTTGAAGACAAGGACCTCCAAACGTCCT TTTCGTTGAAATGTCTCTTTTGCGCATTTGGATAAACGAGGCAAAATTGC TGATTGTTCTTGTTTGTTGGAGTATAGTAGGACCATCGAAGAATATTTCT AGTTGAAAAGTCTCATATGAAGGTTTGGATATACCAAGCAACATTTTTAA TGATTTATGTTTGTTGGAGATGAGAACCATCGAAAAATGTTTCTCATTGA AACAAAAACGGGGATAACGAGGCAAAAGCCGCTGGTCCAATGACGCTCAT TCTTGGTATTTTTCTTTTGCTTTTTTTCAATGAAATGCAGTCAAACTAAT ATGAATAACACTGTAGAGGTGTGTTTAATTCTTAGTTTTACCATTGTCGA AACGATAACTCTCATGTGTTACTTTACCCATAATTTGTTAGTTTTAGATA TTCATTGACCAGTAATGGTATGGAAAAGTAGAATCTTATTTTAACAAGGA TAGATTTAAGCGATGATGAATTTCAATTTGAGTAATATAAGTAATGAGTA ATCGATGATATCTCTATTTACACTCTGTCACAATGTATTGTACCTTCTCT CAGAACTTCTTTCTTGAGTATTATATTCGATCTTGTTCATTACCGTTTTG TTAATTTCATTATCGCGAAGAATATTCTTCACTGCAATTGTTACTAGGTG TCTTAAGTAACAAGATTAAACGCTAAGTATTCTTATATTCTTCATAACAG GAACTTAATAGGTGATATATTGGTCAATTAACACCATGCGCTTCTATTCT TGCCACAACTTCNATAGGTGATATATTGGTCAATTACCACCATGCGCTTC TATTCTTGCCACAACTTCCAGACATATCTTTGTGTGTACGTGAGCGCTCG TTTTTTTCAAAATATTGATGTGCGCGGCCTACGCTTTTATAAATAAGTAG CATCAATAACACAAACAAGATGCTAGCGGATAACGCGCGGGAAATTCGTG ATCTCCTGATAAAACTTAATTGTTCTTAATGACTGGTCTATTAATCTGTC ATACATAAATCTTTAAGGTGACTGTACTAAGTAGGTATTAGTGATTTGGC TCATGACTGAAGATCTTCCTTTTGGTGACTTATTAAAGATAGTATGTCAT CGGAAAATGCTGGTGGTAAACTTTTTAGGCCCCAATGTTCAAAGTATTCG CGTGATTTCCGTCTCAAATTTACGTCTGAAATTAAAGCCCTGCATTGGGT AGCCGGATGATGTCAGCTTCTGAAAAGTTTCTACCTCTAAATTCAAAGAA TCTGGGTGCAAAGGCGACCGGACTTTTCCCCAATCTCCCCAAATGGCCCT CGGGGGGGGGGGGGGGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNGGGGGGGGGGGTGATTTGACGGTTAGGGGACGCCCAACGTG GAAAGGTCCGGTATTCCTGCATTGAGCACTCTTAGTCAAGTGAAAAATAA ACAATGTCTATCTTTTCAGGATTTTTCTTGAATGTGATAGAATGACCTCG GATCATCATTACCAAGTTGATTATATCTCAATGTTACATAACATATCTTG TCATTTACGCAAAAGAACCTCACTGCACTAACAGTGTCCAAACTGTTTGC GTATTATCCACTCTAACATCAATCCATCGACCATTATAAAATGGCAAACG GCTTACTGCACAGTATAATCTCTCCTTTTTTTTGAGATACAGACTACCAT GATATAGTTTTCTATAAATATCACAGTTTGCAGTGAAACTATTAACGGAT TAAACTCGCTACTTTTTGCAAAACGGTTTTTACTTGCTCTCACCACGAAA AACTGATTTACAAGCTTTTCCATTATAACTTTCTTAGTCAGTGAGGTCAT TTCATATTCAAATTGCGATAAGCTTCGAGCCTTTACGTCACACGTTAGAC TAGTATTGCATATCTTATTTATTCAGTGGTTCAGCTATCTTTTTGGGTTT GGAGCGTTAAAGTCTTAAATGGTTTTTGATTTTGATTTTATTTCAAAGCT GAAATGGATTGCTATTGCATATAACGGAGTCGAAAACCGGTCCTGACATT ATTTCTGGTTTCTTGTTGAAGCGGGAGCTTATTGATTTCCAGTTTTGCTT TGGTCATTGCTCGTAAAATTTTAAGATTATCAAGAAATTCTTTTCCATAA GGATTTTTTTTCGTAATTGATGATTTCATGCTTGTTGTTTGGTTCAATTC TTCCTTAGAATTGTCTTAAAACTGTTAACTCCGCCTTCGAATTTTGAAGC CAGGCTTTGTTACTATAGCCGGTCAATCTGCTAAATCTGACCTGAAAAAA GGTTGCTTTTCATCGTCTTTTTTTTTATGTGACCGTTATATGGTATAATT GGATTGTCACTGCAATAAATATATGGTATTATATAAAGGTATCATGGTAT TCACTGTTGTGGTGATATATTGATTTTACCCATGCTGTGAGAAGACTCAA ATTCGATGAAAAATTGCTCGCTTTTTAATTTATTTTGAATGATCATCCAT GGTTTTAGTTAACTTTGTTTCATGAAGGTTCGCTTAATGGTTTCTGTAAA ATTGGAACAACAATGCAATACCTGGACTATTGATGCTTAAATTCACTTTC TGCCTTGTTCTTGGATCATTTTGTACAAAGGCATCCTCTTCCTGGAGTTA AATTACTTACTTACTTCTTTAGTTCGTTTTCGCAGGTGCCAACATTGAGT GTTTAGGGCGAAGGTCAACCATATCCTTCTTTTTCTTTTTCTTCAAGACC TCTTTGTAGAGCTCGTCTGCTGACCGACCATCAAGCACGTGATCTTCGAG TGTTTTGATTGGTCGGCCTCTCTTCTTCTCGTTAAGCACTCGTACTAGCC TGGAGATCTTAGATATCGTGGCGGTTCAAATCGTTTCTTTCTCCCACAAT CGAAAATGGACTGGACGTTGATTGACACTTTTGATAATATTGGAAGGGAG ACATAGATATTAAATTGAAGAGATTTGATTCGTCTGGTCGGAGCTCAAAA TTAATTTCCATGCTAAAATCTGGCTACTTTTGAAGCAATTTGTTTTATAA GCCGATTTCCTGTTATTTGGCGGGTGAGACAAACGACTCTTCCTTGTAGA GATTTTGTTTTCAATTAACTTTTTATATACTGAACTGTAGCGAAATTGTT GTAATATATCTTTGTTTCGGATAGATTGTACTGTTCATAATGTTTACTAC GGAGCGATACTAGTTCCTTGGCGTTGGCATCAGTATATAGTTTTTACTTT TGACCGCGGATACCAATTCCCTGGCAGTTACGTCTACGGTTTATTAAAAG GAAAGAAAGAGGTTATGTGTTGGATTTCGTTGCACTCGCGAGTAACCTTT CTTTGTAGTTTTGATGATATTTTGCCAGGGATTTGCTTAGAAAGTTTTCA ATGACGAAAGAGGCCGTCTACCATTTCTGCTTCTTCAATGGATCGTTATA TTTTCTTGTTTTTTCTTTCATGAACAAATCAAACACTAATCAGGGAATAA TTCTTCGGCAGTAGTAGTGGTTTCAATTAAGAATGAGTTTCTTTTCTCTG ATTATTCACCTTTTCCACCGTAGCTACCAATTGCCGCGTGGGCATTTTTT GTCCGCTGTATCCCACTATATCACCCTTTTTTCGCACCTATAGACAATAG AAAAATGTGTCAAAAAAGGATTGGATCGAGTTTAGGGGGATAATTAAATA ATTAAGTGGTACGCACCTGACCGCGCGACTACGGTCGAAAAGGTGTACTG GGAAAATTCTATCAAAATAATGTTTGTTTGTTTGTTTGTTCACAACTTCT TCCTTGTTTTTTTAATATCGTAGAAAAGGATAAAAATGCGGTCCCCTATA TCTCCACCTTCAGTTCAACCTTAAAGTCTATAATTGAATTTAACTTATTT GAAAAATTCGTCTTGTCTCCGCAAAGGTCGAAGGAGGAAATGAATTTTAT GCGATATTAAATCTCTGTGGTTTTCAGGTTTTAGCGGTTAGGCCAGACTT GTGATGAATATTGAGAGTCTGTTATCGAAAGTACACTATATTCGAGTCGC TTTCCAAGGAGCAAATCACTCGAAAAATGGTGTACGAGATTTATGATTTA TTTTTGATTTATGAACCATACGCGCTATTTTTAACAAGTTGGTATTTGAG TTTTTAAAGAAATAAATGCTTTTAAAACATCTTTGCGAGAGTAAAAGTAG GTTGGCCACGCTTATGGACTTTTCTGACTTGCTCTGGCAGCAATCTTAAG AAACACGGCGTGTGACNTACGCTTATGGACTTGTCTGACTTGCTCTGGCA GCAATCTTAAGAAACACGGCGTGTGACAATTTTTAGCAACTTTTCTTGCT TCTAACTTTTTCGTTCTTTTCGACATATGCCATGTGTTTCTAGAGAACAT ACGCCAGCAATGAGGTACAAGTAAACTCGTGAGCGTCTTCAATCATAAAT TTATAAAGCCTGAAGGGCTAGATGTCGTGCTTTGGCTGAGGAAATGTGTC TAGGTTAGGTAGGAAATCCTACCTAGGTCACGTGACATTACAATAGAATT TCAGCGCTTGACCAATAAGAAGCTTCACAGGTTTTCGAAAACAATAGCAG CAATATTTTTTGTGATATTCACTTTTTTTTTGCTTGGAAGAGCTTAAAGC ACAAAATCTAGCCCTTTGGACTTTACAGAAATTTGCGTCTTCAATGTGAT TCTATTGTTTTGGGAGAAGGCTCTACTGATACCACTACATGCAATCAATT TGAATAATTATATTCCATTAAATTCACAGTTGAAAGTTTGAATGTTTAAC AACAAAATCTTATCAGCATTTAAAGTCACGCTGATATATCATTTCGTTGA AATAGAGAAATAATCGTTGTTTTGAACATACCAGGCAATTGATTTACTGT TTGTTAATAATATCATGTTCTCAAGGAAGTCTCATGGATGCTCGTGTTCT GATTTACGATTGGTCGGACCGGAATGGTATTTTAAGGTGGGGTTTCTAAT CCAGGCAATATTCTGTGAATAATCTTTCCTGTAATATTTCTTGTTGGACT TAACATTTTTAACGACGGTGTATAGAGAATTATAGTTGGTTTTGTAAAGC TAATTTGTCAATTTCAACATTGTCAGCGATTTGCCAGAGTTTGATGAGAC TTCAAAAGCTTTCTAAAATTTTCTATTTGGATTTGAAGGTTGGGCCGAAA AGGGTGGCACACATGCTTTGCATATCGACCGGTTTGGATGTCTGGGGGGT CCTGGGGGTCTCGCTATAAAGGGATATCCGCATGCTTGCCACGTTTTGGC CGTTGCCATATTTTAGCGGCATGATACTAGGTTGCCAGGTGTATGACACC AGGGACAGTCTTTTGCATTTCGTTTTTTATCTCTTTTTCTTTTGGTTTTG ATTAATCCTAAAGGCGGCATTGTTCGTAGTAGTCAATGAAACATTTTTGG CTTAAAAAGAAAAGAAGAAAAGAAGTCTGTGAAACTTTTATAAAGTTGCT AAGGAAATTGTATGGTATCTTGATCAAGAGTTATCCTAACTTCCCGAATC CTGCCCAATTATCTGTTATGTTGATATTATTGTTGTTTTCAAATGTAATA CAAAGTTAATTACTAAAGAATTAAAAGGAGTTCAATTCTCTTATCTTCTA TTACTATAAAACTCCTCATTTGGCTATTGTGTTAAAAAATACCGCTTCAA AAATATTTTTGTTTGTCTCTCATACCATTTGTAATTTGCTTGGAATACTG TTTATGTTTATGTTTATGTATTTGGTTTGTTCGTTTTATCAATCTTTCTT GGTTGTGTGTGTTGAATTTGTTTCGGTAGTTGTTGTCATTCATCACCCCT CCTAGCTGGCACACAACTTTGTTTTAACGTTCATCTAACGTTATATTGAC GTTATGAACATTAGATAAACGTTGAAACAACGTTGTGTGCCAGCCGGTTT GTTTCTATTTCTAAGTACTAGTGGTGATAATTTTCTCGACTGTCAATGTG CTGCTANCCAGCCGGGCTGTTTCTATTTCTAAGTACTAGTGGTGATAATT TTATCGACTGTCAATGTGCTTATTGAGTTGAGTTGAGTGTAAAATAAATT GTTTTTCTATAGACTGTACATTAGTGGTTCAATATATTATTTTCAAAATG AGCTTTTCAAATATTCAAATTAGTGGCAATTTCACAACAGACAATTTAAT GGGTTATTAGCGATGGCTGGTTGAATATTGATAACGCTTTGTATGATATT TTTAATATATTGTTATTGATAATTTCTAACGTGCGGAGTTTTAAATTTTC AGTTAGGCTGGTTGATTTGATAAGTGTAAGTTGATATGTCTGTCACCTCA AAACGTTGGGGCAGGCTGGAGAATTCAAAAATTGTCTAATTCGGCTGAAA TTGGGCACACGCAGAGTACACGTTTTGCACACGTAGAGCGACGACGGGGA GATTAAATCACCCGGCAAATCTTAAGCTGACCCGTCGAAAACTTTAATGT TTATCATGGGAGTTGATTTCCCAAGTAGAAAAGATACAAAAGTCCTTTTA CTCGTTGCTATTAATCATCATATGTGACAAAATTGATTTCTCATCGTTTC GGGATCAGGAAATCTTTATGTTTTTATATGAATTATATAATCTGACGTTA CTGTCCTTCTAGAATCTTCTATCTTCCTTCAACTCTGTAAATACAATAAA TCTTTAGAAAAGCCTTTTCACTTTTCAACATTCGAAATTTGTCGTAGATT GTCTACAGTTGACGCTCTCTAATTCGATGTTCGAATTGGATTTTCACTGA ACAAGGGAGCGAATCCAAAAGTAGAGCGTCGTTTCTGAGAGTTACTTGTT AACGGTACCTTTAATACAATAATAGCGAGTTTATGTATTTGCACTTTTGA GGACGGTAGAGTTACTGAAGCGATTAGGAATAACCCGCAGTTCTGACCCG CAATATCGAGAATGGTAAAGGTGTCGATTTACAGTCGTCCTCAGCTGGTC TGTTCTTAGTAAAATTAGATCCTTACCGTCTCCGTCGCAGAAAAACACAC ATACATAAACTCGGTAATGACTGGTTTTTAAGGGCTATACTGAGAAATAT TACCCGAGGTCAAGTAACGACCGAGCTTACTTAGCATTATTGAATATATC GAATTAGAGAGCGTCAATTGTAAATGGTTATTTCTATTACTTTTTTCAAG CCAGCAGCTTGATATCATAAGGGTAATCTAGATATTGTCATCTTTGTAAA AGGTTGTTAATTTCTGTTAATTTTATTATTCCTTAATCCTTTTATGATTT CAATGTTATTTATTTTTGCAACTTTCCTATTTGATTGAATGGAGTTGAGC AGTGTTGTTGTTGGATGATGTTTTTCTCAACTCAAGCATGAACTTTACAG AAAAAAGTTGTATGGGTTGTGTTGAAGATATCTATTTTGGGGAATTTCTA TAGATTTGTACACCCCTGTCCCGCAGCCCCGGTGATACTTTATGAGAATA GAAATTCTATTGTTTCAAGGTTAAAGAATCCAGTTTTAGAGTGCAATTTT TTTTAAACATTGAATTTCGAATGGGGATATTTGAAATTAATAAAAGTCAT TATAATTTTGGTTGTTGCTATTTTTAGAGGGAAGTTACTTCATAATATCC CGCATCACGTATAATTCACTCAACGCATTTCTTGTTCTGACTTGTCTTGA TACTTTTGACTTCTTGTGCTTTCAATTCAATTCTTTTGTTTTCTTTACAA TGATGACGTCATATTTTCAAGATATTTGTATCATTCTTTAAGCAATCATT AAGCTGCCAATAAGATTAATTACTTTATATTAATTAAAGTTCGTCTGGTT TTTCTTAATTGGCTTTTAGTTTTTGGATATAAGAGATTTCTCTTGATTTA TTGCCAACTAAAAGCCCCCTAAAAGCAAGCTTTTTAATCAGAAGCTCCCA ATTTTTCTTTAAAGCTTCCTTATCAAAGTTTAACATCAAAGTTAAATGTT TGGTTTTCCTTTAAATTGTGGTGTTCTTAGAAAATAAATTATTCTTCTTA TGAAAATGCGGATTGTAAAAACAATACCATTGGAAAGGACATTGCATCTG AGTTCAAAAAATTCTTGAACAGATTAATCTGTCATCGTTCAGGAAATAAC CTTTTATTTTGGAAGTCACCGATCATTTAACTACTACCTTTTCGTATGTG AAAAAAAAATTCATTAACATTTCTTCAATGTAGAGAAGAAAAAAAACAAT ATAACAAAACAATGGAATCGATTGGTTAATACTGAAAATTTCCTGTATTT TGATTGGTTGAGAGAACTACTAACTACANAACAAAACAATGGAATCGATT GGTTAATACTGAAAATTTCCTGTATTTTGATTGGTTCAGAGAACTACCAG CCACTTGAATAATGGATTTGATTGGTCGATTGGGTTCCTCGTTTCCTATT TTCTACATCAATCCGTTTTCAACAACACACGTTAAGCTTCAGCATCATCA TCCAGAGGCGATCACCACAACAAACCAGAGGACATCACCATCCTTTGTCG CTCATCACAAAAGATCCTATTCGACATCACCGCGCGGGCATGGGCGATCG CGATCTCTGTCATCAGGTTATCATCGAAATTACAACACTTTACCAACCAA