Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001661 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001661
Unique NameTCONS_00001661
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3156

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001661 ID=TCONS_00001661|Name=TCONS_00001661|organism=Clytia hemisphaerica|type=transcript|length=3156bp
ttctctaaattgatattttttctaaatttaatttttcttactaaaattaa
atattttttttctaaaattaaatatttttttctcgatggcacttctcggc
ttccataataaagatagtattgtttcagTTAAGATGATGTTTTTTTGgga
agatagtgtcgcgaactgaaagatagtgtcgcgaactgaaagatagtgtc
gcgaactgaaagatagtgccgcgaaatgaaagatagtgccgcgaaatgaa
agatagtgccgcgaaatgaaagatagtgccgcgaaatgaaagatagtgcc
gcgaaatgaaagatagtgccgcgaaatgaaagatagtgccgcgaaatgaa
agatagtgccgcgaaatgaaagaaagtgccgcgaaatgaaagatagtgtc
gcgaaatgaaagatagtgccgcgaaatgaaagatagtatttatttccgct
ttggcgcgccatattaATTTTCGGAAAAGCTAAAGATGTCAAGAGTTCAA
AGGTCAGCTTCATGACACGCGCAGAGCTGGAAGCAGCGCCAGTGACCAGT
CGTGCTCAACTAAGCCAAATATGTCCGAGAATCTCATTATAATTCAGGTA
CTGTGAGCTTTTTGTGAATATTATGTAAAGTAGTATTTTCTGATTGAAGC
CGACTGAGACAAAAACTGACCGAGCTCAAAACACAAAATCGCTTGTGTGC
GGTGCTGATAATATCCAaaggcaaggtggttttttcaAATCTCTGTGTTA
TTTAATGGTTTACTGAATCAAGCAATCATGGGCCTGGTTGATAGTTTGAT
CACAAAGTTAACCTCATGTGTTTTAACATGTCCACTGACCAGCCTTTTTA
TTGCAGTTGTTTTGGGACTTGTCCTCTACATCATGCAGAAACTCAAACCA
AAAGGCAGGAATCCTTTCAATGTGAATTCAGTGAGACCAAAAGAAGGATT
ggaaaatgatttgaaaaaaagggATGCTGTTTTGAAGCAGggATTTACAT
CAAAGAAGGTTCCAGAGGATCTTGATGCTATTGTTGTTGGTAGTGGTATA
GGAGGGTTATCATGTGCCGCTCTTCTCGCCAAAGCTGGAAGAAAAGTGCT
TGTCCTTGAACAGCATGATCAAGCAGGAGGCTGTTGTCATACATTCATAG
AAAAAGGTTTTGAATTCGACGTTGGTATTCACTATATTGGTGAATGTGCT
AACAACACTTTGACTCATACCTTTGTCAATCAAATCACTGAAGGTCAATT
AGAATGGGCACCTGTTGGTGACGTCATCGATAAAGTTGAATTAGgcACTG
GTAAAGACAGAACAACTCATTTGGTCACCAAAGGAAAGGACAACTTTAAA
GCCGAGTTGAAGAAAAGCTTCCCTGCCCCAGAGGACCAGAAATCAATTGA
CCAATTCTTTATTGATATGGGTAGAGTTCGAAGATTATACCCACAGacat
tcattttcaaaatcatcCCACTTTGGTTGTCCCGTTTCTTGCTAAACACT
GGCATTTTCAACTTGTTCTCAGACCTCCCTTACTTTTCCAACCTGTCTCT
AGCTGATTATTTGGATAGTCTGACCAAAAACAAACGATTACAAGGGGCCG
TTGCTTATTCCTATGGAGATTATGGAACTCAACCACGTGAGTCATCTGCT
ATGATGCAATTGATGTTGCTTGCTCACTATATGCATGGTGGATACTATCC
GGTGGGTGGTGCTAGTGAAATTGCTTATAATATCATTCCTGTCATCGAAA
AAGCTGGTGGTAAAGTCTTGGTTCGAGCTCCTGTCACCGAAATCGTCCTT
GATTCATCTGGGAAAGCTATCGGTGTGAAAGTCAAGAAAGGAGGTGAAGA
GCACTTCATTTCTGCACCAATGGTCATCTCTGGAGCTGGTGTCATCAACA
CATTCGAACACATGATCAAAGACCAAAAATCACGCCCGGAATCACTCTTA
