Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001672-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001672-protein
Unique NameTCONS_00001672-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length617

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001672-protein ID=TCONS_00001672-protein|Name=TCONS_00001672-protein|organism=Clytia hemisphaerica|type=polypeptide|length=617bp
MVYREQRLSFFSSEATSRGRSYSQRYDLCSSPRLAEVCSPRARSKTFDTI
NEHPKRDSNSPVARRRRISVKSTAVRKHSSRSTTPRQRRKTVSTYTPAFN
QYNGSDGHLSSAVTPSRRLSVAVGRKTSTTFQRKQRRCSEPFLLDSLSLQ
GLGGAGNNKWNRKQSTSNGRVKRRLSTAGVLPASSKQKLQALAKDELLAS
LNVPLSNAPEITVDDEEVLDELVDSENEAIEESDEKKAQIEKERRETKRL
LIIEEILETEKNYISCLGTLDLVFRSHLKDANIITEKDLNSLFPSHLQDI
KQAHALFMEDLEERMNNDDWRGIIGDIFAKMTSASVNLLEMYTMYVNSFP
KAISTLSKCTRSSGKFRKFLEDCYENPVVERLDLPSFLLSPVQRLPRYIL
LLRELLKYTDEDHPDCYFISQAMKEMESLISSLNSSIHQSMEFYSASETR
RKKMSRQFTSKKRKQRASSTILRNNKNMKPVSENKSDNDQGYCSFGERKD
ESPEDESGRKPRSSSTLKNHPGKRSMSVISNASDDSTKQVIRRKNDLQLT
GRNTDTRKSWRRSIGAVFSHLWSNKDGEETSSQMDTSDNLDXLVKQRWRR
NFLTNGYFRQFRHYVIK
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000868XLOC_000868Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001672TCONS_00001672Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000219DH-domain
IPR001331GDS_CDC24_CS
Vocabulary: Biological Process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0035556intracellular signal transduction
Vocabulary: Molecular Function
TermDefinition
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0005085guanyl-nucleotide exchange factor activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0035556 intracellular signal transduction
biological_process GO:0035023 regulation of Rho protein signal transduction
molecular_function GO:0005085 guanyl-nucleotide exchange factor activity
molecular_function GO:0005089 Rho guanyl-nucleotide exchange factor activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 223..250
NoneNo IPR availableGENE3D1.20.900.10coord: 216..452
e-value: 1.1E-53
score: 181.3
NoneNo IPR availableCDDcd00160RhoGEFcoord: 249..427
e-value: 1.66709E-38
score: 138.97
IPR000219Dbl homology (DH) domainSMARTSM00325RhoGEF_3coord: 252..435
e-value: 2.4E-47
score: 173.3
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 252..434
e-value: 1.1E-46
score: 159.3
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 248..436
score: 33.871
IPR000219Dbl homology (DH) domainSUPERFAMILY48065DBL homology domain (DH-domain)coord: 241..440
IPR001331Guanine-nucleotide dissociation stimulator, CDC24, conserved sitePROSITEPS00741DH_1coord: 384..409

Blast
BLAST of TCONS_00001672-protein vs. Swiss-Prot (Human)
Match: ARHGA (Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4)

HSP 1 Score: 101.679 bits (252), Expect = 3.202e-22
Identity = 62/194 (31.96%), Postives = 113/194 (58.25%), Query Frame = 0
Query:  244 RRETKRLLIIEEILETEKNYISCLGTLDLVFRSHLKD--ANIITEKDLNSLFPSHLQDIKQAHALFMEDLEERMNNDDWRGIIGDIFAKMTSASVNLLEMYTMYVNSFPKAISTLSKCTRSSGKFRKFLEDCYE-NPVVERLDLPSFLLSPVQRLPRYILLLRELLKYTDEDHPDCYFISQAMKEMESLISSLN 434
            +++  R  I+  ++++EKNY+  L  +   +   L +    +++E+ L ++F   +++I Q H+LF   L  R++  D   +IGD+F    S S+ +L+ Y+ YVN+F  A++ L K   +   F +FL+   E +P  +R  L S ++ P+QR P++ILLL+++LK T + HPD   +  A+ E+E+L   LN
Sbjct:  417 QQQVVRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVF-YRVKEILQCHSLFQIALASRVSEWDSVEMIGDVFVASFSKSM-VLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKQEQEASP--DRTTLYSLMMKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLN 606          
The following BLAST results are available for this feature:
BLAST of TCONS_00001672-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ARHGA3.202e-2231.96Rho guanine nucleotide exchange factor 10 OS=Homo ... [more]
back to top