ATCCTCTTCAAGAGCAAAGAGCTTGACAGCTTTGGATCAAGTCGGGACAT CGAGTTTAAATCGATTACAATCGATTCAACATTCAAACTCTGTTGAATAT CTCAGTCAATCTTTCGACGATACAAAATCAAGAACAGCATTTGTTGATGA TTTAGATACGTTGAATTTGTATGGATTTGATAAAATATTGAATGATTTTT CAACAAGTATTTCATCCTCATCACATTCACCAGTTAGTTCACTACCTAAA AATCGTACTTTAACGTTAATTAAAGAAGAAAATTCGTTCGAAGAAGAACA AGAGGAGGAGGAAGAAGAGAGCATTGATAAAAATGAAATGAAGAGTTTGT TATGTAACGAAGAAGTGAATGAAGAAACAATCGAGACAACGAATCACATT GAAACAAAACCACACGATGATTTAGAATCACCAGAGAAAATGTATTTCCA ATTGACCAGTACAGCCTCTACTAAATTACTATCGACACCTGATAGATTGG AAACATCAAATACTTGTTTTAGAGTATACGAAGAAAACACAGATTCTCGT TGTGAGGACAGAATCTCGACTAAAGAATCAAGTAATTATTTACCTTCTTC AACTGGAAGACTGAGCAAATCCATTGTTGAAAATGGAAAGAGCTTACAAA ACGATGATCCACAGAATTTTTCTTCTTTTAAACCATTAGACGCTTCATCA GGAGAAAAAATGAGAACTTTTGCAGTTTTTTCGGAAGAAAAAGAAGATAC AGACAGCTGTTGTGATGCTGATGATGAACTAAGTTTTCATAAAACCGCTA ACATTCGCCCGGTTCGTATCCCGAAACACCTAGACGAATCCGATAACTGC CCCGTTCGGAATACTGAATCCATGTTACGACCCGTTCGGGTTAGTCGAAT ACAGGATGAATTCAAACATCAACGACATCGAAAAATCTCACGCGTTCCTT CCTTAGATTGTCCTATATTACTTGAAGATAAAGTTTTGCCTCATATTGAG AGCAATAAGTTTGAATCTGAGAACCAATTTCTTGGATCAGATCATATTGA TCATTTACCGAGAAGTTGCAGTTGTCCACAAGATGTAAATACCATTTATA AGCGTTTAAGTGACGTCGGCTTACACGATTTACCACGAGTAAAACATAGC GTTGAAAGCGGCTCCATGTTTCGGCGCCAGGGTAGTGATCGACGTTCACG GCGACGCGTTGTTGCCAACGGAGATTTACGGCAACGAAAGAAAGGCATTA GTACTATGGAGTTATCGACGCTCGATTTATTGACGGTCTTCGATATGGCA AGTCGTAATACGCCGTCCAGATTATCACTACGCATGCGTAAAGAATCAGA GGTAGGTTTTAACATGTTGATTTATCTGATCATGACTTTTCATAAGAGAG AACAACAATCCGCAATTCACCAGTGATTTTCTTGCTAGCTTGATTTTTAG GAGTGGGACGATACACTGTCTCAATCAAAAACTTGATTGTTGACTCGAAA ATTCTCTTTTGTTTATTCGAAAACCTTTCCATTTCTATCGTTTATTCAAA AGCTTGATAATATGTACCGAGAATGACTCTGTAGTAAATTTTTGGGGCTA TTTTCAACGATAAACACCATGATTTTGAAATCTTTAGCGTTTTTGGAAGT TTAGTTTGAGTTTCTCTGTCTATTTGACAAAGCTAACAAAGCCGCCCTCT TTTCCATGATTCATTCGATCTCTATAAAGGACGTTTCTGAGGAATACCTG GTATGTCCTATTAGAAGCTAATTATATAAAGCACCGATAGCTGACAAAAC CGTACTTTATTAATTAGTATTACTGATTACGGTTAATCACTTTTTTCCGA ATTTTTCTTTTCTCTTTTGCTTTTTAGAGACATGATTAATGTTTCGAAAT TCTGTCAAACTTTCAAAATAACAGTACTAAAATTGATCCAATTCCAATCC TCTAGCAAGTAAGCTATTGAATTGCTTATTTGTTTGGCTGTCTTTTCTAT AATACTTTGGATCTGGCATTTCAATAATGTCAGCCAATAAAACCACAGCT AAAGTTACAGTTAAAGTTCTTGTATATACAGGCTCAAGTTATGTCCCAAA TTTCCTCTGTAATGCTCGTTGTGGTTATTATGTCCCTATGCACGCTTGTT TGAAATAAATATTCAAAAAACACGTTCCTAAAATTCTAAAGTAGTTAACC AAACAAACGTATGGAGGCTGAGATTAACCAGGCGATAAACGATAAAATAT TGCTATTAGAAAAACATTAAAAACCGTAATGTTTGTCTATAAAGCATTTT CATGGTTAAACCATTTGACCATAATTTAATTCCAAAGAAAAATATTCGAA AATCCTTTCTCACGATATTTTTCAAATTCGCGGCCGGTGCATTGATGTAA AAAGTGCGGAATCTAAACTTGATTATTTTTATTTGATCTTGTCATCTTGG TTTTGATTTTATTTCCGTAGAGAAATAGTGTTTCTGATTCTATTTTAACA ACTTTTAATTATAAAATCCTGATATTGTCAGACCTTAGGATGAGAATTGA ACTTTAGCTTTCATAAACTTTCGAATGGTTCTGAGCTGTCAGATGGATTA TGTCGAGTTTGTTTTGCTAGAATATCAGGTAAAATAAAGATATTTTCAAA GTAGTTTACGAAATAAGGGAATTATTTCGAGATTTTACGTTGCATTTCTA GATATTCATTGCTGTAAACTTATCTCAAATTATTAGTCCAAATGAAGACA GACTTTACTTGAATTTTGTTGACGCAGTTTACCATATGTCCTATATTGAA AGTATAACTTTTCTCTTTCTCAATTTTTCATGGATATTTAGATCTGATGT GGTCAACTCGAAATTTCAGGATGTTTTTTTACGTCTGTAGATAAATTCGT TTCTTTCTTGGTGAATAAAACCCGATAACGAAATAAACTTTCACAAAAAA AGGCCAAAAAAACTGTCATATCTTCGTACTCAAAATCATTAGAGAAGCAA GCTTTGGATTTTGCTGGTTATTTTCAAAAATATTCAAAGTACTATTTCTT TGGAAAATGTCATTGACCTCCAGATGGTCTACAAGTCTCTGATAGAGGAA GAAAATTTAGTAAAATTAAAATCAAAGACGTGACCTCATTTACGCTTTTT GATACTATCTTTATGGATGGATAATAAGATAGTATATAATGATGTAATAT TATCACCATGCATAGTCTAAAAAGATTATTTAAAGGATCCAATGTTGTGT TTCCTCTTCTTTATTTTGGTTCGCTGTTGGAAAGATATGAATTTATTCCT GAAAAAGGAAGACGAAAAATGAAAATGAAGAATAAAAAAGTTTATCATTT ATCACTATGAATTCTCATTAGTCAAAAGAAAATTATTCTGTTAGTTAAAA ACAAAACCATATGTAATNAAAATGAAAATGAAGAATAAAAAAAGTTTATC ATTTATCCCTATGAATTCTCATTAGTTCAAAGAAAATTATTCTGTCAGTT AAAAACAAACCATATGTAATGGAATTTTAGAGTAATTTAAAGCCTTTGAT TATAATCGGTGAAATTGTAAGAGGGGGTACTAAGATTTTTAAAAACCCTA AGTAGATTTTAAAAAGTAAAAGTTTTATTTTCTCGGCTCGGGGAAGGAAA AATTTGCCGGTGTGATCAAAGATGGTTCATTTTGTTTGACAAGCGCTGTT AGTTTTTCGTTGAATTTCAAAACATTGGATATATGGCTTCCTTTAAACAT ACTATGGTCTCCAAAAATTGTCATATTATTTCATCTTTGTAAAATGTCAA TCAAAAGTGATCCAATAGGCTAAAATGGAATTCAAAAGTTTTTATTCAAA TGGAAATCTAGTTTTGAAATCGATTAATACTATTGATTATTGATTATTGA TTATTGATTATTGATTATTGATTATTATTTATGATTGGGTTTTACTGGAC TGGATTTCAAAGATATTAACGATGATTGTTTATTCCGTGTTATCATCTTT ACTTTATCACTTATTTGGTCATCTGTCGTTGACTTTTATTGTCGCATTAT TGATTTTCACCTACTTCGTGTATTTCCCAAAAGTTAGCGACGAGGAAAAA ATATTGGTACGTTTTTGTTTTTATTCATGTTCACAAACTTAGGTTCTATT TAAAAGGGTTTCTAAAAAGGTCTTGCTTCAATTGGGGATTTCCCATCTTT CAATTTGACTTTTTAAAGCAATTAATTGACCAATAGCCCTAAACTAGCAG CTTTTTGGCACAAAATATTTTAGAGCGTTCGTATTAGATGACGTGACTAT AAGATGGACATTTTTAACGTTTTTTTTTTGCCCAACGGTTGATCAATTGC GGAATATTTTGAACGCATGGCGTTCTAATGGATTTAGAACGCAATGTTTG AACGTCATTCCTATCGTCCTCAAAACACGGAAGATTGAATTTTGATGTGA TTCTAACATGAACGCTCACTAATTCGATTTTCCAGGAGGATTAGATTTTC CTCGAACAAGGGAGAGTATCGAATAGAAGAATGTTTCTAACCAGTAATCC ATTGATTTGACATCTTCACCATTTCAAACACAAATCAATAACCACTCATC ACCAGACCTCTAAACAAACATTACAACCCTATCATAACATTTGGAACAAT AATTATTCGTTCTCAAGGCGTCAAACGATTGAAACATTAAATTTTAGGTT TCATCTCATAACAATAACATCAACAACGTTCTTTGACCAGAGAGAGAGAC TCTTCAAGATATCTTAAAAGGTCATGAGAAAAGAAAACAAATCCATAATC ATAGCTGAGAGTGATTGATAACTTCGATCTGTTTTGACTTGCAAAGAACT GAAAACTTCCAATGTCTTTCGTTCCCTTCCTTCAAAAGTCCTCAGAAAAA TCAACCCTAACCACGAAAACTTTATGAAATTTCTTCTTTTTAATGTTATA CTATAACAGTATACGGCCAAACATTGTATAAAATATTAACGTAATATTGG GTTGCTGAGAGCTGTTCTTTTATGCAAGTCTAAAAGAATTATTTCGGTAG ATTTTGAGTTTGTCTTACTTTCTTAACTGTGGCTTGATGTTGTTATGGGG TTGCTGCAAGTTCCCTGTCAACATCATTCTTATCCTGAATCACTGAAGGT TTAACTATAATATACTTTTGTTATCTGTATCTTTTTTCCCTTGAAGAATA CAAACGAACTCTGTACCGGTTCGGAGACTAAGACCATGTTCGCACGTGAC GTTTCCGTTTTGCTCTGAAGTGAAATGAAGCCATTCTATTGGTTAGAAGT GACGTAAAACTTGAATGTAACCAATAGAATGGCTTCTTTTTGTTTCGAAG CGAAACGGAACCGTAGCGTGCGAGCGTGATCTAACTAGGTGCCCATCATT GGTTTCGATTCGTTTGACATTGTCCTAACCAAACCATGATTTTCCGCTAC TTAAAAGGATGATCAGATGGTTTGAGATATTCAGATTACAGAAACCTTAT GTGGTCCTCAGTAAAACCTCAAAGTATTTTTGTGTAACAATTTTCCCAAA TCGAGATATTGATATTTGAAAAATTTTTGAAAATAGGCTCTTACACGGTT CTTACGTTGAAATTCTATTGTTTTCATCCTAAAAGCCAAAAACTTATAAC TCGTAACTTAAAATATCTCGACACAAATAATTTTGAGATTTTGCTCAGGA CAATAGAAGGATCCCACATGTCAAATATTACAAACAATCCGATTATCCCT TTAAATTTCCCGTTTATCTTGATTTCTAAGAATTGGTCAAATATCATACT TACCATGCTTACCTTTTTTCCTTCAAAGTCACCAAGGAAATCAAACAGGA TTTTCCCAGGAAGGGGTTTTTTTTAATGACTGAAAGCTTTTATATCTTGT CGATTATATATGGGCACTTGAAATAGGTAATTATCTGGCGCAATCTTCAA TCAGATCAAATGGCGAGAATCTTTAGACATACATTTTTTGAAGATTAAGT CACAAATCCTTGTAGTCAATACTAAATTCTTTGTTTCCTGCTTTTAAAAC ATGAAAAATGCTTTACACAGATTACGTTTGTATTTAATTATCAAATCGGT ATCAAAATACTTCATTAAAACAGATAATTATATCGCGATAGCCTTAAAAT GATGTTTTTGCTATCATGCATTAAAAACTCATTAGCGTTTCTTAAAAGAT TTTATTTTGATTGTAGAGGTATTTCATCTTTACATCACGCTCGAGTGTTT TTACGTCTTAGAACCTAGTTAGCACNTTTCGTCTTTACATCACGCGCGAG TGTTTTTGCATCTTAGAACGTAGTTAGCATAAATTTATGGTTTTTGATTT TCTTCACAGGAATTTTAATGGGACTTTTAATGCCAAAATTTTCATAGTGG GGCGTGGAGAAAATTTTAATGATTATTGATTTTTTGTTAAAATTTGAGAG AGAATTTTTATTGAATGGTTGTAAGATGGATCAAAATGCAAAATTTCTTA GAGCACAACGCTATCGTAAAGGTTCCAAGGTACTCCCTTTTTTTACACTT TACTGACCTTTACTAAGCTGGCACACGAGGTCAAGACAATGTTCATAATT GTAGAGCCAGAGTTTGGTATTCCATTAGCACAGTATTTGCAATAATAACA TTATTGCACTAATTAGGTTCTTTCTCAACTTTATGGAAATCTGCTGGTAA AAATTGTCAAAATATTTCCATATTTTGGACTAATATCAGAGGCACTTTCA TTTAATAATCAAGGCACTTTCATTTAATAATCAAGGCCCTCAAATTATTG CTATAATTAACAACGTAATATATTTATACTTCTTGCCAACATCATTTATT TCTGTTACTATAATTAATCTCTTAATTACTTTCCGGTACCCTTAAAAATA GCTCTGATTAAGGGGTCGTTAAAAATTAAAAATATTTTATTCAGAATGTC AAAAATTTGGGTATTCACAATGCCCCATGCCCTTATATAAGGTGAAATGG TACTTCAAAATGCCTTAATTGGTATATTTCTTTAATGACCTATTGAGAAT TTGCGTAATTATGTTACCATTTTGATTATTATCTAATTTGTGGGATAAAT GCGTATATTTTACGACGCACAACTTGAAAGAAGAAAATCAAAAAAAAGTT TTTTCTTCTTTAATATTGTTTTTCGAGAGAGTGTGTGTTATACGCATGTT GTTTTTCGCAAGAGTATTTTGAGTTCAGACTACTCTTTCTTTCTTTTGAT GAGTTTTTGATGAGTTGAAAGAGCTAAAATAGAATTTGAAACGTTTCGAA CCTTTTATGGTAGAACTGCTTGTGGAGTTTTGGCTTATTCTATGTATTTT TCAAGTCAACCTTCGCTTTTCCAAGTGGTTAACTATAAAATCATGGAAAG GGTGAAAAGATCAGCAGTATCAAATTATGTAGGTTCTTAACTTCTGTAAA TATCGTCACGTAGGGTTAACCCTTGGGATTCATAGCATCTTTCATGGGAC GCAACCATGTGGTTAATTCGAAAGTAGATATTTGAAAGGGGGCATCATTT GGTGTCTGTTTTGCTTTAAAGTTTGTTTTCTCAAGATTTACTTGTATTGA TTTGAGCTATGAAAGCAACTTTTTGCTGCTCTCTCAATTTAAAATTCGCA AGGTATTAAAGTTTGAGATTTTCTCCTTGTTTGCTGGTGTGTACCTGGAC CTAGACCTCTCACCATTATTTCAATACCCTAGAGTTGGTACTGGTCATGG CCAATGCATTCACATGTTAAATTTCCTATTGCCAGACTTCGAGAGGTATC GTGGAAAAGCGACAAAACTTTAAACTTTATCCCAATGAGCCAAATGTTCA AGTGTCAGAAGCGTGATTGAGATCTTCTTCAATTTATAACAGTTTTTATC AACCTACTTTAATTCATATTCATTCAGAACTCACCAGTCGCACGTCGACG TCGAATCTCAGTCAAAAGCACAGCCGTCCGAAAACATTCAAGTCGCTCCA CAACACCACGACAGCGTCGCAAGACTGTCTCTACATACACGCCAGCATTT AACCAATACAATGGCTCTGATGGTCACCTTTCATCGGCTGTTACACCGTC ACGCCGATTATCTGTAAGTCAGCTTTATATTTTCTTTTGATTTTGAATTA AAGTACACTCCTTTCTCACAGACCTGGTAGGGTTTTTTCAGCCAGTGGGG TAAAAATGATGGACTGAAACTCGCAGGGATTTTCAAGTCAAAAAATTCAG TGGGGATGAAAAGATGATGATTTGCAGTGAGGCTTTTTGCTTTATTATTT TAACTGGGGCTAAAATTGGAGAAAGATTTTCCAATGGGTGCGATATTTTG GCCAATTTTTTCAGTTGGAGGGGTCCCACCGGGTCTCTGAGAAGGGCGTT TCCAGTAACATTAACAATAATTGTGATATTGGCTGNTGGCCAATTTTTCC AGTTGGAGGGCTTCCACCGGGTCTCTGAGAAGGGCGTTTCCAACAATAAT TGTGATATTGGCTGGTAGCTGCGCAGTCTTTGTGACCAAAAAAGTGAACC ATACAAGTTGCAAAATAGTCTATTATGCTAGATTACCAATTTAGACATTA GTAGAAAATAAGCAAAGATAATGGAAGTGACAAACTGATATTATCCCGTT ACAACTATTGTATTATGATTTAACACTCCGTATTATTGTATTATGGTATA CGGATTATGAACGACTCTAGTCTTGTTACATCCATACTCCGTATTATACT