AAGAAAGTCAACAGTGGACACGGTGCAGTGTCGATCTTCGCCGGTCTGGA
TGGAACGAATGAAGAATTAAAATTGGAAAATACTAACACGTGGGCAATGG
CTGAACCTGACCTTGACAAAGGATTGGATGATTTCTTGAACACACCAGCT
GAGAAGGTTGGTACTGAGGATATCCCATTGTTGTTCATATCTTTCCCCTC
AACCAAAGATCCAACATGGGACCAACGTTTCCCTGGTAAATCCAACTGCA
CCATTGTTACCCTTGGCAACTGGAAATGGTTCGAAGAATGGGAGGAAGGG
CGTGTTGGGAAACGTGGTCAAGACTATGACGAGTTGAAAACGAGGCTTGC
TGAACGTGCTTGGGAACAAGCATGTCGTTTCTATCCACAAATCAAAGATa
aacgtgtttattttgatgttggAACACCTCTTACCAACAAGTATTATATT
GGTTCCCCTAGAGGTGAGATTTATGGATTAGATCACAATTTAAATCGATT
TAATCTGTCAACAAGCGCTGAGTTACGACCCACTACGAGCATTGACGGGT
TATATCTTACTGGCCAGGATATCTCTACTTGTGGTTTTGCTGGTGGCTTG
TACGCAGGTTTATTAACTGCTGCTGTCATCTTGAATCGTAATTTGATGAG
TGATCTGGTTAACTGTACGAAAGCTACACGAAAGCTGGCCGCACAACGCC
AAAAGAAGAATTGATTGACCTCTAAGAATTTTAATACAAATCAGAAACAG
GACACTATATGAAATTAGCCGACTCTTAATTTAAATGTAGCTTTATTGTA
GATTAAACATTAGccttttgcattttttttctagaatttttttaagTAAA
TCAATATAGTTCAGTTAATATttgtaaatttaaaaatttttccttaTAAC
ATATTTCAAATATTAAGCACGATTTTAGATACATTTCCTCAACAGTTCCA
TTGTATGCATCCAAATTCGTTATTAACGTTTCCGTTTGTCGCTTTAAACG
ATCcctccttttcaaaaagaaagttttCCCAGAAGTGAATTGAAGATGTT
TTTAGTTCCTAACGTTAACCTTTAAAGATGCTTTTTaagctgtttcattt
tatgaTTAATCTTTGTTCTCATAAACATTATGCAGTTTTTGAGACCTTGa
cctattctcaacttcagttgagttagaatctgagaatgtgtgtgtgtctg
tctgtg
Run BLAST on NCBI

protein sequence of TCONS_00001661-protein

>TCONS_00001661-protein ID=TCONS_00001661-protein|Name=TCONS_00001661-protein|organism=Clytia hemisphaerica|type=polypeptide|length=628bp
MGLVDSLITKLTSCVLTCPLTSLFIAVVLGLVLYIMQKLKPKGRNPFNVN
SVRPKEGLENDLKKRDAVLKQGFTSKKVPEDLDAIVVGSGIGGLSCAALL
AKAGRKVLVLEQHDQAGGCCHTFIEKGFEFDVGIHYIGECANNTLTHTFV
NQITEGQLEWAPVGDVIDKVELGTGKDRTTHLVTKGKDNFKAELKKSFPA
PEDQKSIDQFFIDMGRVRRLYPQTFIFKIIPLWLSRFLLNTGIFNLFSDL
PYFSNLSLADYLDSLTKNKRLQGAVAYSYGDYGTQPRESSAMMQLMLLAH
YMHGGYYPVGGASEIAYNIIPVIEKAGGKVLVRAPVTEIVLDSSGKAIGV
KVKKGGEEHFISAPMVISGAGVINTFEHMIKDQKSRPESLLKKVNSGHGA
VSIFAGLDGTNEELKLENTNTWAMAEPDLDKGLDDFLNTPAEKVGTEDIP
LLFISFPSTKDPTWDQRFPGKSNCTIVTLGNWKWFEEWEEGRVGKRGQDY
DELKTRLAERAWEQACRFYPQIKDKRVYFDVGTPLTNKYYIGSPRGEIYG
LDHNLNRFNLSTSAELRPTTSIDGLYLTGQDISTCGFAGGLYAGLLTAAV
ILNRNLMSDLVNCTKATRKLAAQRQKKN
Run BLAST on NCBI

transcript from alignment at sc0000011:395188..404288-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001661 ID=TCONS_00001661|Name=TCONS_00001661|organism=Clytia hemisphaerica|type=transcript|length=9101bp|location=Sequence derived from alignment at sc0000011:395188..404288- (Clytia hemisphaerica)