GTATTATACGGATTATGAACGACTTGTTACATCTTTGTAGCCCGGTTTTG TATCATTTGAGTGCTTTGAAATCACTGAACTACAATCAGTGCCGTAATAT ATTGGCACTTTTGGCTAATTTACCATTTTTCGAAAATTAAAGTTCGAGTG AGAATGTCAATTTTTAGGCCTTCAACTTGATTTCATCGATTATTTCGATC TGGGAGGGATTTATTGGTTTCTAGGCTATATTTTAAGCCTTACTGAAGCA TTTTTGAACTTTTGCATCCTCAGATCCCAAGTCATAAGTCAAGCGTTAAA ACTCAGAGTTAAAACTCTACCCTTCGAACCTACTTTAGAGCACTTTACAA ATCGATTGTGGTTTCAAAACACCCCGGTGAATTTCCCTTTTGTGTCAAGT ATTTTGTCACTGATTGTAGATAGCCCAATTGTATGTTTTAACCCTCGTGA CTTCAGTCCACTGTCAATGGTAGTGATAGGATACATAGTCTGGCCGAAAT ACAATAAAATAGGGGTGAACGTAGAAAAAAATTCCGCGTAGACTTTCTTG GTACCGTTGGAAGCGAAATTTTATGTACATTATCATACTCAGAGCCTCAT GATGAGGCCCTTGGGGAAAACTTTTGGTAAAATCAAGACTGAAATGTACT TCTTCGCGCCAAAATAGATACGTTTTTTAGCAGTGTACTGGTCAACAGCT ACACTAAAAACCTATCAAAGCTATTCAAAGTCTTTGAAAGTCAGCGCTAT CCCCATGTGCTTTCGCCTTGCACTTGACCCATTTCATATCATGGATAACA CTGTTTAATTGCTTGTGGTTTTCAGTAATGTGTTTGTTGGAAAATCCCCC CCCCAGATTTTTGAGACATGGGTATACATATTTGAATGTTTTGAAAGACA CCTACCATTGCAAGGATAGCACTTTTCAAGGCATTTTATATCGAAAATTG GTCCTAAGTGTTTTATTTCACCAATTTTTTTCCCCAAGGGCCTCAACGTG AGGCTCTGAGTATGTTAAACCTCGTAAAATTCCGCTTCCAACGATACCAA GAAAGTTTACGCGGAATTTTTTTCCAGGTCAACTTTTATTTCTGCCAGAC TAACAGTAGAGAAATACGTTCAAGCAAACTTGATAAAATGCTTACTTGCA ATGAGTACTTTATCGCAGTCTCAGATCATAGTTTTATTTTAAGTGAATTT TTAGTTTATATCAATCAATTCTAAATTGCCCTCGACGAGATAAGAATTTT TATATCGAAATGTCTGAATTGAATGTGTAAGCTTGCACAACTTTTGTTAT CTTATCTTGAGAAATGATTCAGGCTCAAGATTATTACTAAAACTAAAATT TTCAAAATATTGATTTAAGATTTAAGCTTGAGATATACCGTTTTAAACCA CTCTATGACAGTCACGTTTTCAACCAATTTTTTCACACAAGATTATTGTA AGGGTTGTACAATTAAGTGTCATTTATGACTATTTTATAACTCATTTGCT TAAAAACAACGCAATTTTATTACTAAACTGGATAAATATAATGATGTAAT TTATCGTTAAAATCCGTTATATAAATAACGGTTTAATACCACTGCATACG TGACTCAAGTTTGTTCTTTTGAAATTTTTGTTACAGTTTCTTCTGAAAAT AACTTTGAAGCTGCCTTGGTGGAACTAGAAGAAATGATTTCTTATTCTAA ATTTATACTATGTGATAAATTTATTTTTAGTTTCACACATTAAAACCCCC CCCCCCCCCCCCAAAAAAAAAAAAAAAACTAAGAAAATCCTATGAATTCC TTACTAGGACTAATTTAACCACATCTTGATCTTTCCAGAAGCTGAGCTTT TTATCCGACCCTTAGTGGAACTGCAACTTAATTTTCTGAGTTTCCAACCC TTATAAGGCCTTTCATGTTACAAAAACGGCATATACCCAACCCTTCACTC GCCTAACCTCTGACAATGACCTTGATTGATATCCTCAAGTCAAAGCTAAC ATTATAGCTTTATTTTTTAAGTAACTTTAAAAAATGTACAGTTTCCCTTT AAAAACTCAATATTATCGAATCTTCAGATGACCTTGGTTAGTTTAATGGC TTGTTAATGCTATAATTAGTTGTTGTGGGAGTGGGACCGAGCAATCCAAG TGTTCTTTTAATGGCTCATTAAAACTCAATCATTATTATTATAAGGTTTT GTTGTTTATTTTGAAATGGTCATCATTTATCCCTATGTAAAGCTGGTCAA TCAAATATTGCAAAGAATAAATTGTTTAGAACTAAATTGGTTTATTTTGA ACCTTCCTTAACAATTTAGACAAAGTCAAACTTTTGAATGTACAATTTTG AAAAGCATTTAATCCAAAAAAGACAGATGTTTTATAATCAATTGTCAAAG TAAAGTAAATTGGCAAACAATTATCGAAATCACTTAAATGTACACCTCTG CTAGCATTCCACGGATATTTCTCATGAGTTGTGTGAGTTGGTACATTTGA TTTTAGCCTGGGTGCAACAATGTCTCCCGTCTAATGTCCAATCATCACAG TAATAGACCTTATCGGAGTTTTTCTAAAAAAGCGATATATTGTGGGATTG TTTCGGGGGTATTATACAATAGAATTCCCTCGAGGAATTCCTAAGAGATT TCTATTGTAATACCCCCGAAACAATCCCACGATGCATCGCTTTTTTAGAA AAATCAAAACCTCCGATACGATCTATTGTTTGGTTGTCCTCGTCTTTCTT ATTAGACGTTTTTTTGATAAGAACATCCAAACCTAGATGTTCTTAACTTT TTTAGTTTTAAGCCTAAAAATGTTCTTAGCATGTTCTTATTTTTACCATT TGCGAGTGTTTAATTTGAGCTTATCATGTCAATTAATTAACTTAGTTTGA GCTAGAAGAATAAACAATTGCAAAAAATTTCACTTCATTATAATGTTGTC AACATATGCTTACACAAGACCGCCCTAAGAAGGGAGGAGGCGGAGAAATG AGAATTTAATAACTTAGAATTGCTCACGCGAGGTTAAATATGGAAGGTTA AAGACAGGTCTATCCAAGAGATTTTCATTTTGTTTATATTCTAATATCAG TATCATGTTATTGCTGATTTTCATTATGACATTAATCATTTTTGAAAGTT TTCATGGAAAGTCAAATCAAAGCCAAATCAAAGATTATTGCTTTGTTTGT TCCTGGTACAACGGTATTTGCTCTGCAAGCTAAGCAACCAAGATAATACA AGGTCTTTACATATTCTTGCTGTAAGGATTATTTCAAAGTTTGTATATTG GTTACTCACTAATCGGAAATTGACAATCATGCCCTGGGTTTCGAGTTCCC CTTTTTAATAGCTTCTTAAAGATTACATCATACATTACATCTATGTACCA CGTCAGCAAAATTTACATCACTAAAGGATAAAAAGGGGTAAAAAGGGGTG AATAATTAATGCACCAGAACAATAGATTTAATTGATGGGATAAGACTCTT GGGTAGAATTTGATTCAAACCAGTCCATCCATTTTTATAAGAGCAAACTA TATAACAACATAAGGCTTCGATGGCCAAAATGTTAAGAACAAGTTAAGAA CATTTTAAGGCTTTGTGGACTTTAAAAGGCCATATTTCTCAGTAAAAGGG ACGAAAATACTCACAAAATAGCGAAAATAGGAACATGTTAAGAACATTTT TAGGTACCTCAAAAAAGTTAAGAACATCCGAAGGATGGATGTTTGGATGT TCTTATAAAAAAACGTGAAGCGGCTTATATTTGTCTCAAAAGATAAATCG AGAACTAGGTCTGTTTGGTTTTTAGTTTTGAAATTCAAACATAACAACTT TTTTTGCGAAATAAGAATATTTATCAAATATTGAAAATGCTAATATTTGA TAAGTCTCTCTCTCCCTTAGTGTCAAAATATTATTTCAGGTATTTTCCAG GCTATTTTTCCAGGCTAGATCATGTTTACGGGTAGCAAAAGGTCGCTCAT ATAAAAACGGATGTTAGCTGTTGTAGCCTCACTTTCGTGCAATGATGCTT TGGACCAAATCCGATAATCACGTCATTTGTTTGATTAATCAAAAAGTCAT TAATGATGAAATATGCTTACTCAGGCTATAATCCTTTTGTCAATAAAATG TAATTAAAGCCTAGCCTGATAGCTTGTTAAATTGAAAGTCGAACACAACC TATTATTTGTTAAATGATGGAATTACTCCACTCTCCCACACTGTTATTGA CTTAGTTATTGTCAGTTAGATTATAATTTGTATGACTAATCGCGCTTTGA AACAAGGGTGGAGGGTGATATCATGATATTAATTTTCATGCGATTTGGAA AAAAAGGAGAAATTATATACACAGACACAAGCTAGATCTTCAATTTAGAG TATTCATATATCTGAGAAAAAATAGAAGGAAAAAGTTATAATATGTATTT GAAAAGAAGACTTTGAGAGAAGAAATAATGTGTGAAGGTATAAATCATTG ATTGGAAGGCTTACTTTTTATAACTGTTGGAAAAGCTATACATAGAGCTA CTCAATTGGTTGGGAAAATCCGTGAATAGAAAAGCTGCTATCCAACGAGA AATCTTAACTGTGATCGGAAACAATAGAGAGACTTAGTTCAAAGAAAAAA AATCACAATTTTTTTACGAAAGATTTTATACTGGTTGCGTCTCAGTTGAG AAGAGAGAATTTTTTAAAGAAATATTTTGGTTATGAAATGTCATGTAAGC TGATGACAAATTTATAACAATTTTTTAAGAAGGAGCTTAACACTTTATGA TTGTCGCTTGGTTTTAAAACATTTTGGTACACTATAAACTCGTGGTTTGA AGAATATACCCTCTTGATTGTTAGAAAGAAACTACATTTGATTTTCTTGT TGTGAGAGAGAGTCGACAGTGGTTATAATTTTGACTGAGAAAATTATTAT ATCGTGTTAGTTAGAGGTCAACCGCTAGCTATTTCAAAAACGAAATCTGT AAAAGCGAAAGACTTGTGTTTAATGCCATTTGTGAGTTTATAAGAAAACA CGTAGTCACGCTACCATACTATATATGCATGTGAAATCGCATTTCGTATA AGCGACGAGAAAAAAGGAAATATCAAACAATACAATGAATAGTAAAAGAA CCAATCAGGAGGCGTTGCCTATGGAAACGGATGCAATAAATTGTAGCATC GAAAATAATGAGGATGATGATGATGTTTTTAAACGGTATTACAGTACGAA TGATGTTTTGCTGAGAGTACCGAGTTATAAAAGAACTGCTAATTTTTCAC CTGAACGTTCACGAAAAAGACTGAGTACAAGTTCAAATGATATTACAAAA GCAGAGATTGTGGAGAATAAATTAATATCAAGTATGAAACCACCGAATTC ATTGAATTTGTCTTTATCAGAATCAAGAGAACGATTGGATTTGTTTTCAC CAGATCCTCGAGATACATCAGTGTTATCTTTCATAGAATCAAGACCACAA GTATTGAACCAATATTCATCAGAGCCGAGAGGTGCATTTAATGTAGATTC AAAAACAAGATTGAATTCATCTTTACCAGATCCTCGAGAACCACCATCGA TACAGAGACCTAACCAATTGAATCTATCATTACCAGTTAGTACTGAACCA CAACCTAAAAAACTTTTACATCGTTCAATGTCTTCAAAAGTCGAACGTAA ATGTTATCAACAACGAATGGCCACGGCTCCTACGACACCTTTATTTAGTC CAACGACGCCACAGCGCCAAAAGCGTTTCAGAACACCGACAGTATCGAGA ACGCCGACTCTGTCGTTACGTCATGCTGCTTTAAATCGGACATTTTCGGT TCGCACACCGACTAAACCCGTCATGTTAAGACGTTTGAATTCAGAGACAG GTGGAAGTATTTCACAACTCCACTCTTCACAATTAAATCGTACTTATTCT GGGTTTTTCAAACGTAACAGAGCTGTATCAACTTGTACTATAGCTCAGAC ACCAACTCTTAAACGCAATGGAAGTGTTAGGATTGTCTCCTCTAAAGTCA AGAGATGTCACTCGACGGCTAGTCTACAAAGACGAAAGGTATTTCACTTT CTTTTGATTACGTAGTACCTCTTCCAGTCAACTCTCTCTCTAATTCGAAC CTCTATTACTCGAATCTTTCTGTAATTCGACCTAAAAAGATTAGGTCCGC TCGACCTAGAAAGTCGTATAAAATACTCTCCGTAATTCGAATCTTTCTAT AATTCGAAAAGAATTCTTGGTCCCTTGAAGATCGAATTAGAGAGAATCAG ATGTAGTACTATAGTTTGACACATATCGATTACGAATTTTATCGGATTAT AATAATCTAATTAGTTGCTAGTTAGTTAGTTTCCCGAAAGAAGCTTTTTT AAGTTAATTGGAGCTGTAGTATTTTTGACAGGTTTTTATGAACACAAGCT GGGAATTCGGTAAAATATAATCCAGTTTGAGTCTAATATAATCTAGTGAA TGCAGTTCGCGAAAATGATTTTCCTTCACTACTGTATAATGAAGTACTAT AAAATCCGTTGATATGATGATTTCTGTAAAGTAAACAAAATTTAACCAAT GAATTTTCGCTCACAGTGAAAAAGTTACAACAACCTAAATATTACATTAA ATAAATGGTATTAAATTATGCGGTATGTTGCGTGTCAGATGAATTATAAA GAGTGATTTAAGATGACATATTGATTATGATCTGATTGACGAAATACTGT TTCATGCATAAAGATCTTTATCATCAACGTCTTTCAACAACAGAGATGTC TCGTGTGAACTTTTCTACTCTTACGTCTAGCCTCACGTAGTCAAATACCA TCATCTTTGAACTAAACACCAACGCCAACACCCTAGCTCTTTCTCTCTTT TAACATATAAAATGCATAATGCTTTTCAGATTCGTTGGTTCAATAGCACC CACTGGTTTTAGACTAACCTAGACTCGATTTCTATGATCTTAGCAATAAT TCCCATAACGCTAGACTCGATTTTTCATGATCTTAGCACCAATCCTATCA TAACAATATAATTTCCACGACCCTAAAATTACAACTCAAACAATAAGAGT TGTTTTTAATAGTTTAAAGAAGATTTGTGATCTTCGAAAGTCTCCTGGAG ATCAATTAGTCGCCTACTGTCCACGATTTGATTGGTTCAAAAGCAATTAG GATCGACTACTGATTCTAGATTTGCTCCATTGGAAGTCCATTTGTCTCAA CGTCAGACTCAAGTTTCAATTACTTTAAGCCACGTTTGATAACCTTTAAA ATCTCTAAATATGTTTTAAGACCTCTTATTCTAATCTATTGGATATTAAC AAGTTAGGAAACAAATTGATAGACAAATCTATTTGATATTATGACCCTTG ACCTCAATGATTAAACTTAGAGTGAATTTTAGGAATTCAAGTAATGTTTT AAATTCAAGCAAATTCGTTAAACTTCTTACAAAATCATAATGTAAGCATT CAACCGCGTTCCCTGCGTATTATCAGCTTTTTTATGCTTACTAATAGCGC TAGATGATATTCTCTGGCGTCAATCAGTAACGTTAATATAAAGCCTGGGA TACACGGGGACGAGGTTGGTTAGCATCGTGTTTTAAATCTACCAAGTATT ATAACAGCAGTCAGGAAGTATACAACACACTTCATCAGACACACCAGAAA TTGGATATTTGAACACAATCACCTGTCACCTGTCACCTGTCAGCAGCAGA AATCAATCATTATATAATACACGTTAATTTATCAGAACAACTATATAAGA ACATAAGGCTTCGACAGTCGAAAATTAAGAACAAGTTGAGAACATTTTAA GGACTTTGTTGACTCTAAAACACCCAATGTTTTAGAGAAATAAACAAAAA CACTTAAAAAACCTTGAAAATAAGAACAATTTCAGACAGTATCTTTAGGC TTAAAACTAAAAAAGTTAAACATATATTCGAAGGCTTCGAAAACTTCCAA GTTCTTATGAAAAAAAACGTGTATTCCTCTGAAAGAAATTACAATCACCA AATCACTTTTTCAAATTGATAGAATGATACCGGAAAACACGTAACAGCAG TTGACCGGACTTGCAAAATACTTTCGGAAGACGTCGTTGTTACAAATTGT GTACAATCAATTTGTTTCACTCAACCTTTCCTTTGTTGTAAAACATAAAT GCATGATGCATTTCTAATTTTAGGGAAAATACATAATTCTTAGTGGTTAC CATTTTGGATTCTCGATGATTTGACCTTTGAAGAAGTCTTTTAACCTTAA CGTAATGTCAAAACCAGACCTTCACAGTTAAACATGGTAATTGACTCATT TACAAAATATTTCTAGATTGATAGGCATATACAAGTTTTTTATAAGAACA TCAAAAATTTTCGTAACTTTTTGAGTTTTAAACCTCTAAAATGTTCTTAA AATGTTCTTATTTTTGCCATTTTTTGACCAATTTTACCGTTTTCCTAAGA AATCGGGTGTTTTTGAGTCAATGAAGCCTTAAAATGTTCTTAACTTGTTC TTAACATTTTGCCCATCGAAGCCTTTTGTTATTATATAGTTGTGTTCTTA TAAAAAACGTGTAGCAGACATCCCACAAACATCATGTATTCTCATTATCA TAATTTAAAAACACCACTTATTCATTTTCGTTTTAATTGTAGTCAAAAAT AGTAATTCTNCTCATTATCATAATTTAAAAACACCACTTATTCATTTTCG TTTTAATTGTAATCAAAAATAGTAATTCTATATTATCAAATGCTTCATTG TTGTCATTTGTTTGCGAAAATGTAAGCAAGCAAACGCATAAAGAAACTCC ACTCCTAAATTCCTTTCCAACAAGTAACTTAAACCTAGGTTTATGTGAAC AAATCCAAATATCAAAGCAGTAAATTCAGACCCACAAAATTGCACTCGAC TATGCAAATCAAGTTTTCAAAAAATTGATTGATTGATTTTTCTTAAAAGT GTGATGACCACTTCAATATACCACTTGAAATATGTCAAATTATTTCAAAA ATTTACCAAATACTTGAAGTACCTCTTTATTAACCTTATTTTGACCTCTC CTCGAATCTTATTGTTTACTTTGGAATGAACCGATAGCAAAGCTTTCTCA GGCCTGTCTTGTTGGCTCTTACCGTCACGTCAATCCTTTAAAAAGTGCTT TGGATATTCGGCGGAGAAACTTTTTTTCCTGCAGTATGGAAACCACTCCT AGGGAGTCTAATTGCAAACACGTTTTTCATACAAGGAACACGTTTGGCTG AAAAATGGTCCGAAAAATAAGAAATTGTTAAGGAACTGCTCAGGCTGTGA ATAAGAAAACAAGTTAAGGAATAGTAAGATTTAAACTTGAACTTGTCACA TTTACAAAAGCCTAAACAAAAAGCTGACAAATATTGACGAAACAACTTTC AGTAAACGTCTTTTTATGTACTGTGGTTCATTTTTAAAGTTACATACTTA GAAAAGCCAATCTTAGCAGCTAAGTAAATAAGGAACTTGATAAGGAATTT TGAAGCTGAAATTCTCTGGAAAAATAACGAACTCCAGGCTCGGAGCCAAG TTAAGGTTCTTTATAAAAAGAAAACGTGTACGCTTAAATAGTTTCTGCAT GGTACAGTAGTAGTGATGAGTGCACACTTGCTTAAAATAAAATGGAATTT TAATACTTTGGTGTTTCAATAAAATTTCAGGCTATCCGACCCCAGTTATT TAAACAAGAAAACTACCTTATTACACGAATATTACAAGTCATTTTACTAA CACGAATTGAAAAATTTCGTGTTAGTAAAAACCCCCTTAATTAAAACCAG CTGTGGTGTCCTTGAAAAAGCTAATAAAATTCGTGTTAATTTTTTGGGTG TTAGTTTCAAGGCCGTTTAATACTTGTCTAGTAATATTCGTGTAATAAGG TGAAAATTCTTCCTAGAAACAGAAAAGTAAATTTTAAGTATGTTTAGATT CAATATTTAGACTGTGTGAAGAAAATTGTAACAAAATCCTTACTTGCTGT GTGGTGCGAGAATTTACTAAAATATTATCGATAACTGTTTGACAAGTCTT AAACTTGCAATATTGTTTTTGTTACAATTTGAAAGTTCAAAAATATTTTT GTTTGTTTTGACAGCCTCTCTTTCAAACCTCAAACCGTTAAATAAATATA CAAACAATTTTAAGCCCTTTGTTTTTTAGTTGTTGGGAAAATAGGTATGC AAATATAGAACTAGTTACAAAGTTTTTCTTGTATTTGATTTAAGTATCAA GTTGATTTTGTCAATTTAGATTTTATACAGGTGACTCGGTAGTTTTTTTG TCAGAGCTTGGAGTAGCTTTTTGTGGTTTCTTTGTATGTGTACCAATTTT GAGTTTTAGTAAAAGAACTACAATCGAAAGCAGCCGGCGAGGCGACCTTT TTTCTGATGTGTTCTGAGAGTATCTTTCAGCTAGAAATCTTGATCTGTTC TGATAGGATCTTCTTAAAATCAAACAGCTAGAAATGGTGATGTGTTCGGA CGAGATAAGGTTATAATCAAAGTTGTCGAACATGTTTTTGTTGTCTAGGT AACCCTAGGAACACATATTTCTAAAAAATTGCTTCGCCGGCTACTTCTGT AAAACCAAGTGGTAAATTTAAAATCTAGTCTGAGATCTAAGTTTTTCATC ACGAAATTCAACTACTTGATTGTCCATATTGTGATATTATATGACCGTTT TTCGTCGTCTCTCAAGAGGTGAAAAATTTCAGGATCAACTGGATCTCAAT TAAAAAATGTATCGCTATCTTTTCAAGTGGATGAAACTTTAAGTGTCATT TGGAATTTCAAGCACTTGATTTGTGAAGGATTTCGCTTATAGATTCACCT ACAAGTCATTAATTTGTGTATGTTAAGAATTAAGAATTATTTTTAATTTC AAAAACCATAACAAGTAGTGGATCGAGAAAGAAAACATACTTTAAGGTTT TCCTTTTTCCTTCAAAATGTCATATCTTTGGATAAACATCCGTGGAGAGG GGAGAGCATCATTAGTTTTGGACATTCGAGAATACTGAAAACCCTCCACC GGCTGGCGCTCAATAAGTCAAACAGAGTAACTATATTTCAGAGACCAAAC GTAGAAGAGCATCTTTATCTCCTTGAGGCTCCTTTTTCAAGTATTTCCCC TCCATCTGAACGATCTTTTTGAAGACTTGAAGAAATATCTAATAATCGAT GAAACGATTTATAGAAATTTCGGATAGTTTGATGAGATGAATTTTTTATT GCTTGACAAACTGTGTCATTAACTGCTTGAGCACGCGACAGAGCATGTAG ACATTGCTTATCGATCTCTGATAGTTGATATATATCACGAACTAAGACTT TTGATCATTTCTAACATGGAATGCAATTTTTTGAGAGCTTAAAATTCTAC CTTGTCTCGTATTTTTTAATTTGTCGAATTTTCTGAATGGAGTAATAGCC AAATTAATTAACCAAGCTGGTACATAACATTGTTTCAACGTCCATCCAAC GTCATTTGAACGATAAAAACGTCAAATGGACATTCAAAAAACGTTCTGTA CCAGCTTTATTTATTAATTTATTTGCCCACATCTAGTCGTTCTCACCATC TTAAGTAGTTTTGAGGTATGACTTTAAGTTTTTGGAAAACAAGCAAGAGA CATTTGAAAAATCTCACGTCGTTGGTTTAGTTTGCACCTAGTTTATAACA TGATTTATTAGTCTGTTGAAAAAAGGGTCTGTTGATTTTTTTCACTTGAC AACATTTCTATTACCTCAACGATATAATTCTAGATGTCTCGTAAAAAATT GTGTATCTTTCGATAAAATGGAAACTACTTGTGGAGCTTGGGTGAATTAT CAGGACGAAACTTTCAATTTCTTTTACACGTTCCATTAAGAGGACTTGCT TGGCTTGTTTGATATCTATACGTTTTTTATAAGAACAAACTATATAAGAA CATAAAGCCTCGATGGTCAAAATGTTAAGAACATTTTAAAAACATTTGAC TTTGTAGACTCGAAAACACCCAATTTTTTGGAAAAGGAAGTCACAGAATG GTCACAGAATGGAGAAAGAAGAACATCTTAAGAAAATTTTTAAGCTTCAA ACCCAAAAGGTTAGGAACATTTGAAGGCTTCAAAAATTTTGTTGTTCTTA TAAAAAACATGTATTGATGTAGATTCATCTTTGTATAAGTACGAATCTTC AAGGGGTCATTTTTCCTTCAAAATGACATTCGTTTTGAGGTCACATGATC AAAGGGTCTTAGTAACGTTTTTGGGGTTTGTCCCATACGTTGTTTGTTTA TAGCTGTTACACAACACTAAAGTTCTTCATTATTTTTTGCCGTTTTCGCA TCCCATTCATTTATTGTGTCCCTTTTTGAAATGAAAGGACCATTTTTCAC ACTCGTGTACCAAGTTGATTCAAATCCCTATAAAATAGAAATAAAATTGA TGTAGTTTGTTTGTCCAGTTTGTCCACTGCAAAATGTATTCACTATTGTT CCTATATTGCCTTGTTCTAAATGAGATGGTCTTCTTTTGAATGTCATTTG TACGTCTAAAAGACGTTAACAGCATTTTGAAGACATCTTTTTCGCGTTCG AAGGAAAGTGCTCTTCTTTGCCAGTCTTTCNACAGCATTTTGAAGACATC TTTTTCGCGTTCGAAGGAAATTGCTTTTCTTGCCAGTCTTTTACTGTTGG GTTTACGCGACTTTTTTCCGCAACTTTTTTTTTGACTCCTTTTTATTTTG TCACACTGGTATTAGATGAACGTCAATGAAGACTCCATCATCTATGCTTT CAATGTGGAGATTCAACGTCATTAATATTGACATAATCATGACATGAAAA TTATTCTCGTGGCCTGCGAATTGCTTAATTTTTCTTAAAGTTTTGATAAA TTTGGAGTGGATTTGAGATTTGGAATCAATCATAAAATGATTGTCTTCTC TAAGTGTTTGATTATTTTTTTGATCAGCGTTATGTCATCACCTTAGGGTT GTTGAAGTGTCTGATTTGACACGGCTTCAAAAATAGATTGAGATTTTAAG AGATCTGAGAGATTAATGTATTTCTTGGACTTATATAACAGAGGCTTTAG CAAAGAAAAATCGAGGATAAATGGTACTGTAATAGCATTGTGAAAATTTG AAGTAAAAAGAAAATTAAATCAAATCTTTATGCATGGCTACTGCAATGGT TGAACCAAGCTCCTTGGTTGAGCATGGTCCTCCCATGGACCTGCCCGCTC ACTTCTTGAAAAATCGGGTCCAACTGGACACTCGAAGGGCCACAATAATG CCCGGCGCGTCGCCGAGGACTGGATTGAGAGGATTACGAGTTGAGCGGAG CCGTCGGTTGGAGACACGCCGAGGAACTTTGTTGGGTGCCGTCATCAAGT TTGAAGCAGAACAGGTTTGACTGAATATCCGTATTAGTTACAGTTAGCTC TCTCTATTTCGAACCACTGGTATTCGAATCTCTCTGTAATTCGAACTATT TGTTCCCTCTGCTGTAAAAAAACGTATAAAATACTGTTCGTAATCTGAAT CTTTCTATGTAATTGGAAGAAAACTTTTGAACATCGAATTAGAGAGAGTC AACTTTACAGGCTCGATCCTAGCTGACACAAACGTCCTTCGAATGTCCAT ATACCGTGTACCGGTTTGAATGACCTTATGAGCATATCGAGGCTTGGAAA CAACGCCTTAAGCCTCGAAACCGAAAACAGCAGTTTTTCCAGGGCTATTA TTTCCACCGCGCTTTTACTTTCGACGGACTATTAGCGCTAAAGTCATAAA AGGGAACTAGGTCTACAAAAATGAAGATGACCTTAGTGCTCTTAAATGTT ATGATCAATAAGAGATCTAGATCCAGTAAATTTATGAGACTCGGCTGTTC TTATCTCTGTGGCACTTAGCCTAAAATTATCCTGTAATCTCTAGGCAAAA ATCGGGGTATTTTAGATTTGATAATCTATTATCTTATACCATTTTGACCC TGAATAGCTTAAAAATCAGCCATTATCCAAATTCTGGAGCCGCTCGCTGC GCTGCAGTTGATGTGCGTGTCGGGACAAAAATCGAGGCGGAAGCTATTTT GTTTACCTTTTGGCTGGGGAAGCACTGCAAAACAGTGCTTTTTGAGTAGA TTTGGTGATTCTTGGGAAGAAAGAAGAAGAATACTACTTGGAACCAACAT CAAATGTATTGGAATAGACTTCTATCATACATTGGAATAAAAGACAATAC TTTTTGAACATAATGAATGTGTGACCAAAATAAAAATGGTGAAAATAAGA ACATGTTACTAGAACATTTTTAGGCTTGAAACTCAAAAAGTTAAGAACAT CCGAATGCCCCAAAAAATTTGGATGTTCTTATGAAAAAACGTGTTTAAGG ATAAGGAGAGTAACATTTCAAATCATCGATCTTTAACGATAATTTAGTTT TTCGAGACATCTCGCCTGCTATCTTTCAACCTCTATGAAAAGGTTTTATC AAAATGAGATATCATTTTAAATTCTCCAGTTTGTAGCATTAGTCCGAAGT TTAAAATTTATAGGTCTCTTTTAAACGTCATATACCATATACAGTTAGAT AGAAAAATTCATCTCTTGCTCAAATCTAAAACAAGAGAAAGCAAGGAAAC AAAGAGTTATTATTTAGCGAATCGACGAAACTCATAGACTAGTATACAAC AGTAGCGCGGTTTAGAATTTCGCTTAGCTGAAGAGAACTTCGTTTCAAAA CTTTGTTTCAACATTGTAGTGCTATATTGATATAGTAGCTTTTGTTTTAA AAAATTTCCATCGTACAAACTGTATAGAAGAAAGATTTTTTTTTATTTGT TCGTCCTTCTGTGTTTGTTGATGGGTCACAGAGACCTAAATTAGTGCGGG CAAAATTCGATAGATGTTATGTTCAATAATAAGTGGTTTGTTGTTGTGGC TGATATATAAACTTGCGGTCACGGACATTTTTAAAATCCTCAATCTCCCG CATGTTGTCGCCTCTCCGGATCAGAAAAGAACAGGAAAACTAATCTATTT GGATGGAAAAAAAACTGGTAACGAACAGGAATCTTAGAGGCATGGTAACG AATTTGATAATAATCGATCGGTTGGAGTAAACAGACGTTGGTTGCTTGCA AACAAACAAAGTGAAAAACTAAACGGTGTGTTTTAGAGAATAAAAGAAAA AGAGAGAAAAATTTGTGTTGTGTTAGTTTAGTATATGATGTCTACTTCTT CAGAGACGAAAGCATCAACAAGCACAGTACGTCCAAAGACGAAACTCAAA GCTACCAAGAGTCTACCAGCTTTTCAATCAAGGCGTGCATCGAATGAAAA TGAAGAGGAGGCTACATTACGTAATCAAAACAAACCAACTTCACGTCCTC GTTTACAATCAAAAACAAGTTTGAAATTCAACGAAGGGTTAAGGAAACAA GCTTCAGTCGACTTCACACGTGCAAGACCTCGGGTTTACAGTAAATCAAA AGACGTTCCTTTAATTCTGGTGGAGCAGCCAAGACAAGAGGAGAAACGCA CCATCAGGCCAGAAATGGTACATAGACTCAGTCGACCTCTCAAACGACAG TCAACACTGGATACTATAAAAGACGACGATGTTTTCAAAGAAACTGAAAA AGAATGGCGAATACACGGTTCGGAAAGCACGCAATCATTCCCAAACGTAC CAACGGTAAAACGTAAAACTTCAACGTCACAACGCCAACGTAGTTCTTCT TCGTCTTCGTCACAACGTAAAATATCACGTCAAAATAATTTCTCAATGGT CGGCGGCAAAAGAAATTCAATACGTATACGAAAGAGTTCCAAAGTTTTAG TGAAACAACCAACGTTAGATTCAATCCCTGATAATGGGATACCGACTAGT TACCAATCGCGATACGGTGTTCGGAGAAGCACCTTGGCTACTTCTTTACC AAAGGTATTTCATCTCATAAATTCCTATCCAGGGTGATCCAGGGTCGGTC AAAGAGTACAGAAGTTTTTTAACTGCTTGTATTGAGTGAAATATTATCTT TTAATGAGCTAGGTCATTGTTCTTAGCAGCATTAGTCTTTAACTTAGTCT CATAGCTCTTATTTAGCCCAGTCCAATGGTAAGGGAGAATAAGTTTGGTT AAAATGTTTATTTATGACTTTCGTTTGAAATTTAATTTAATGTCAGGATT ACAGGAAAATCTGAAAAACCTGATGACGTTTATTGAGGTCAAATATCCAA AAATAGGAGGCACTGTATCTCAAACTAATTTGTTTAATTTCTGCATGATG TGGTAGGGCTTCATTAAGTCTTCAGTTGTATAATTATAATGACTTAGTAA TTAATCTTCGATATCAGTTTTTAGATGTAAGCCTTATTAGGGTATTTTGT GAAAGAGGAAGTTTTAAATTATTGCGAAAAGATATCTTTCTGTAAGTTAA ACTCTATGGAGATAGATCATGCGTCAGGACGAAATCCAAGCTATACATTT ACTTTTATAATGACGTTTTTCTGTAGCGGAGTATTTTCTTTTGATATTGA GCACGTTTTAAAAATGCCATGTTTGCATTTAGATTATTTGAGATTTTGAA ATCTTCAGATTTTAGCTCATTCATATTTTCTGGAAAGTGTTTTTTTTCGA ATTTCAGAAATTATTTTCGTTTTAATAATCATTTGTAGTCCAAACTTCAT TTAGGAGTCAGAAAATCATTCTATGACATAACAAAAAGCACAACGAGTTG ACTTATTATCTCATGACTATGATGTTTATTTTTGGTCTATATGTCTGTTG TCAATACGTAACAAAAGATTGTAAAGATTCTAATGTCAACAATATTAGTC CACTTTCCTTTTAACAAAATTCATCAATATTTGTGTCCGGTCATACGATC TCTGTCAAGAAACTGTCTCCTTGAAATTAGTAATATGCCCAATATCCTTT CTTCAAAATGCTGGTTTTACCGCAATGCATCTTTCAAATAACTTCACTTT TTGCCAATGTCGAGTATATTCGACAAAGGACTGTTTTCCTATGAATGTTA AAGATAAAGGCTTGTTTGACTATTAAACTAGATTCATAAATCAGGGACCT CAGGCTACACCGTAAGTTGGTTTAGTGTCGACAACCTCATTTTAATCCCG ACACCCTTCTGAAGGGATGAGAAACAAAAAAGGAAAAAAAAAATGGCGGA ATCGCCAATTGTTGTTATCTCTTAAAAAATGTTGACGAAAAAAGAGTAGG TTTACGGTTCCTTCTACCTATTCTCGAATTATCTCTCAGATGATTTGAAT CATAGATAAATGATGGTCAAATTTATGTAGCCACTCGTAATGACTTAATT