TTCTCTAAATTGATATTTTTTCTAAATTTAATTTTTCTTACTAAAATTAA ATATTTTTTTTCTAAAATTAAATATTTTTTTCTCGATGGCACTTCTCGGC TTCCATAATAAAGATAGTATTGTTTCAGTTAAGATGATGTTTTTTTGGGA AGATAGTGTCGCGAACTGAAAGATAGTGTCGCGAACTGAAAGATAGTGTC GCGAACTGAAAGATAGTGCCGCGAAATGAAAGATAGTGCCGCGAAATGAA AGATAGTGCCGCGAAATGAAAGATAGTGCCGCGAAATGAAAGATAGTGCC GCGAAATGAAAGATAGTGCCGCGAAATGAAAGATAGTGCCGCGAAATGAA AGATAGTGCCGCGAAATGAAAGAAAGTGCCGCGAAATGAAAGATAGTGTC GCGAAATGAAAGATAGTGCCGCGAAATGAAAGATAGTATTTATTTCCGCT TTGGCGCGCCATATTAATTTTCGGAAAAGCTAAAGATGTCAAGAGTTCAA AGGTCAGCTTCATGACACGCGCAGAGCTGGAAGCAGCGCCAGTGACCAGT CGTGCTCAACTAAGCCAAATATGTCCGAGAATCTCATTATAATTCAGGTA CTGTGAGCTTTTTGTGAATATTATGTAAAGTAGTATTTTCTGATTGAAGC CGACTGAGACAAAAACTGACCGAGCTCAAAACACAAAATCGCTTGTGTGC GGTGCTGATAATATCCAAAGGCAAGGTGGTTTTTTCAAATCTCTGTGTTA TTTAATGGTTTACTGAATCAAGCAATCATGGGCCTGGTTGATAGTTTGAT CACAAAGTTAACCTCATGTGTTTTAACATGTCCACTGACCAGCCTTTTTA TTGCAGTTGTTTTGGGACTTGTCCTCTACATCATGCAGAAACTCAAACCA AAAGGCAGGAATCCTTTCAATGTGAATTCAGTGAGACCAAAAGAAGGATT GGAAAATGATTTGAAAAAAAGGGATGCTGTTTTGAAGCAGGTAAAATTCT ATAAACCCTCATGTCATTTAGTTCTTCCTTTTTCCTGTTTTCCTGTTTTA TACAGTAGGGCAGTCAGGATTTAACCGCCTAAATAGGAACAAATTTTGGG TTTACTAAAAAAGCCATGATTGAAAAGATCAACCGGCCGACTGTTATTAA TTTTGTTAGATCTGATATATAGACCTTTTCGCCTTTTCGTCCGCCATATT GATTTGTATGCAAAAATTATGGTGGCCGAATTGCCGTGGTGAAATTCCCT TAGAAAGTATGCAAAACATATGCAAAAAGAAAGTATTAATATAAAACTTA CATGCATAATTGGCATTATATTAAAGTGTAATCTTGTAGACGAAAGATCA AATTTGCTTCTCTTGAAAACTAAAAACAATTATATTCACTCATCTCTTAG AACAAGTACTTCAAAAGACCATAACATTAGACATAAACTCAAACTGAAAA ATCAGCCGCGAAGGTAAAAAATAATCCTTATTCGGCTAACGGTAAATTAT TCTCCTGGGAATAGAGCCGCCAAATGATCTAATCAAAACATTGATGATGT GTGACGTCATAATTACTGCTTTCAGTTTGCGTGTTTTGAAAGTTTGATGT GTGTACTCCGTCTTTGTGGAATTTTTTAATGGCATGAAAACAAAATATGC TATGTCTTTAAGAACAAATTTCTAAAAGGTTTTTGTTATTCTGTAAATAT TTCTTTTTGGATTAAGAAATTCCATCTTTTATTGTTCTAATGATTATAAT ATTTATTTATAAGATGCTTTGTTGTCTTTTTAATCTTTGTGTAAACTTGC ATATGTTTTGCATACTTTCCAACTAAATCCAACCACGGCATTTTCGTTCC TGTATTTTTGCATACAATTCAAGATGGCGGATGGAAAGGCGAAANAAAGC TCTAAAACAGCATCTAATAACATGAAAACCAGAATATGATTCTTCAATGG GAATCAAAACTACAAAGTGCACTTACAAACATCAATTTGTCAGATCTAAC AAAATTAATAACCGCACTGTCATCATTGACAATAAAACAAACAATTTTCC AACAACTTCCATCGAAATGATCTATCACAGCTCAGTCTACCATTTTTAGC GCTTTTTAGCGCGGTCCGAGGATTGAGCCGAGAACGCTCCGCGAACTCCT GCGCGGGTGAAAAACTTCAATCTGTCAATCATTTTTTCAAGCGAAGAGTA CGCGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAT GTGGCGTTTTTTTGCAAATTTCAAAAAACTGATTTTTGTCCCGCCTTTGC GGGACTTTGGCTTAAGTGCTTGAGTGCAGCATAGGGTACAAAGTCCAAAC ATGGGATTCCCGTAATTTTTGTGTGAAGAGTTAGGTCTATACTGAAAGGT CTATTGATGTTTGTAAGTGCACTTTATAGACCTTTTTTCAAAGAGGCCAC CCTGTTGAATAATCATGTAGTCCAGCAGAAAAACAATGATAAAACCATGC ATAATTATTACAATATGCATGATACAGTAATTATGTATGGCTCTATCATT GTTTTTATGGCTGGAGTACATAATTATTCAAGAGGACGTCCTCTTGAATA ATTATGTACTCCAGCAGAAAAACAAAGATAAAACCATGCATAATTATTGC AATATGCATGATACAGTAATTATGCATGGCTCTATCATTGTTTTTATGGA TGGAGTACATAATTATTCAACAGGACGTCCTCTTTGAAAAAAGGTCTACA GTTTTTATTCCCATTGAAGAATCATATTCTGGTTTTCATGTTATTAGATG CTGTTTTAGAGCTTTAGAGCTAGCCTGTCTAATCTTACCCTGGGTTTACT AAAAAAGCCATGATTGAAAAGATCAACCAGCTCATTTAGCGACATACAGC CATTTGTTTTGAATTTTCCGGTGCCGTAAATCAGCGCTAAGTCGTGTTTT CACCTTGACGTTGAAAAACTTTCACATTTGAAAGATCTTCTATGTGGCGT TTTTTTTGGCAAACATCAAAAAAATGATCTTTGTCCCGCTCTTGCAGGAC TTTAAAGCTTAAAAGTACTTGCATGCAGCATTGGGTACAAAATCCAAATA TGCATTTCCCATAACTTTTAAATTTGAATAGTATAGGGTATAGACAGGAC CAACTCTCAACCACAAAATACATCTTTCTGTCGAAAACATAGTTATTAAG TGTCGAAATCGAACCTTTGTCCGGCTGTACGCCCGCATCCTCTGTGTGTC CCGGGTTTTCAAATATTCAGTAGAATTACATTCAAAGTCACACTAAACAG CGTAAAATGACAAAATACAACCAATTATCATGAGGAAGATGATATATTAA TGATAAAAAAGTAAAATATCAAATATGTTTCTGTAACTTTTCCAATCAAA TAAATGAAGAAAATTTTACTTAGAGAGATAACTCCAGAGGGATCCCGATT GAGAGAACCCCCATTGAAAATCCAAAGTTCAATTTTACACTCGCTTCGCT TGCATCTTATTGTCTCGCATTCAGATTTTGAAACCTGGCAACTATGGTCA AAGGTTCTTCCTTCAAAGAATATCGATCACTTTCGTTTTCCTCTTGAGCA TGTGCAAGAAAAATTATATTATCTCGCACGCAGGGAATAAGAATGAGGAG GAAATCTTTTGCCAAGGAGGCTAAAATTTTAGAAATAAAAGAATAAAAAC TTTGTAATTCATTGCGGGAAATCTAATAATTTTGGAAAACAAAATTCTAT CACACTTATTTGTCTTGCCTGAATATCCAAGCTTTAGATTTCAGAAGAAA TAAAATCTCACATCAACATTCAAAGCTGGCATATTCTGTTTTGACGCAAT CAAAAAATTCCACAAAGATATAGCAAGCACATCAATACATGTAAATTGAA AGCAATAATTATGACATTAAAGTTACACATATTCATACATAGTCAAAATA ATTTAAAGGCCCCACAACTATCAATTCCATCAGTAATTAACAGTAAAATT CTTTGATCTTTGTCTATTTGCTTTCATTTTCATATGTTAGAATTCTTGAA CGGGATATTTAGTTATAAAGAATATAAGTGAAGTACTGAGCATTCTCTAG AGCTCTGCATTCTGTACAATTTGTTCAAAGGTGTGACAAATTAAATTTTT TCTTTTATAAGGGATTTACATCAAAGAAGGTTCCAGAGGATCTTGATGCT ATTGTTGTTGGTAGTGGTATAGGAGGGTTATCATGTGCCGCTCTTCTCGC CAAAGCTGGAAGAAAAGTGCTTGTCCTTGAACAGCATGATCAAGCAGGAG GCTGTTGTCATACATTCATAGAAAAAGGTAATGCTCTTTACACAGTGTTG TTGATACACTGTGTAAATATTTTTCAATACTTTTGAGTAAAAAAGTAACG TCAAGATATCTTTCAACCAGGTAGAAATATTTAAGTGCTTACTCTAAATA CTCTGACTGAAAACACAAGCAAGGCTCCAGAACTCAGAAAGAATGATATT ACAATGCTTTAAATGGTTAAGAAATGATAAAAAAATTGAAATCTACTAAG TCAAATCTAAATGTTTAGCACATCTCCATCATCCTGAGAAATTTGATTTT AACTTCTAGGTTTTGAATTCGACGTTGGTATTCACTATATTGGTGAATGT GCTAACAACACTTTGACTCATACCTTTGTCAATCAAATCACTGAAGGTCA ATTAGAATGGGCACCTGTTGGTGACGTCATCGATAAAGTTGAATTAGGTG GGTAATATTTTATTACTTTGTTTTATGTCAGCTTTATGTCAGTATTTTAT CATTTCTTGATATTATCTAAAGGTGATTTCTGATTTCTTTTGCAAATATT CACATTATATTAGCTTATAATGTAATTGAGTCCGATTTTAAGGAATTTTT TTCCAGCGGGAAATACCGAAAAGATGTGGGGAAACCGCCCTTTTTGCAGA TTTTGATTAGAATTTGCACGAAAACATTTATGATTGTCCAAGATTTTAGC ATTGTTCAATTTTAAATGAATTAGTTTTTGTAACAAGAACTTTCTAACTT TCTTTAAAATCTTTCGAGTCTGACTCTCTCGGGAAATTATTTTCTGGCCA GAAATGCCCAAAAAATGCTATTTTTTTTTCAATTTTCATGAGCTTTTTCC TAATATTACATTATACTAAAGTCTTCATATCAACAAGATTCAGAACGGTT CATATTCATTAGAATTGATTTTTGTCGTCTATTCTTGAGCGTCTCTATCA GGAAGGTTGGGTCTAACTTGTTCTTAATCAATCTCCAATTTATGTATTTA CCTGAAAATAAAAGGATTCCTGGAAAAAGTGTCAGATTACTGCGAAATTA ATGTCCGTAAAAAGCACTCATTAATTACCTTCGCATCTGAAAGCTAGTTC CGCAAAATAAATATTTTCAATAAAATACTGTAGTTCCCTTTCAAAATCAA TCGCAAAAGTTCTGTAAAAAACACTCGTTATAATACCCTCTGACGTGCAA TCCAGTTCAATAAAATACCTAGTTTTAGTAAAAGCAGTTCCCTTTGAAAA TTAATCAATCAATCAATCTAAACGAAGTAAAGCTAATGACTGAGGGTTTT CCAACCTTTCTACTTGCCAGAAAAGTTTATCATTCTCACAACATGTTTTT TATTTTAGGCACTGGTAAAGACAGAACAACTCATTTGGTCACCAAAGGAA AGGACAACTTTAAAGCCGAGTTGAAGAAAAGCTTCCCTGCCCCAGAGGAC CAGAAATCAATTGACCAATTCTTTATTGATATGGGTGTAAGTTTAAAAAA ACCTGAAAATTCTGGAAAATTGGATTCTTCACGAATAAGACTACTTCTTG AACTTTGAATCTAACTATGAAATTTTTACACTCATTTGTTCTTCTGGTCC TGAAATTTGAAGTCTCCATATCTTGATATCCATGATTTGTAATTTTTTAG AAAAATCATGCTAAGTCTGTTTTCATGGAATATGAACCTTAAATTCCAGA GCGTAGAACAAACAAATTACAAATGTTCTGGTACAATTTAGCTCGAAAAC TTGATCGAAAGTTAACAATTCTATATTACTAAATCCGAGATTCGAAAAAA AAAACATTAATACTTTTAGATATTTATCATAAATGTTCTTTCTTCTTTTT TTACAGAGAGTTCGAAGATTATACCCACAGACATTCATTTTCAAAATCAT CCCACTTTGGTTGTCCCGTTTCTTGCTAAACACTGGCATTTTCAACTTGT TCTCAGACCTCCCTTACTTTTCCAACCTGTCTCTAGCTGATTATTTGGAT AGTCTGACCAAAAACAAACGATTACAAGGGGCCGTTGCTTATTCCTATGG AGATTATGGTGAGAGTTGAATTTAACAAAATCTCTATTATTTTGCTAAAC TACTTCAGATTTGTAAACAATTATAAATTCTACTCAAGACTGTGGAAGGA CTCAACAGGTCAAATACAGGCTTTTTTCTAAGAATAGTGTTTTTCCATTT CATCATGGATATTCTTAACTTTTTCGAGATGATCATTCTAAATCATTCTT ACGGTATTCTTAGGTTAGAATCCAAATTTAACCTAAATTTGGCATATAAT ACGTACCTAAAGCATAAAATGGCATTTTCAGGAAAGTTTTGACCATTTTT GGGTAACACATTCTCAGCATATTCTTAATTTTTTTGGCCAATTTCATGAT GAATATTCTTATAGAGTATATTCTTTTAAAAAACTTGTATTCCTTCCATT ATGTTTCAATATTAGACAAATACTAAACTAAAATAAAATCTTAACATCTG