TCGTTAAACTTTTAAAATCCTTATCTATAAGTTCAAATCAAATAGGGCAT GACTTTGTGGGTTAATTGAGGTCAAAAACCCATTAATCTAATACATCAAA CTGTGGTCTACCAGTTGACAAACTTTTCACTATTTTTGTTATAAAATCAT AAACAAAACTTGACTATGTAAAACTAAGTTATGTCGCCAAACTCTCACAA TCACCCCTTGTAGACCTGCATAATGGGTATAATGTAAAGCCCTATATATA ACACTATGTAATACGTGATATAAAACAAGATATTTTAAGATGAGATTATT ACTTCGTTTTAGGTCAGCAGGTTTGAATTTTGAAGTTATGGGGGTGTCGA GACTAGAACTATTTAACACAATTGTGTTTATCTTATTCATTACCATGTCT AACTGATTCGCGTCAAAGCAAGCTTTAATACCATATGACCTTATCATGGG AAATTGATAGACCTTATTACTAGAAGAAGAAAAAACAGTGTAGGGGACTA GCAGACAAACATGCAAACAATCCATAGGGTTTTAAAGTAGCTCTTTGCAG TAGGTACCCATGCTATAATCCGTAATAATAACAAAGAGTCTAAGATTTTT TTTTCTACAGAATGAAAAAATTTAATTGGATAATGATTAATACCTTTAAA AAGATGGCCCTTAAAACCCGTATATAAGACAATAGGGTTTTTCTCTTTTT AAGAGATAGTAATTATTGCCTTTTAATAAAAATTCTTGTAAAAAAAGATC TCTCCTCTCTATTGCTTTAGTGGCCTACCATCGATTATTTAATGCCCAGT TGGAGGGTAGATCACTCTCAACAATCCTTAATAAAAATTATAATCATTAA AAAAATCAAAAAAGGATAAATAAATAGTAGAGAAGAGCATTTTTTAAAGA ATTATAAAAATTTATAAAGCGAAATAGAGAAGGTTTAGCATAATTGCTGT ATGCGTTCAAAGGTTACGTTGGTTTATGGTATTTTAAGAAACATAACGCT TGTTATGGTGTTGAGATACTACAACGATTAATTTTATGAAAAATTATGAG AGATCGAACTTTAAAACGACAAAGGAAGTTTAGTGTAGTTGAAAACACTA GACATTTAACAGTACCTACGTTAGAGCATTATGGAGAAAATTTCGAACGT CCATTATATGATTCAAGAAGTAAAGAGTCACCGAAAAGGTTACGAGCGTC AGCTACCAGTACGCCTTCACCCGCTACTAGATCGCGTAGCATTAGTGTTG GGATAAGACCTTTTGGTCTCAGTCAAGCGCTTGAGTTACCGACAGATTTC GATGAAGAGTTTCATAAGGATTTTTCTTCACTTAAGGTTGCTGTTGGACG TAAAACATCAACGACTTTCCAAAGAAAACAGAGACGATGCAGTGAGGTGA GTGATTTATTTTTTCTTCTCTCAAATTCGAGTTATACCGAGTATACTAAC TCGGCTCAACGATATTTCTTTACTGGTCCAAATGTACAGAAGGCTTAAGA TCTCCGAAAATCTCACAATGTAACCTTAGAATTCTATCACTTAATCCATA ATCGACTCTTTTGGCATTCTGTAATATGGTGTTAGATTGACCTAACAGGA AATCGGTATCTGATTCTTTGTTACATAACTCAGATGTAAGAGTTAAGACC CCCTCTTCTTGTTTCAGCTGTACATATGGAGTAGAATTTCAGATACCCTA AGTAGAAATTCGCTCAAACCAACTCTCCGGAAGTTCACTGTGGAATAAAA AGAAGTTGAAAACCCACTCAAGATTTCAGTAAACAAGAAAAAGATTTACT AATTTTATTGATTGAATTTTTCATATGTTTCTTGTACAGCCTTTCCTGTT AGATTCATTATCCTTGCAAGGTCTTGGAGGTGCTGGTAACAACAAATGGA ATCGAAAACAATCGACATCAAATGGTCGAGTAAAACGACGTTTATCCACA GCTGGAGGTTCGTTCGTTTCAATGTTTTTGTTTTTTTTTGTTTTCAGGAT GAAATTTTAGTTCAATTTGTACAGAACTACCGATTACAATGGTCTCAAAA GGCGACCCTTTTCTTCGTGTCTTCGTAGAAGGGGGCGGACAAGGGTGGGA GATACAGTACAACTTTGAAACTGTTGAATATTCCAGAGATTTCAAGAATG TAATCAAAGATATTGCTGACGTTATATAATATAGCTCTGTTCGGCTCTAA TTAATTTTTAATCAGTTTGACATCAAATTAGGAATTAAGGGATCCGGTCC TTACAATGAAAATAAAACAAGCAAACGGGATAATCTATCATGATACCTTA TAAGAGGGTTGATATTTAATTTCTATGTTTGTGTTAGGGAAAGGGAAAGT TTATGTAGTGTTCCTTAAAACTAATGAGTAATTAACGTCCGTCGTCCCGT GGTGCTATTCAATGTTTTTTTTAACTGACTGTTATTACCTGACCAACGAA AACACCTTCATTTAGACATAACCGCCTTAGATTAGGTTTTCTCACGAATC AAGCGTACAGTTATTTCAGGCTGTTGAATGAAAAAAACCACTAACAATAT TTTAGGCGTGGTTTCCACCAACTATCACTCTCTACAATAGGGGTGCTATT AGCTCTATCGCGCTGATAGAAACCACGCTTTTGTCATACAAGATAATATA CACTTTCAAGTTTTTTTGTACTGAAGGCAAGGGCAAATTAATCAAAAGTT ATATTTTTGTCATATTTTCAGTCTTACCAGCATCAAGCAAACAAAAACTA CAAGCACTAGCTAAAGATGAATTATTGGCTAGTTTGAATGTACCGCTATC GAATGCACCTGAAATCACGGTCGACGATGAAGAGGTCTTGGACGAGTTGG TTGATTCTGAAAACGAGGCTATCGAAGAAAGCGATGAGAAGAAAGCACAA ATTGAAAAAGAAAGGAGGGAAACGAAACGATTATTGATCATCGAGGAAAT CTTGGAGACGGAAAAGAATTATATTTCTTGTTTGGGAACTCTCGATTTGG TAAGCATTTAGGTCATTGCTTTCTCTTTTCTTTAGCACACATAAAAATTT CATCTATCTAATACATTTTACTAATTCCCTTAAAAATCTAACCTGAAAAT TGTAAAGGCCTACGTAATTAAATTCAACATTCCATCCAAGGAAAGCATTT TCGCCGACCTTAACTACGCTGAAGTTTACGCAAAGTTTACGCAAATATTG ATGTATATTCATTCTCTTCTTCAATATATCAGGTCTTCAGATCACACTTA AAAGATGCCAACATCATCACCGAGAAAGACTTGAACTCATTATTCCCATC ACACTTGCAAGACATCAAACAAGCACATGCTCTCTTCATGGAAGATCTCG AAGAACGAATGAATAACGATGATTGGCGAGGAATTATCGGTGATATTTTC GCTAAAATGACGTCAGCGTCGGTCAATCTTCTCGAGATGTATACAATGTA TGTGAATTCGTTCCCCAAAGCCATCAGCACATTGAGTAAATGTACAAGAT CGTCTGGCAAATTCCGCAAATTTCTAGAGGTAAGTACTATTGATGGTTCT CTCGATTAAGAATTTGTCTTTGGTGATTCTTCATCAATCTGATCAATCTC CTTGATAGACTTTTATATGAGTCAGAATTCAAATTTTGTGACATATAGTA ATAACCTAGATCTCAAGGCACCACTCTACTACAGAAATGTCGAGGTGTCT GTATGTCTATATTTGAAAATAAAAGGACATGAAAAATTTGATCGAAATTA TCATTGCATTAACAGGGAGGGGGGGTTTGTAGGGGTTCGAAATACCGTTT TCCCGTCAAAATTTTTGCTGAATCCCGGAATCCCGAAAATTGAAAAAATA ATAACACCGTCACACCGGCTTGTGCAGGGCAAAAATGTACCTAAATCCCG TTTTCATCATATTCTGTTTTCATTCCAGGATTGTTATGAGAATCCGGTGG TGGAAAGATTAGATCTGCCATCTTTCTTACTCTCTCCTGTACAACGGTTA CCAAGATACATCTTATTACTTCGAGTAAGTATCTATTTATTAACGTATTG TGAAGAATGATTAAATTAAGGTCTGTTTTAGATGTTTAGATTTACGACTT TTGTGGGCGATTCTGTTGAAAATGCAATGGAAAATTGTGTCCCGAATATA GCAAAGCCTATCAAAAACTCTTTTATCAACTAGCTAAGATCAAAGAACTT CTTTTTTGCTGCAAATACAAATTCCTATCATCCTACCGTCCTTTAGTCGG ATTTAGATATCTGATACTTGGAGAATATTAAAATTTTTTCTTTATTACTT TCACAGGAATTATTAAAATACACAGACGAAGATCATCCAGATTGTTACTT CATTAGTCAAGCCATGAAAGAAATGGAATCTCTCATATCCTCACTTAACA GTTCAATCCACCAATCAATGGAATTCTACTCGGCAAGTGAAACCAGGCGT AAAAAGATGTCAAGGCAGTTCACTTCTAAGAAAAGAAAACAAAGAGCGTC TTCCACCATTTTAAGGTATATTACATAACAAATAATTTACAATAATTTTA GAAGACCAAATGTGGGAATGACCTATCAAAGCCAATCTTTATGAATATAT GAAGCGGTTTGTGATCTAAAGTTTTTTTACCAACTGGAAATTAAGACCAT TCGTTTCTATCCATCTTTAATTCCCAAATAAGAATAAGGTCGAGTTTTCT TACCACACGGTCAAGTGTGAGTTGTAGCCAATTCGAGTGTAAAGCTTTTA AGTGAAACGGGGGAATCAAATTGATCCTTAATAGAAAAAGAACATGGACC TAGAATTATCATTTTAAGCATTTTAAGCAAATAACACAAATATTCATTCT TCACTTTCGATTTTTTCCATGCAGGAACAACAAAAACATGAAACCAGTTT CCGAAAATAAATCCGATAACGACCAAGGTTATTGTAGTTTTGGTGAACGG AAAGATGAATCACCCGAAGATGAATCCGGACGGAAGCCCCGATCATCATC AACACTTAAAAACCATCCCGGTAAACGCTCAATGTCGGTCATTTCGAACG CCAGTGATGACTCAACAAAACAAGTCATTCGACGTAAAAATGATTTACAA CTAACAGGGCGAAATACAGACACCAGAAAATCGTAAGTAATTTACTTTAT TATTTCTTCTTTCGGTGTGATTCCACTTGTAAAAAAATTCTAACAATTCA CAATATTTACCTCGAGATTTTCTAATCTGAAGCTCACTAAAATCCATCTT GGTGATACCTTTCTAAAAAAGCGGCGTTATCATTTGACGGAAAAATTTCT ATTAGAAACAGTCTCCATACTGTACGGAGAGAAATATATTTAGAGTATAG TGTATGTAAAATATTTCCATATTTTTTCTTTTGGTAGATGGCGACGTTCG ATCGGTGCAGTCTTTTCACATCTCTGGTCAAATAAAGATGGCGAAGAAAC TTCCTCACAAATGGATACTTCAGACAATTTAGACNCTCTGGTCAAACAAA GATGGCGAAGAAACTTCCTCACAAATGGATACTTCAGACAATTTAGACAT TACGTCATTAAATGAAAATAGAGGTTCACAGGACCATATAGACGGAATCC CGTCAAATTCTACGCCGTATAACCGTAAGAACAGTTCGGTAAAACGTAAA CACGCAATCGCGTTACCGTCGCCGATGATCGAGGAAGTCGATTCTTCTTC CGATTCGCCGAGACTTGCGATGGAAAATTCTGTATTAGACGGAAATGAGA ATATACAACAGATAAATACTTTAGTTGAAAACACGACATTAAACGATACG GAAATATCGACGTCTCCGGTCGGTGAAATGGATATTCCGCTTTGCGTCGT ATCCGATGACGACTGTGACCGTAAAAATTCGACGGAATCGGAACGTTCTA ATACTGCATCGCCTTCTTCACTAAAGACCCCTCCCTCTCCGCAAAACTTT CGTCGAAACGGCCGTCTACGTGGTAGCGCTGGTCCCGTGTTTAAATCTAT ATTTCAAAAGAACAGTACTAAAATGCAGAAAACAGTTTCCATGGATGCGT TAAATACAAACAAATACAGTGAACAGGACGATAAAAAGAAACAGCGGGCG CTTAAAAAGCGGAACAAAGAACTACATAAGAGTGCAACAGTTATCGCACA AAGGACTACAGTTGAGAGTGGTTATCCAATAGTAAAATCTTTGTCTTCAT GTAACATCTCACACGAAGATAGCCAATCGGTGTCCTCCTCAGAGACTATT TCAAGTAAAACATCAGGCAGTGTTAAAGAAGAGCAAGACGGTGGAGAGAA TTACGTCATCACTGAAAATAATAACAAATTTGTGAAATCAAAGACTGAAC GTAAAAGTAAAATTTTCAAAACACTAAAATCGTTTGTTGGGAAGAAATGA ATGGTATTTTTTATGAATGAATAGTTGATAGTTTATTATATTACACGCGA GAAAGCAATTTTGATAGTACGAACAGATTATGCATCAATCCCTGTTCTAG GCAATTAATAACGCAATATCTGATCAAATGACATATCATAGAATACTTGG TTTACCATAGAAACACAAGGCTGACTAAGTAATGGGTTTACCAAACCATA TTTGTATAAATTTTAGAGTGAATTTTACGGTCTTCCTTTCTCTTTTCTTG GATGAATGAAAGGTTCGAAAACAAAGAAATGACTTAGAAAAGCTTAGTTT TAGTTTTCGTTACATCATGTTGAACTATCAATTACGGCTTTCAATATCAA AATCTTGTTAATACAAATACATTTTTCAGAATATTTTTTTTTGATAATTT ATAGTTTAAAGAATTATATACGATAAAGCTGGCCCTGTCGTAAAGTTTTT TCTTCACAAAAGGGTTTTTATTCAAGTCGTTTTTAGTATATAGGAATGCT ACGTGTTCTTCATTTCCNATCGGAACGTTCTAATACTGCATCGCCTTCTT CACTAAAGACCCCTCCCTCTCCGCAAAACTTTCGTCGAAACGGCCGTCTA CGTGGTAGCGCTGGTCCCGTGTTTAAATCTATATTTCAAAAGAACAGTAC TAAAATGCAGAAAACAGTTTCCATGGATGCGTTAAATACAAACAAATACA GTGAACAGGACGATAAAAAGAAACAGCGGGCGCTTAAAAAGCGGAACAAA GAACTACATAAGAGTGCAACAGTTATCGCACAAAGGACTACAGTTGAGAG TGGTTATCCAATAGTAAAATCTTTGTCTTCGTGTAACATCTCACACGAAG ATAGCCAATCGGTGTCCTCCTCAGAGACTATTTCAAGTAAAACATCAGGC AGTGTTAAAGAAGAGCAAGACGGTGGAGAGAATTACGTCATCACTGAAAA TAATAACAAATTTGTGAAATCAAAGACTGAACGTAAAAGTAAAATTTTCA AAACACTAAAATCGTTTGTTGGGAAGAAATGAATGGTATTTTTTATGAAT GAATAGTTGATAGTTTATTATATTACACGCGAGAAAGCAATTTTGATAGT ACGAACAGATTATGCATCAATCCCTGTTCTAGGCAATTAATAACGCAATA TCTGATCAAATGACATATCATAGAATACTTGGTTTACCATAGAAACACAA GGCTGACTAAGTAATGGGTTTACCAAACCATATTTGTATAAATTTTAGAG TGAATTTTACGGTCTTCCTTTCTCTTTTCTTGGATGAATGAAAGGTTCGA AAACAAAGAAATGACTTAGAAAAGCTTAGTTTTAGTTTTCGTTACATCAT GTTGAACTATCAATTACGGCTTTCAATATCAAAATCTTGTTAATACAAAT ACATTTTTCAGAATATTTTTTTTTTTTGATAATTTGTAGTTTAAAAAATT ATATTGTACGATAAAGCTGGCCCTGTCGTAAAGTTTTTTCTTCACAAAAA GGGTTTTTATTCAAGTCGTTTTTAGTATATAGGAATGCTACGTGTTCTTC ATTTCTGAGGAAAAATTATTACCCTAGTAAAATTAGAAAGTTATTAGTTT TTCGACGATTTTTTCCACCTTTTTGAGAATAGAAAATATTTTTTATTACT AAAAACCAAGTGTACAGTATATATTATATGTTATAAATATTGCAAAACAG TCAAA

Coding sequence (CDS) from alignment at sc0000011:416724..488978-

>TCONS_00001672 ID=TCONS_00001672|Name=TCONS_00001672|organism=Clytia hemisphaerica|type=CDS|length=20394bp|location=Sequence derived from alignment at sc0000011:416724..488978- (Clytia hemisphaerica)
ATGGCGACGTTCGATCGGTGCAGTCTTTTCACATCTCTGGTCAAATAAAG
ATGGCGAAGAAACTTCCTCACAAATGGATACTTCAGACAATTTAGACNCT
CTGGTCAAACAAAGATGGCGAAGAAACTTCCTCACAAATGGATACTTCAG
ACAATTTAGACATTACGTCATTAAATGAGAACAACAAAAACATGAAACCA
GTTTCCGAAAATAAATCCGATAACGACCAAGGTTATTGTAGTTTTGGTGA
ACGGAAAGATGAATCACCCGAAGATGAATCCGGACGGAAGCCCCGATCAT
CATCAACACTTAAAAACCATCCCGGTAAACGCTCAATGTCGGTCATTTCG