CTTGTATTCACTTCTAGGAACTCAACCACGTGAGTCATCTGCTATGATGC AATTGATGTTGCTTGCTCACTATATGCATGGTGGATACTATCCGGTGGGT GGTGCTAGTGAAATTGCTTATAATATCATTCCTGTCATCGAAAAAGCTGG TGGTAAAGTCTTGGTTCGAGCTCCTGTCACCGAAATCGTCCTTGATTCAT CTGGGAAAGCTATCGGTAAGGCTAAAGGCTGTTTGTAAAAGGGCAATAAA CATGACCTCTAATGCGGCGTATCTTACTCTCAAAAAGACTCCCTACTTTG CTAATGTTGGTAGAATTTTGCTTGTTTATGTTTCTTTATCGATTTGATGA GATAGAAACATTGGACACTTGGTCTTTAGGGGGTCCTAAAAGAGCTTTTC TTTGCAATAACTGTACCTTAGAGTACCATAGAGGGATGACATGTTTCGAG AACTGATGAAAAATGTGCACTCTTTATTTGTTACCGTGTGTGAACCACTA TCAAGGGAATTAGCCTACTTACATTGACATCGTATCCACTTGAAAGTTGA AAAGGGCCACGTATTTATCGTAAACTTTAGTATCTTTCAGTATTAAATTA AGATGTTTTAGATTGTTACTGCTCTCCAAAAACTTACTCCATTAATAAAG CAACATCTTGTATTTTAACTATAAAGTCTACATAAATATGATCAACATTA ATATGTTTCTTCCCTAGGTGTGAAAGTCAAGAAAGGAGGTGAAGAGCACT TCATTTCTGCACCAATGGTCATCTCTGGAGCTGGTGTCATCAACACATTC GAACACATGATCAAAGACCAAAAATCACGCCCGGAATCACTCTTAAAGAA AGTCAACAGTGGACACGGTGCAGTGTCGATCTTCGCCGGTCTGGATGGAA CGAATGAAGAATTAAAATTGGAAAATACTAACACGTGGGCAATGGCTGAA CCTGACCTTGACAAAGGATTGGATGATTTCTTGAACACACCAGCTGAGAA GGTTGGTACTGAGGATATCCCATTGTTGTTCATATCTTTCCCCTCAACCA AAGATCCAACATGGGACCAACGTTTCCCTGGTAAATCCAACTGCACCATT GTTACCCTTGGCAACTGGAAATGGTTCGAAGAATGGGAGGAAGGGCGTGT TGGGAAACGTGGTCAAGACTATGACGAGTTGAAAACGAGGCTTGCTGAAC GTGCTTGGGAACAAGCATGTCGTTTCTATCCACAAATCAAAGATAAACGT GTTTATTTTGATGTTGGAACACCTCTTACCAACAAGTATTATATTGGTTC CCCTAGAGGTGAGATTTATGGATTAGATCACAATTTAAATCGATTTAATC TGTCAACAAGCGCTGAGTTACGACCCACTACGAGCATTGACGGGTTATAT CTTACTGGCCAGGATATCTCTACTTGTGGTTTTGCTGGTGGCTTGTACGC AGGTTTATTAACTGCTGCTGTCATCTTGAATCGTAATTTGATGAGTGATC TGGTTAACTGTACGAAAGCTACACGAAAGCTGGCCGCACAACGCCAAAAG AAGAATTGATTGACCTCTAAGAATTTTAATACAAATCAGAAACAGGACAC TATATGAAATTAGCCGACTCTTAATTTAAATGTAGCTTTATTGTAGATTA AACATTAGCCTTTTGCATTTTTTTTCTAGAATTTTTTTAAGTAAATCAAT ATAGTTCAGTTAATATTTGTAAATTTAAAAATTTTTCCTTATAACATATT TCAAATATTAAGCACGATTTTAGATACATTTCCTCAACAGTTCCATTGTA TGCATCCAAATTCGTTATTAACGTTTCCGTTTGTCGCTTTAAACGATCCC TCCTTTTCAAAAAGAAAGTTTTCCCAGAAGTGAATTGAAGATGTTTTTAG TTCCTAACGTTAACCTTTAAAGATGCTTTTTAAGCTGTTTCATTTTATGA TTAATCTTTGTTCTCATAAACATTATGCAGTTTTTGAGACCTTGACCTAT TCTCAACTTCAGTTGAGTTAGAATCTGAGAATGTGTGTGTGTCTGTCTGT G

Coding sequence (CDS) from alignment at sc0000011:395188..404288-

>TCONS_00001661 ID=TCONS_00001661|Name=TCONS_00001661|organism=Clytia hemisphaerica|type=CDS|length=13209bp|location=Sequence derived from alignment at sc0000011:395188..404288- (Clytia hemisphaerica)
GTGTGAAAGTCAAGAAAGGAGGTGAAGAGCACTTCATTTCTGCACCAATG
GTCATCTCTGGAGCTGGTGTCATCAACACATTCGAACACATGATCAAAGA
CCAAAAATCACGCCCGGAATCACTCTTAAAGAAAGTCAACAGTGGACACG
GTGCAGTGTCGATCTTCGCCGGTCTGGATGGAACGAATGAAGAATTAAAA
TTGGAAAATACTAACACGTGGGCAATGGCTGAACCTGACCTTGACAAAGG
ATTGGATGATTTCTTGAACACACCAGCTGAGAAGGTTGGTACTGAGGATA
TCCCATTGTTGTTCATATCTTTCCCCTCAACCAAAGATCCAACATGGGAC
CAACGTTTCCCTGGTAAATCCAACTGCACCATTGTTACCCTTGGCAACTG
GAAATGGTTCGAAGAATGGGAGGAAGGGCGTGTTGGGAAACGTGGTCAAG
ACTATGACGAGTTGAAAACGAGGCTTGCTGAACGTGCTTGGGAACAAGCA
TGTCGTTTCTATCCACAAATCAAAGATAAACGTGTTTATTTTGATGTTGG
AACACCTCTTACCAACAAGTATTATATTGGTTCCCCTAGAGGTGAGATTT
ATGGATTAGATCACAATTTAAATCGATTTAATCTGTCAACAAGCGCTGAG
TTACGACCCACTACGAGCATTGACGGGTTATATCTTACTGGCCAGGATAT
CTCTACTTGTGGTTTTGCTGGTGGCTTGTACGCAGGTTTATTAACTGCTG
CTGTCATCTTGAATCGTAATTTGATGAGTGATCTGGTTAACTGTACGAAA
GCTACACGAAAGCTGGCCGCACAACGCCAAAAGAAGAATTGAGAACTCAA
CCACGTGAGTCATCTGCTATGATGCAATTGATGTTGCTTGCTCACTATAT
GCATGGTGGATACTATCCGGTGGGTGGTGCTAGTGAAATTGCTTATAATA
TCATTCCTGTCATCGAAAAAGCTGGTGGTAAAGTCTTGGTTCGAGCTCCT
GTCACCGAAATCGTCCTTGATTCATCTGGGAAAGCTATCGAGAGTTCGAA
GATTATACCCACAGACATTCATTTTCAAAATCATCCCACTTTGGTTGTCC
CGTTTCTTGCTAAACACTGGCATTTTCAACTTGTTCTCAGACCTCCCTTA
CTTTTCCAACCTGTCTCTAGCTGATTATTTGGATAGTCTGACCAAAAACA
AACGATTACAAGGGGCCGTTGCTTATTCCTATGGAGATTATGGCACTGGT
AAAGACAGAACAACTCATTTGGTCACCAAAGGAAAGGACAACTTTAAAGC
CGAGTTGAAGAAAAGCTTCCCTGCCCCAGAGGACCAGAAATCAATTGACC
AATTCTTTATTGATATGGGTGTTTTGAATTCGACGTTGGTATTCACTATA
TTGGTGAATGTGCTAACAACACTTTGACTCATACCTTTGTCAATCAAATC
ACTGAAGGTCAATTAGAATGGGCACCTGTTGGTGACGTCATCGATAAAGT
TGAATTAGGGATTTACATCAAAGAAGGTTCCAGAGGATCTTGATGCTATT
GTTGTTGGTAGTGGTATAGGAGGGTTATCATGTGCCGCTCTTCTCGCCAA
AGCTGGAAGAAAAGTGCTTGTCCTTGAACAGCATGATCAAGCAGGAGGCT
GTTGTCATACATTCATAGAAAAAGATGGGCCTGGTTGATAGTTTGATCAC
AAAGTTAACCTCATGTGTTTTAACATGTCCACTGACCAGCCTTTTTATTG
CAGTTGTTTTGGGACTTGTCCTCTACATCATGCAGAAACTCAAACCAAAA
GGCAGGAATCCTTTCAATGTGAATTCAGTGAGACCAAAAGAAGGATTGGA
AAATGATTTGAAAAAAAGGGATGCTGTTTTGAAGCAGGTGTGAAAGTCAA
GAAAGGAGGTGAAGAGCACTTCATTTCTGCACCAATGGTCATCTCTGGAG
CTGGTGTCATCAACACATTCGAACACATGATCAAAGACCAAAAATCACGC
CCGGAATCACTCTTAAAGAAAGTCAACAGTGGACACGGTGCAGTGTCGAT
CTTCGCCGGTCTGGATGGAACGAATGAAGAATTAAAATTGGAAAATACTA
ACACGTGGGCAATGGCTGAACCTGACCTTGACAAAGGATTGGATGATTTC
TTGAACACACCAGCTGAGAAGGTTGGTACTGAGGATATCCCATTGTTGTT
CATATCTTTCCCCTCAACCAAAGATCCAACATGGGACCAACGTTTCCCTG