AACGCCAGTGATGACTCAACAAAACAAGTCATTCGACGTAAAAATGATTT
ACAACTAACAGGGCGAAATACAGACACCAGAAAATCGAATTATTAAAATA
CACAGACGAAGATCATCCAGATTGTTACTTCATTAGTCAAGCCATGAAAG
AAATGGAATCTCTCATATCCTCACTTAACAGTTCAATCCACCAATCAATG
GAATTCTACTCGGCAAGTGAAACCAGGCGTAAAAAGATGTCAAGGCAGTT
CACTTCTAAGAAAAGAAAACAAAGAGCGTCTTCCACCATTTTAAGGATTG
TTATGAGAATCCGGTGGTGGAAAGATTAGATCTGCCATCTTTCTTACTCT
CTCCTGTACAACGGTTACCAAGATACATCTTATTACTTCGAGTCTTCAGA
TCACACTTAAAAGATGCCAACATCATCACCGAGAAAGACTTGAACTCATT
ATTCCCATCACACTTGCAAGACATCAAACAAGCACATGCTCTCTTCATGG
AAGATCTCGAAGAACGAATGAATAACGATGATTGGCGAGGAATTATCGGT
GATATTTTCGCTAAAATGACGTCAGCGTCGGTCAATCTTCTCGAGATGTA
TACAATGTATGTGAATTCGTTCCCCAAAGCCATCAGCACATTGAGTAAAT
GTACAAGATCGTCTGGCAAATTCCGCAAATTTCTAGAGTCTTACCAGCAT
CAAGCAAACAAAAACTACAAGCACTAGCTAAAGATGAATTATTGGCTAGT
TTGAATGTACCGCTATCGAATGCACCTGAAATCACGGTCGACGATGAAGA
GGTCTTGGACGAGTTGGTTGATTCTGAAAACGAGGCTATCGAAGAAAGCG
ATGAGAAGAAAGCACAAATTGAAAAAGAAAGGAGGGAAACGAAACGATTA
TTGATCATCGAGGAAATCTTGGAGACGGAAAAGAATTATATTTCTTGTTT
GGGAACTCTCGATTTGCCTTTCCTGTTAGATTCATTATCCTTGCAAGGTC
TTGGAGGTGCTGGTAACAACAAATGGAATCGAAAACAATCGACATCAAAT
GGTCGAGTAAAACGACGTTTATCCACAGCTGGAGGTTGCTGTTGGACGTA
AAACATCAACGACTTTCCAAAGAAAACAGAGACGATGCAGTGAGAACTCA
CCAGTCGCACGTCGACGTCGAATCTCAGTCAAAAGCACAGCCGTCCGAAA
ACATTCAAGTCGCTCCACAACACCACGACAGCGTCGCAAGACTGTCTCTA
CATACACGCCAGCATTTAACCAATACAATGGCTCTGATGGTCACCTTTCA
TCGGCTGTTACACCGTCACGCCGATTATCTGTCTTACAGCCAGCGTTATG
ATTTGTGTTCCAGTCCACGATTGGCTGAAGTTTGTTCACCACGTGCTCGA
TCCAAAACATTTGACACAATCAACGAACATCCGAAGCGAGACTCCATGGT
TTACAGGGAGCAACGATTGTCATTTTTCTCATCAGAAGCTACTTCAAGAG
GAAGATGGCGACGTTCGATCGGTGCAGTCTTTTCACATCTCTGGTCAAAT
AAAGATGGCGAAGAAACTTCCTCACAAATGGATACTTCAGACAATTTAGA
CNCTCTGGTCAAACAAAGATGGCGAAGAAACTTCCTCACAAATGGATACT
TCAGACAATTTAGACATTACGTCATTAAATGAGAACAACAAAAACATGAA
ACCAGTTTCCGAAAATAAATCCGATAACGACCAAGGTTATTGTAGTTTTG
GTGAACGGAAAGATGAATCACCCGAAGATGAATCCGGACGGAAGCCCCGA
TCATCATCAACACTTAAAAACCATCCCGGTAAACGCTCAATGTCGGTCAT
TTCGAACGCCAGTGATGACTCAACAAAACAAGTCATTCGACGTAAAAATG
ATTTACAACTAACAGGGCGAAATACAGACACCAGAAAATCGAATTATTAA
AATACACAGACGAAGATCATCCAGATTGTTACTTCATTAGTCAAGCCATG
AAAGAAATGGAATCTCTCATATCCTCACTTAACAGTTCAATCCACCAATC
AATGGAATTCTACTCGGCAAGTGAAACCAGGCGTAAAAAGATGTCAAGGC
AGTTCACTTCTAAGAAAAGAAAACAAAGAGCGTCTTCCACCATTTTAAGG
ATTGTTATGAGAATCCGGTGGTGGAAAGATTAGATCTGCCATCTTTCTTA
CTCTCTCCTGTACAACGGTTACCAAGATACATCTTATTACTTCGAGTCTT
CAGATCACACTTAAAAGATGCCAACATCATCACCGAGAAAGACTTGAACT
CATTATTCCCATCACACTTGCAAGACATCAAACAAGCACATGCTCTCTTC
ATGGAAGATCTCGAAGAACGAATGAATAACGATGATTGGCGAGGAATTAT
CGGTGATATTTTCGCTAAAATGACGTCAGCGTCGGTCAATCTTCTCGAGA
TGTATACAATGTATGTGAATTCGTTCCCCAAAGCCATCAGCACATTGAGT
AAATGTACAAGATCGTCTGGCAAATTCCGCAAATTTCTAGAGTCTTACCA
GCATCAAGCAAACAAAAACTACAAGCACTAGCTAAAGATGAATTATTGGC
TAGTTTGAATGTACCGCTATCGAATGCACCTGAAATCACGGTCGACGATG
AAGAGGTCTTGGACGAGTTGGTTGATTCTGAAAACGAGGCTATCGAAGAA
AGCGATGAGAAGAAAGCACAAATTGAAAAAGAAAGGAGGGAAACGAAACG
ATTATTGATCATCGAGGAAATCTTGGAGACGGAAAAGAATTATATTTCTT
GTTTGGGAACTCTCGATTTGCCTTTCCTGTTAGATTCATTATCCTTGCAA
GGTCTTGGAGGTGCTGGTAACAACAAATGGAATCGAAAACAATCGACATC
AAATGGTCGAGTAAAACGACGTTTATCCACAGCTGGAGGTTGCTGTTGGA
CGTAAAACATCAACGACTTTCCAAAGAAAACAGAGACGATGCAGTGAGAA
CTCACCAGTCGCACGTCGACGTCGAATCTCAGTCAAAAGCACAGCCGTCC
GAAAACATTCAAGTCGCTCCACAACACCACGACAGCGTCGCAAGACTGTC
TCTACATACACGCCAGCATTTAACCAATACAATGGCTCTGATGGTCACCT
TTCATCGGCTGTTACACCGTCACGCCGATTATCTGTCTTACAGCCAGCGT
TATGATTTGTGTTCCAGTCCACGATTGGCTGAAGTTTGTTCACCACGTGC
TCGATCCAAAACATTTGACACAATCAACGAACATCCGAAGCGAGACTCCA
TGGTTTACAGGGAGCAACGATTGTCATTTTTCTCATCAGAAGCTACTTCA
AGAGGAAGATGGCGACGTTCGATCGGTGCAGTCTTTTCACATCTCTGGTC
AAATAAAGATGGCGAAGAAACTTCCTCACAAATGGATACTTCAGACAATT
TAGACNCTCTGGTCAAACAAAGATGGCGAAGAAACTTCCTCACAAATGGA
TACTTCAGACAATTTAGACATTACGTCATTAAATGAGAACAACAAAAACA
TGAAACCAGTTTCCGAAAATAAATCCGATAACGACCAAGGTTATTGTAGT
TTTGGTGAACGGAAAGATGAATCACCCGAAGATGAATCCGGACGGAAGCC
CCGATCATCATCAACACTTAAAAACCATCCCGGTAAACGCTCAATGTCGG
TCATTTCGAACGCCAGTGATGACTCAACAAAACAAGTCATTCGACGTAAA
AATGATTTACAACTAACAGGGCGAAATACAGACACCAGAAAATCGAATTA
TTAAAATACACAGACGAAGATCATCCAGATTGTTACTTCATTAGTCAAGC
CATGAAAGAAATGGAATCTCTCATATCCTCACTTAACAGTTCAATCCACC
AATCAATGGAATTCTACTCGGCAAGTGAAACCAGGCGTAAAAAGATGTCA
AGGCAGTTCACTTCTAAGAAAAGAAAACAAAGAGCGTCTTCCACCATTTT
AAGGATTGTTATGAGAATCCGGTGGTGGAAAGATTAGATCTGCCATCTTT
CTTACTCTCTCCTGTACAACGGTTACCAAGATACATCTTATTACTTCGAG
TCTTCAGATCACACTTAAAAGATGCCAACATCATCACCGAGAAAGACTTG
AACTCATTATTCCCATCACACTTGCAAGACATCAAACAAGCACATGCTCT
CTTCATGGAAGATCTCGAAGAACGAATGAATAACGATGATTGGCGAGGAA
TTATCGGTGATATTTTCGCTAAAATGACGTCAGCGTCGGTCAATCTTCTC
GAGATGTATACAATGTATGTGAATTCGTTCCCCAAAGCCATCAGCACATT
GAGTAAATGTACAAGATCGTCTGGCAAATTCCGCAAATTTCTAGAGTCTT
ACCAGCATCAAGCAAACAAAAACTACAAGCACTAGCTAAAGATGAATTAT
TGGCTAGTTTGAATGTACCGCTATCGAATGCACCTGAAATCACGGTCGAC
GATGAAGAGGTCTTGGACGAGTTGGTTGATTCTGAAAACGAGGCTATCGA
AGAAAGCGATGAGAAGAAAGCACAAATTGAAAAAGAAAGGAGGGAAACGA
AACGATTATTGATCATCGAGGAAATCTTGGAGACGGAAAAGAATTATATT
TCTTGTTTGGGAACTCTCGATTTGCCTTTCCTGTTAGATTCATTATCCTT
GCAAGGTCTTGGAGGTGCTGGTAACAACAAATGGAATCGAAAACAATCGA
CATCAAATGGTCGAGTAAAACGACGTTTATCCACAGCTGGAGGTTGCTGT
TGGACGTAAAACATCAACGACTTTCCAAAGAAAACAGAGACGATGCAGTG
AGAACTCACCAGTCGCACGTCGACGTCGAATCTCAGTCAAAAGCACAGCC
GTCCGAAAACATTCAAGTCGCTCCACAACACCACGACAGCGTCGCAAGAC
TGTCTCTACATACACGCCAGCATTTAACCAATACAATGGCTCTGATGGTC
ACCTTTCATCGGCTGTTACACCGTCACGCCGATTATCTGTCTTACAGCCA
GCGTTATGATTTGTGTTCCAGTCCACGATTGGCTGAAGTTTGTTCACCAC
GTGCTCGATCCAAAACATTTGACACAATCAACGAACATCCGAAGCGAGAC
TCCATGGTTTACAGGGAGCAACGATTGTCATTTTTCTCATCAGAAGCTAC
TTCAAGAGGAAGATGGCGACGTTCGATCGGTGCAGTCTTTTCACATCTCT
GGTCAAATAAAGATGGCGAAGAAACTTCCTCACAAATGGATACTTCAGAC
AATTTAGACNCTCTGGTCAAACAAAGATGGCGAAGAAACTTCCTCACAAA
TGGATACTTCAGACAATTTAGACATTACGTCATTAAATGAGAACAACAAA
AACATGAAACCAGTTTCCGAAAATAAATCCGATAACGACCAAGGTTATTG
TAGTTTTGGTGAACGGAAAGATGAATCACCCGAAGATGAATCCGGACGGA
AGCCCCGATCATCATCAACACTTAAAAACCATCCCGGTAAACGCTCAATG
TCGGTCATTTCGAACGCCAGTGATGACTCAACAAAACAAGTCATTCGACG
TAAAAATGATTTACAACTAACAGGGCGAAATACAGACACCAGAAAATCGA
ATTATTAAAATACACAGACGAAGATCATCCAGATTGTTACTTCATTAGTC
AAGCCATGAAAGAAATGGAATCTCTCATATCCTCACTTAACAGTTCAATC
CACCAATCAATGGAATTCTACTCGGCAAGTGAAACCAGGCGTAAAAAGAT
GTCAAGGCAGTTCACTTCTAAGAAAAGAAAACAAAGAGCGTCTTCCACCA
TTTTAAGGATTGTTATGAGAATCCGGTGGTGGAAAGATTAGATCTGCCAT
CTTTCTTACTCTCTCCTGTACAACGGTTACCAAGATACATCTTATTACTT
CGAGTCTTCAGATCACACTTAAAAGATGCCAACATCATCACCGAGAAAGA
CTTGAACTCATTATTCCCATCACACTTGCAAGACATCAAACAAGCACATG
CTCTCTTCATGGAAGATCTCGAAGAACGAATGAATAACGATGATTGGCGA
GGAATTATCGGTGATATTTTCGCTAAAATGACGTCAGCGTCGGTCAATCT
TCTCGAGATGTATACAATGTATGTGAATTCGTTCCCCAAAGCCATCAGCA
CATTGAGTAAATGTACAAGATCGTCTGGCAAATTCCGCAAATTTCTAGAG
TCTTACCAGCATCAAGCAAACAAAAACTACAAGCACTAGCTAAAGATGAA
TTATTGGCTAGTTTGAATGTACCGCTATCGAATGCACCTGAAATCACGGT
CGACGATGAAGAGGTCTTGGACGAGTTGGTTGATTCTGAAAACGAGGCTA
TCGAAGAAAGCGATGAGAAGAAAGCACAAATTGAAAAAGAAAGGAGGGAA
ACGAAACGATTATTGATCATCGAGGAAATCTTGGAGACGGAAAAGAATTA
TATTTCTTGTTTGGGAACTCTCGATTTGCCTTTCCTGTTAGATTCATTAT
CCTTGCAAGGTCTTGGAGGTGCTGGTAACAACAAATGGAATCGAAAACAA
TCGACATCAAATGGTCGAGTAAAACGACGTTTATCCACAGCTGGAGGTTG
CTGTTGGACGTAAAACATCAACGACTTTCCAAAGAAAACAGAGACGATGC
AGTGAGAACTCACCAGTCGCACGTCGACGTCGAATCTCAGTCAAAAGCAC
AGCCGTCCGAAAACATTCAAGTCGCTCCACAACACCACGACAGCGTCGCA
AGACTGTCTCTACATACACGCCAGCATTTAACCAATACAATGGCTCTGAT
GGTCACCTTTCATCGGCTGTTACACCGTCACGCCGATTATCTGTCTTACA
GCCAGCGTTATGATTTGTGTTCCAGTCCACGATTGGCTGAAGTTTGTTCA
CCACGTGCTCGATCCAAAACATTTGACACAATCAACGAACATCCGAAGCG
AGACTCCATGGTTTACAGGGAGCAACGATTGTCATTTTTCTCATCAGAAG
CTACTTCAAGAGGAAGATGGCGACGTTCGATCGGTGCAGTCTTTTCACAT
CTCTGGTCAAATAAAGATGGCGAAGAAACTTCCTCACAAATGGATACTTC
AGACAATTTAGACNCTCTGGTCAAACAAAGATGGCGAAGAAACTTCCTCA
CAAATGGATACTTCAGACAATTTAGACATTACGTCATTAAATGAGAACAA
CAAAAACATGAAACCAGTTTCCGAAAATAAATCCGATAACGACCAAGGTT
ATTGTAGTTTTGGTGAACGGAAAGATGAATCACCCGAAGATGAATCCGGA
CGGAAGCCCCGATCATCATCAACACTTAAAAACCATCCCGGTAAACGCTC
AATGTCGGTCATTTCGAACGCCAGTGATGACTCAACAAAACAAGTCATTC
GACGTAAAAATGATTTACAACTAACAGGGCGAAATACAGACACCAGAAAA
TCGAATTATTAAAATACACAGACGAAGATCATCCAGATTGTTACTTCATT
AGTCAAGCCATGAAAGAAATGGAATCTCTCATATCCTCACTTAACAGTTC
AATCCACCAATCAATGGAATTCTACTCGGCAAGTGAAACCAGGCGTAAAA
AGATGTCAAGGCAGTTCACTTCTAAGAAAAGAAAACAAAGAGCGTCTTCC
ACCATTTTAAGGATTGTTATGAGAATCCGGTGGTGGAAAGATTAGATCTG
CCATCTTTCTTACTCTCTCCTGTACAACGGTTACCAAGATACATCTTATT
ACTTCGAGTCTTCAGATCACACTTAAAAGATGCCAACATCATCACCGAGA
AAGACTTGAACTCATTATTCCCATCACACTTGCAAGACATCAAACAAGCA
CATGCTCTCTTCATGGAAGATCTCGAAGAACGAATGAATAACGATGATTG
GCGAGGAATTATCGGTGATATTTTCGCTAAAATGACGTCAGCGTCGGTCA
ATCTTCTCGAGATGTATACAATGTATGTGAATTCGTTCCCCAAAGCCATC
AGCACATTGAGTAAATGTACAAGATCGTCTGGCAAATTCCGCAAATTTCT
AGAGTCTTACCAGCATCAAGCAAACAAAAACTACAAGCACTAGCTAAAGA
TGAATTATTGGCTAGTTTGAATGTACCGCTATCGAATGCACCTGAAATCA
CGGTCGACGATGAAGAGGTCTTGGACGAGTTGGTTGATTCTGAAAACGAG
GCTATCGAAGAAAGCGATGAGAAGAAAGCACAAATTGAAAAAGAAAGGAG
GGAAACGAAACGATTATTGATCATCGAGGAAATCTTGGAGACGGAAAAGA
ATTATATTTCTTGTTTGGGAACTCTCGATTTGCCTTTCCTGTTAGATTCA
TTATCCTTGCAAGGTCTTGGAGGTGCTGGTAACAACAAATGGAATCGAAA
ACAATCGACATCAAATGGTCGAGTAAAACGACGTTTATCCACAGCTGGAG
GTTGCTGTTGGACGTAAAACATCAACGACTTTCCAAAGAAAACAGAGACG
ATGCAGTGAGAACTCACCAGTCGCACGTCGACGTCGAATCTCAGTCAAAA
GCACAGCCGTCCGAAAACATTCAAGTCGCTCCACAACACCACGACAGCGT
CGCAAGACTGTCTCTACATACACGCCAGCATTTAACCAATACAATGGCTC
TGATGGTCACCTTTCATCGGCTGTTACACCGTCACGCCGATTATCTGTCT
TACAGCCAGCGTTATGATTTGTGTTCCAGTCCACGATTGGCTGAAGTTTG
TTCACCACGTGCTCGATCCAAAACATTTGACACAATCAACGAACATCCGA
AGCGAGACTCCATGGTTTACAGGGAGCAACGATTGTCATTTTTCTCATCA
GAAGCTACTTCAAGAGGAAGATGGCGACGTTCGATCGGTGCAGTCTTTTC
ACATCTCTGGTCAAATAAAGATGGCGAAGAAACTTCCTCACAAATGGATA
CTTCAGACAATTTAGACNCTCTGGTCAAACAAAGATGGCGAAGAAACTTC
CTCACAAATGGATACTTCAGACAATTTAGACATTACGTCATTAAATGAGA
ACAACAAAAACATGAAACCAGTTTCCGAAAATAAATCCGATAACGACCAA
GGTTATTGTAGTTTTGGTGAACGGAAAGATGAATCACCCGAAGATGAATC
CGGACGGAAGCCCCGATCATCATCAACACTTAAAAACCATCCCGGTAAAC
GCTCAATGTCGGTCATTTCGAACGCCAGTGATGACTCAACAAAACAAGTC
ATTCGACGTAAAAATGATTTACAACTAACAGGGCGAAATACAGACACCAG
AAAATCGAATTATTAAAATACACAGACGAAGATCATCCAGATTGTTACTT
CATTAGTCAAGCCATGAAAGAAATGGAATCTCTCATATCCTCACTTAACA
GTTCAATCCACCAATCAATGGAATTCTACTCGGCAAGTGAAACCAGGCGT
AAAAAGATGTCAAGGCAGTTCACTTCTAAGAAAAGAAAACAAAGAGCGTC
TTCCACCATTTTAAGGATTGTTATGAGAATCCGGTGGTGGAAAGATTAGA
TCTGCCATCTTTCTTACTCTCTCCTGTACAACGGTTACCAAGATACATCT
TATTACTTCGAGTCTTCAGATCACACTTAAAAGATGCCAACATCATCACC
GAGAAAGACTTGAACTCATTATTCCCATCACACTTGCAAGACATCAAACA
AGCACATGCTCTCTTCATGGAAGATCTCGAAGAACGAATGAATAACGATG
ATTGGCGAGGAATTATCGGTGATATTTTCGCTAAAATGACGTCAGCGTCG
GTCAATCTTCTCGAGATGTATACAATGTATGTGAATTCGTTCCCCAAAGC
CATCAGCACATTGAGTAAATGTACAAGATCGTCTGGCAAATTCCGCAAAT
TTCTAGAGTCTTACCAGCATCAAGCAAACAAAAACTACAAGCACTAGCTA
AAGATGAATTATTGGCTAGTTTGAATGTACCGCTATCGAATGCACCTGAA
ATCACGGTCGACGATGAAGAGGTCTTGGACGAGTTGGTTGATTCTGAAAA
CGAGGCTATCGAAGAAAGCGATGAGAAGAAAGCACAAATTGAAAAAGAAA
GGAGGGAAACGAAACGATTATTGATCATCGAGGAAATCTTGGAGACGGAA
AAGAATTATATTTCTTGTTTGGGAACTCTCGATTTGCCTTTCCTGTTAGA
TTCATTATCCTTGCAAGGTCTTGGAGGTGCTGGTAACAACAAATGGAATC
GAAAACAATCGACATCAAATGGTCGAGTAAAACGACGTTTATCCACAGCT
GGAGGTTGCTGTTGGACGTAAAACATCAACGACTTTCCAAAGAAAACAGA
GACGATGCAGTGAGAACTCACCAGTCGCACGTCGACGTCGAATCTCAGTC
AAAAGCACAGCCGTCCGAAAACATTCAAGTCGCTCCACAACACCACGACA
GCGTCGCAAGACTGTCTCTACATACACGCCAGCATTTAACCAATACAATG
GCTCTGATGGTCACCTTTCATCGGCTGTTACACCGTCACGCCGATTATCT
GTCTTACAGCCAGCGTTATGATTTGTGTTCCAGTCCACGATTGGCTGAAG
TTTGTTCACCACGTGCTCGATCCAAAACATTTGACACAATCAACGAACAT
CCGAAGCGAGACTCCATGGTTTACAGGGAGCAACGATTGTCATTTTTCTC
ATCAGAAGCTACTTCAAGAGGAAGATGGCGACGTTCGATCGGTGCAGTCT
TTTCACATCTCTGGTCAAATAAAGATGGCGAAGAAACTTCCTCACAAATG
GATACTTCAGACAATTTAGACNCTCTGGTCAAACAAAGATGGCGAAGAAA
CTTCCTCACAAATGGATACTTCAGACAATTTAGACATTACGTCATTAAAT
GAGAACAACAAAAACATGAAACCAGTTTCCGAAAATAAATCCGATAACGA
CCAAGGTTATTGTAGTTTTGGTGAACGGAAAGATGAATCACCCGAAGATG
AATCCGGACGGAAGCCCCGATCATCATCAACACTTAAAAACCATCCCGGT
AAACGCTCAATGTCGGTCATTTCGAACGCCAGTGATGACTCAACAAAACA
AGTCATTCGACGTAAAAATGATTTACAACTAACAGGGCGAAATACAGACA
CCAGAAAATCGAATTATTAAAATACACAGACGAAGATCATCCAGATTGTT
ACTTCATTAGTCAAGCCATGAAAGAAATGGAATCTCTCATATCCTCACTT
AACAGTTCAATCCACCAATCAATGGAATTCTACTCGGCAAGTGAAACCAG
GCGTAAAAAGATGTCAAGGCAGTTCACTTCTAAGAAAAGAAAACAAAGAG
CGTCTTCCACCATTTTAAGGATTGTTATGAGAATCCGGTGGTGGAAAGAT
TAGATCTGCCATCTTTCTTACTCTCTCCTGTACAACGGTTACCAAGATAC
ATCTTATTACTTCGAGTCTTCAGATCACACTTAAAAGATGCCAACATCAT
CACCGAGAAAGACTTGAACTCATTATTCCCATCACACTTGCAAGACATCA
AACAAGCACATGCTCTCTTCATGGAAGATCTCGAAGAACGAATGAATAAC
GATGATTGGCGAGGAATTATCGGTGATATTTTCGCTAAAATGACGTCAGC
GTCGGTCAATCTTCTCGAGATGTATACAATGTATGTGAATTCGTTCCCCA
AAGCCATCAGCACATTGAGTAAATGTACAAGATCGTCTGGCAAATTCCGC
AAATTTCTAGAGTCTTACCAGCATCAAGCAAACAAAAACTACAAGCACTA
GCTAAAGATGAATTATTGGCTAGTTTGAATGTACCGCTATCGAATGCACC
TGAAATCACGGTCGACGATGAAGAGGTCTTGGACGAGTTGGTTGATTCTG
AAAACGAGGCTATCGAAGAAAGCGATGAGAAGAAAGCACAAATTGAAAAA
GAAAGGAGGGAAACGAAACGATTATTGATCATCGAGGAAATCTTGGAGAC
GGAAAAGAATTATATTTCTTGTTTGGGAACTCTCGATTTGCCTTTCCTGT
TAGATTCATTATCCTTGCAAGGTCTTGGAGGTGCTGGTAACAACAAATGG
AATCGAAAACAATCGACATCAAATGGTCGAGTAAAACGACGTTTATCCAC
AGCTGGAGGTTGCTGTTGGACGTAAAACATCAACGACTTTCCAAAGAAAA
CAGAGACGATGCAGTGAGAACTCACCAGTCGCACGTCGACGTCGAATCTC
AGTCAAAAGCACAGCCGTCCGAAAACATTCAAGTCGCTCCACAACACCAC
GACAGCGTCGCAAGACTGTCTCTACATACACGCCAGCATTTAACCAATAC
AATGGCTCTGATGGTCACCTTTCATCGGCTGTTACACCGTCACGCCGATT
ATCTGTCTTACAGCCAGCGTTATGATTTGTGTTCCAGTCCACGATTGGCT
GAAGTTTGTTCACCACGTGCTCGATCCAAAACATTTGACACAATCAACGA
ACATCCGAAGCGAGACTCCATGGTTTACAGGGAGCAACGATTGTCATTTT
TCTCATCAGAAGCTACTTCAAGAGGAAGATGGCGACGTTCGATCGGTGCA
GTCTTTTCACATCTCTGGTCAAATAAAGATGGCGAAGAAACTTCCTCACA
AATGGATACTTCAGACAATTTAGACNCTCTGGTCAAACAAAGATGGCGAA
GAAACTTCCTCACAAATGGATACTTCAGACAATTTAGACATTACGTCATT
AAATGAGAACAACAAAAACATGAAACCAGTTTCCGAAAATAAATCCGATA
ACGACCAAGGTTATTGTAGTTTTGGTGAACGGAAAGATGAATCACCCGAA
GATGAATCCGGACGGAAGCCCCGATCATCATCAACACTTAAAAACCATCC
CGGTAAACGCTCAATGTCGGTCATTTCGAACGCCAGTGATGACTCAACAA
AACAAGTCATTCGACGTAAAAATGATTTACAACTAACAGGGCGAAATACA
GACACCAGAAAATCGAATTATTAAAATACACAGACGAAGATCATCCAGAT
TGTTACTTCATTAGTCAAGCCATGAAAGAAATGGAATCTCTCATATCCTC
ACTTAACAGTTCAATCCACCAATCAATGGAATTCTACTCGGCAAGTGAAA
CCAGGCGTAAAAAGATGTCAAGGCAGTTCACTTCTAAGAAAAGAAAACAA
AGAGCGTCTTCCACCATTTTAAGGATTGTTATGAGAATCCGGTGGTGGAA
AGATTAGATCTGCCATCTTTCTTACTCTCTCCTGTACAACGGTTACCAAG
ATACATCTTATTACTTCGAGTCTTCAGATCACACTTAAAAGATGCCAACA
TCATCACCGAGAAAGACTTGAACTCATTATTCCCATCACACTTGCAAGAC
ATCAAACAAGCACATGCTCTCTTCATGGAAGATCTCGAAGAACGAATGAA
TAACGATGATTGGCGAGGAATTATCGGTGATATTTTCGCTAAAATGACGT
CAGCGTCGGTCAATCTTCTCGAGATGTATACAATGTATGTGAATTCGTTC
CCCAAAGCCATCAGCACATTGAGTAAATGTACAAGATCGTCTGGCAAATT
CCGCAAATTTCTAGAGTCTTACCAGCATCAAGCAAACAAAAACTACAAGC
ACTAGCTAAAGATGAATTATTGGCTAGTTTGAATGTACCGCTATCGAATG
CACCTGAAATCACGGTCGACGATGAAGAGGTCTTGGACGAGTTGGTTGAT
TCTGAAAACGAGGCTATCGAAGAAAGCGATGAGAAGAAAGCACAAATTGA
AAAAGAAAGGAGGGAAACGAAACGATTATTGATCATCGAGGAAATCTTGG
AGACGGAAAAGAATTATATTTCTTGTTTGGGAACTCTCGATTTGCCTTTC
CTGTTAGATTCATTATCCTTGCAAGGTCTTGGAGGTGCTGGTAACAACAA
ATGGAATCGAAAACAATCGACATCAAATGGTCGAGTAAAACGACGTTTAT
CCACAGCTGGAGGTTGCTGTTGGACGTAAAACATCAACGACTTTCCAAAG
AAAACAGAGACGATGCAGTGAGAACTCACCAGTCGCACGTCGACGTCGAA
TCTCAGTCAAAAGCACAGCCGTCCGAAAACATTCAAGTCGCTCCACAACA
CCACGACAGCGTCGCAAGACTGTCTCTACATACACGCCAGCATTTAACCA
ATACAATGGCTCTGATGGTCACCTTTCATCGGCTGTTACACCGTCACGCC
GATTATCTGTCTTACAGCCAGCGTTATGATTTGTGTTCCAGTCCACGATT
GGCTGAAGTTTGTTCACCACGTGCTCGATCCAAAACATTTGACACAATCA
ACGAACATCCGAAGCGAGACTCCATGGTTTACAGGGAGCAACGATTGTCA
TTTTTCTCATCAGAAGCTACTTCAAGAGGAAGATGGCGACGTTCGATCGG
TGCAGTCTTTTCACATCTCTGGTCAAATAAAGATGGCGAAGAAACTTCCT
CACAAATGGATACTTCAGACAATTTAGACNCTCTGGTCAAACAAAGATGG
CGAAGAAACTTCCTCACAAATGGATACTTCAGACAATTTAGACATTACGT
CATTAAATGAGAACAACAAAAACATGAAACCAGTTTCCGAAAATAAATCC
GATAACGACCAAGGTTATTGTAGTTTTGGTGAACGGAAAGATGAATCACC
CGAAGATGAATCCGGACGGAAGCCCCGATCATCATCAACACTTAAAAACC
ATCCCGGTAAACGCTCAATGTCGGTCATTTCGAACGCCAGTGATGACTCA
ACAAAACAAGTCATTCGACGTAAAAATGATTTACAACTAACAGGGCGAAA
TACAGACACCAGAAAATCGAATTATTAAAATACACAGACGAAGATCATCC
AGATTGTTACTTCATTAGTCAAGCCATGAAAGAAATGGAATCTCTCATAT
CCTCACTTAACAGTTCAATCCACCAATCAATGGAATTCTACTCGGCAAGT
GAAACCAGGCGTAAAAAGATGTCAAGGCAGTTCACTTCTAAGAAAAGAAA
ACAAAGAGCGTCTTCCACCATTTTAAGGATTGTTATGAGAATCCGGTGGT
GGAAAGATTAGATCTGCCATCTTTCTTACTCTCTCCTGTACAACGGTTAC
CAAGATACATCTTATTACTTCGAGTCTTCAGATCACACTTAAAAGATGCC
AACATCATCACCGAGAAAGACTTGAACTCATTATTCCCATCACACTTGCA
AGACATCAAACAAGCACATGCTCTCTTCATGGAAGATCTCGAAGAACGAA
TGAATAACGATGATTGGCGAGGAATTATCGGTGATATTTTCGCTAAAATG
ACGTCAGCGTCGGTCAATCTTCTCGAGATGTATACAATGTATGTGAATTC
GTTCCCCAAAGCCATCAGCACATTGAGTAAATGTACAAGATCGTCTGGCA
AATTCCGCAAATTTCTAGAGTCTTACCAGCATCAAGCAAACAAAAACTAC
AAGCACTAGCTAAAGATGAATTATTGGCTAGTTTGAATGTACCGCTATCG
AATGCACCTGAAATCACGGTCGACGATGAAGAGGTCTTGGACGAGTTGGT
TGATTCTGAAAACGAGGCTATCGAAGAAAGCGATGAGAAGAAAGCACAAA
TTGAAAAAGAAAGGAGGGAAACGAAACGATTATTGATCATCGAGGAAATC
TTGGAGACGGAAAAGAATTATATTTCTTGTTTGGGAACTCTCGATTTGCC
TTTCCTGTTAGATTCATTATCCTTGCAAGGTCTTGGAGGTGCTGGTAACA
ACAAATGGAATCGAAAACAATCGACATCAAATGGTCGAGTAAAACGACGT
TTATCCACAGCTGGAGGTTGCTGTTGGACGTAAAACATCAACGACTTTCC
AAAGAAAACAGAGACGATGCAGTGAGAACTCACCAGTCGCACGTCGACGT
CGAATCTCAGTCAAAAGCACAGCCGTCCGAAAACATTCAAGTCGCTCCAC
AACACCACGACAGCGTCGCAAGACTGTCTCTACATACACGCCAGCATTTA
ACCAATACAATGGCTCTGATGGTCACCTTTCATCGGCTGTTACACCGTCA
CGCCGATTATCTGTCTTACAGCCAGCGTTATGATTTGTGTTCCAGTCCAC
GATTGGCTGAAGTTTGTTCACCACGTGCTCGATCCAAAACATTTGACACA
ATCAACGAACATCCGAAGCGAGACTCCATGGTTTACAGGGAGCAACGATT
GTCATTTTTCTCATCAGAAGCTACTTCAAGAGGAAGATGGCGACGTTCGA
TCGGTGCAGTCTTTTCACATCTCTGGTCAAATAAAGATGGCGAAGAAACT
TCCTCACAAATGGATACTTCAGACAATTTAGACNCTCTGGTCAAACAAAG
ATGGCGAAGAAACTTCCTCACAAATGGATACTTCAGACAATTTAGACATT
ACGTCATTAAATGAGAACAACAAAAACATGAAACCAGTTTCCGAAAATAA
ATCCGATAACGACCAAGGTTATTGTAGTTTTGGTGAACGGAAAGATGAAT
CACCCGAAGATGAATCCGGACGGAAGCCCCGATCATCATCAACACTTAAA
AACCATCCCGGTAAACGCTCAATGTCGGTCATTTCGAACGCCAGTGATGA
CTCAACAAAACAAGTCATTCGACGTAAAAATGATTTACAACTAACAGGGC
GAAATACAGACACCAGAAAATCGAATTATTAAAATACACAGACGAAGATC
ATCCAGATTGTTACTTCATTAGTCAAGCCATGAAAGAAATGGAATCTCTC
ATATCCTCACTTAACAGTTCAATCCACCAATCAATGGAATTCTACTCGGC
AAGTGAAACCAGGCGTAAAAAGATGTCAAGGCAGTTCACTTCTAAGAAAA
GAAAACAAAGAGCGTCTTCCACCATTTTAAGGATTGTTATGAGAATCCGG
TGGTGGAAAGATTAGATCTGCCATCTTTCTTACTCTCTCCTGTACAACGG
TTACCAAGATACATCTTATTACTTCGAGTCTTCAGATCACACTTAAAAGA
TGCCAACATCATCACCGAGAAAGACTTGAACTCATTATTCCCATCACACT
TGCAAGACATCAAACAAGCACATGCTCTCTTCATGGAAGATCTCGAAGAA
CGAATGAATAACGATGATTGGCGAGGAATTATCGGTGATATTTTCGCTAA
AATGACGTCAGCGTCGGTCAATCTTCTCGAGATGTATACAATGTATGTGA
ATTCGTTCCCCAAAGCCATCAGCACATTGAGTAAATGTACAAGATCGTCT
GGCAAATTCCGCAAATTTCTAGAGTCTTACCAGCATCAAGCAAACAAAAA
CTACAAGCACTAGCTAAAGATGAATTATTGGCTAGTTTGAATGTACCGCT
ATCGAATGCACCTGAAATCACGGTCGACGATGAAGAGGTCTTGGACGAGT
TGGTTGATTCTGAAAACGAGGCTATCGAAGAAAGCGATGAGAAGAAAGCA
CAAATTGAAAAAGAAAGGAGGGAAACGAAACGATTATTGATCATCGAGGA
AATCTTGGAGACGGAAAAGAATTATATTTCTTGTTTGGGAACTCTCGATT
TGCCTTTCCTGTTAGATTCATTATCCTTGCAAGGTCTTGGAGGTGCTGGT
AACAACAAATGGAATCGAAAACAATCGACATCAAATGGTCGAGTAAAACG
ACGTTTATCCACAGCTGGAGGTTGCTGTTGGACGTAAAACATCAACGACT
TTCCAAAGAAAACAGAGACGATGCAGTGAGAACTCACCAGTCGCACGTCG
ACGTCGAATCTCAGTCAAAAGCACAGCCGTCCGAAAACATTCAAGTCGCT
CCACAACACCACGACAGCGTCGCAAGACTGTCTCTACATACACGCCAGCA
TTTAACCAATACAATGGCTCTGATGGTCACCTTTCATCGGCTGTTACACC
GTCACGCCGATTATCTGTCTTACAGCCAGCGTTATGATTTGTGTTCCAGT
CCACGATTGGCTGAAGTTTGTTCACCACGTGCTCGATCCAAAACATTTGA
CACAATCAACGAACATCCGAAGCGAGACTCCATGGTTTACAGGGAGCAAC
GATTGTCATTTTTCTCATCAGAAGCTACTTCAAGAGGAAGATGGCGACGT
TCGATCGGTGCAGTCTTTTCACATCTCTGGTCAAATAAAGATGGCGAAGA
AACTTCCTCACAAATGGATACTTCAGACAATTTAGACNCTCTGGTCAAAC
AAAGATGGCGAAGAAACTTCCTCACAAATGGATACTTCAGACAATTTAGA
CATTACGTCATTAAATGAGAACAACAAAAACATGAAACCAGTTTCCGAAA
ATAAATCCGATAACGACCAAGGTTATTGTAGTTTTGGTGAACGGAAAGAT
GAATCACCCGAAGATGAATCCGGACGGAAGCCCCGATCATCATCAACACT
TAAAAACCATCCCGGTAAACGCTCAATGTCGGTCATTTCGAACGCCAGTG
ATGACTCAACAAAACAAGTCATTCGACGTAAAAATGATTTACAACTAACA
GGGCGAAATACAGACACCAGAAAATCGAATTATTAAAATACACAGACGAA
GATCATCCAGATTGTTACTTCATTAGTCAAGCCATGAAAGAAATGGAATC
TCTCATATCCTCACTTAACAGTTCAATCCACCAATCAATGGAATTCTACT
CGGCAAGTGAAACCAGGCGTAAAAAGATGTCAAGGCAGTTCACTTCTAAG
AAAAGAAAACAAAGAGCGTCTTCCACCATTTTAAGGATTGTTATGAGAAT
CCGGTGGTGGAAAGATTAGATCTGCCATCTTTCTTACTCTCTCCTGTACA
ACGGTTACCAAGATACATCTTATTACTTCGAGTCTTCAGATCACACTTAA
AAGATGCCAACATCATCACCGAGAAAGACTTGAACTCATTATTCCCATCA
CACTTGCAAGACATCAAACAAGCACATGCTCTCTTCATGGAAGATCTCGA
AGAACGAATGAATAACGATGATTGGCGAGGAATTATCGGTGATATTTTCG
CTAAAATGACGTCAGCGTCGGTCAATCTTCTCGAGATGTATACAATGTAT
GTGAATTCGTTCCCCAAAGCCATCAGCACATTGAGTAAATGTACAAGATC
GTCTGGCAAATTCCGCAAATTTCTAGAGTCTTACCAGCATCAAGCAAACA
AAAACTACAAGCACTAGCTAAAGATGAATTATTGGCTAGTTTGAATGTAC
CGCTATCGAATGCACCTGAAATCACGGTCGACGATGAAGAGGTCTTGGAC
GAGTTGGTTGATTCTGAAAACGAGGCTATCGAAGAAAGCGATGAGAAGAA
AGCACAAATTGAAAAAGAAAGGAGGGAAACGAAACGATTATTGATCATCG
AGGAAATCTTGGAGACGGAAAAGAATTATATTTCTTGTTTGGGAACTCTC
GATTTGCCTTTCCTGTTAGATTCATTATCCTTGCAAGGTCTTGGAGGTGC
TGGTAACAACAAATGGAATCGAAAACAATCGACATCAAATGGTCGAGTAA
AACGACGTTTATCCACAGCTGGAGGTTGCTGTTGGACGTAAAACATCAAC
GACTTTCCAAAGAAAACAGAGACGATGCAGTGAGAACTCACCAGTCGCAC
GTCGACGTCGAATCTCAGTCAAAAGCACAGCCGTCCGAAAACATTCAAGT
CGCTCCACAACACCACGACAGCGTCGCAAGACTGTCTCTACATACACGCC
AGCATTTAACCAATACAATGGCTCTGATGGTCACCTTTCATCGGCTGTTA
CACCGTCACGCCGATTATCTGTCTTACAGCCAGCGTTATGATTTGTGTTC
CAGTCCACGATTGGCTGAAGTTTGTTCACCACGTGCTCGATCCAAAACAT
TTGACACAATCAACGAACATCCGAAGCGAGACTCCATGGTTTACAGGGAG
CAACGATTGTCATTTTTCTCATCAGAAGCTACTTCAAGAGGAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000868XLOC_000868Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001672-proteinTCONS_00001672-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001672-exon-sc0000011-1575043694:488954..488978TCONS_00001672-exon-sc0000011-1575043694:488954..488978Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:481181..481533TCONS_00001672-exon-sc0000011-1575043694:481181..481533Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:480956..481071TCONS_00001672-exon-sc0000011-1575043694:480956..481071Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:465824..465938TCONS_00001672-exon-sc0000011-1575043694:465824..465938Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:442866..443051TCONS_00001672-exon-sc0000011-1575043694:442866..443051Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:423433..423492TCONS_00001672-exon-sc0000011-1575043694:423433..423492Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:422872..422989TCONS_00001672-exon-sc0000011-1575043694:422872..422989Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:421830..422107TCONS_00001672-exon-sc0000011-1575043694:421830..422107Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:421300..421596TCONS_00001672-exon-sc0000011-1575043694:421300..421596Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:420805..420900TCONS_00001672-exon-sc0000011-1575043694:420805..420900Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:420314..420522TCONS_00001672-exon-sc0000011-1575043694:420314..420522Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:419697..419954TCONS_00001672-exon-sc0000011-1575043694:419697..419954Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1575043694:416724..419441TCONS_00001672-exon-sc0000011-1575043694:416724..419441Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:488954..488978TCONS_00001672-exon-sc0000011-1510915933:488954..488978Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:481181..481533TCONS_00001672-exon-sc0000011-1510915933:481181..481533Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:480956..481071TCONS_00001672-exon-sc0000011-1510915933:480956..481071Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:465824..465938TCONS_00001672-exon-sc0000011-1510915933:465824..465938Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:442866..443051TCONS_00001672-exon-sc0000011-1510915933:442866..443051Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:423433..423492TCONS_00001672-exon-sc0000011-1510915933:423433..423492Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:422872..422989TCONS_00001672-exon-sc0000011-1510915933:422872..422989Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:421830..422107TCONS_00001672-exon-sc0000011-1510915933:421830..422107Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:421300..421596TCONS_00001672-exon-sc0000011-1510915933:421300..421596Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:420805..420900TCONS_00001672-exon-sc0000011-1510915933:420805..420900Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:420314..420522TCONS_00001672-exon-sc0000011-1510915933:420314..420522Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:419697..419954TCONS_00001672-exon-sc0000011-1510915933:419697..419954Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1510915933:416724..419441TCONS_00001672-exon-sc0000011-1510915933:416724..419441Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:488954..488978TCONS_00001672-exon-sc0000011-1491911889:488954..488978Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:481181..481533TCONS_00001672-exon-sc0000011-1491911889:481181..481533Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:480956..481071TCONS_00001672-exon-sc0000011-1491911889:480956..481071Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:465824..465938TCONS_00001672-exon-sc0000011-1491911889:465824..465938Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:442866..443051TCONS_00001672-exon-sc0000011-1491911889:442866..443051Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:423433..423492TCONS_00001672-exon-sc0000011-1491911889:423433..423492Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:422872..422989TCONS_00001672-exon-sc0000011-1491911889:422872..422989Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:421830..422107TCONS_00001672-exon-sc0000011-1491911889:421830..422107Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:421300..421596TCONS_00001672-exon-sc0000011-1491911889:421300..421596Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:420805..420900TCONS_00001672-exon-sc0000011-1491911889:420805..420900Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:420314..420522TCONS_00001672-exon-sc0000011-1491911889:420314..420522Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:419697..419954TCONS_00001672-exon-sc0000011-1491911889:419697..419954Clytia hemisphaericaexon
TCONS_00001672-exon-sc0000011-1491911889:416724..419441TCONS_00001672-exon-sc0000011-1491911889:416724..419441Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:416724..488978 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.00804546 7.12197e-07 3.99643e-05 0 0.063176 0.17707 0.000704235 0.084438 5.98776e-10 0 0.551218 0.0673199 1.1717 0 0.323016 1.41809 2.38391 2.05294 0.458937 0.0494652 2.26737 1.2104 0.00466265 0.995148 2.31183 1.82073 0.00172387 0.000978104 0.00248849 0.000353133
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000219DH-domain
IPR001331GDS_CDC24_CS
Vocabulary: Biological Process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0035556intracellular signal transduction
Vocabulary: Molecular Function
TermDefinition
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0005085guanyl-nucleotide exchange factor activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0035556 intracellular signal transduction
biological_process GO:0035023 regulation of Rho protein signal transduction
molecular_function GO:0005085 guanyl-nucleotide exchange factor activity
molecular_function GO:0005089 Rho guanyl-nucleotide exchange factor activity
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001672 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top