GTAAATCCAACTGCACCATTGTTACCCTTGGCAACTGGAAATGGTTCGAA
GAATGGGAGGAAGGGCGTGTTGGGAAACGTGGTCAAGACTATGACGAGTT
GAAAACGAGGCTTGCTGAACGTGCTTGGGAACAAGCATGTCGTTTCTATC
CACAAATCAAAGATAAACGTGTTTATTTTGATGTTGGAACACCTCTTACC
AACAAGTATTATATTGGTTCCCCTAGAGGTGAGATTTATGGATTAGATCA
CAATTTAAATCGATTTAATCTGTCAACAAGCGCTGAGTTACGACCCACTA
CGAGCATTGACGGGTTATATCTTACTGGCCAGGATATCTCTACTTGTGGT
TTTGCTGGTGGCTTGTACGCAGGTTTATTAACTGCTGCTGTCATCTTGAA
TCGTAATTTGATGAGTGATCTGGTTAACTGTACGAAAGCTACACGAAAGC
TGGCCGCACAACGCCAAAAGAAGAATTGAGAACTCAACCACGTGAGTCAT
CTGCTATGATGCAATTGATGTTGCTTGCTCACTATATGCATGGTGGATAC
TATCCGGTGGGTGGTGCTAGTGAAATTGCTTATAATATCATTCCTGTCAT
CGAAAAAGCTGGTGGTAAAGTCTTGGTTCGAGCTCCTGTCACCGAAATCG
TCCTTGATTCATCTGGGAAAGCTATCGAGAGTTCGAAGATTATACCCACA
GACATTCATTTTCAAAATCATCCCACTTTGGTTGTCCCGTTTCTTGCTAA
ACACTGGCATTTTCAACTTGTTCTCAGACCTCCCTTACTTTTCCAACCTG
TCTCTAGCTGATTATTTGGATAGTCTGACCAAAAACAAACGATTACAAGG
GGCCGTTGCTTATTCCTATGGAGATTATGGCACTGGTAAAGACAGAACAA
CTCATTTGGTCACCAAAGGAAAGGACAACTTTAAAGCCGAGTTGAAGAAA
AGCTTCCCTGCCCCAGAGGACCAGAAATCAATTGACCAATTCTTTATTGA
TATGGGTGTTTTGAATTCGACGTTGGTATTCACTATATTGGTGAATGTGC
TAACAACACTTTGACTCATACCTTTGTCAATCAAATCACTGAAGGTCAAT
TAGAATGGGCACCTGTTGGTGACGTCATCGATAAAGTTGAATTAGGGATT
TACATCAAAGAAGGTTCCAGAGGATCTTGATGCTATTGTTGTTGGTAGTG
GTATAGGAGGGTTATCATGTGCCGCTCTTCTCGCCAAAGCTGGAAGAAAA
GTGCTTGTCCTTGAACAGCATGATCAAGCAGGAGGCTGTTGTCATACATT
CATAGAAAAAGATGGGCCTGGTTGATAGTTTGATCACAAAGTTAACCTCA
TGTGTTTTAACATGTCCACTGACCAGCCTTTTTATTGCAGTTGTTTTGGG
ACTTGTCCTCTACATCATGCAGAAACTCAAACCAAAAGGCAGGAATCCTT
TCAATGTGAATTCAGTGAGACCAAAAGAAGGATTGGAAAATGATTTGAAA
AAAAGGGATGCTGTTTTGAAGCAGGTGTGAAAGTCAAGAAAGGAGGTGAA
GAGCACTTCATTTCTGCACCAATGGTCATCTCTGGAGCTGGTGTCATCAA
CACATTCGAACACATGATCAAAGACCAAAAATCACGCCCGGAATCACTCT
TAAAGAAAGTCAACAGTGGACACGGTGCAGTGTCGATCTTCGCCGGTCTG
GATGGAACGAATGAAGAATTAAAATTGGAAAATACTAACACGTGGGCAAT
GGCTGAACCTGACCTTGACAAAGGATTGGATGATTTCTTGAACACACCAG
CTGAGAAGGTTGGTACTGAGGATATCCCATTGTTGTTCATATCTTTCCCC
TCAACCAAAGATCCAACATGGGACCAACGTTTCCCTGGTAAATCCAACTG
CACCATTGTTACCCTTGGCAACTGGAAATGGTTCGAAGAATGGGAGGAAG
GGCGTGTTGGGAAACGTGGTCAAGACTATGACGAGTTGAAAACGAGGCTT
GCTGAACGTGCTTGGGAACAAGCATGTCGTTTCTATCCACAAATCAAAGA
TAAACGTGTTTATTTTGATGTTGGAACACCTCTTACCAACAAGTATTATA
TTGGTTCCCCTAGAGGTGAGATTTATGGATTAGATCACAATTTAAATCGA
TTTAATCTGTCAACAAGCGCTGAGTTACGACCCACTACGAGCATTGACGG
GTTATATCTTACTGGCCAGGATATCTCTACTTGTGGTTTTGCTGGTGGCT
TGTACGCAGGTTTATTAACTGCTGCTGTCATCTTGAATCGTAATTTGATG
AGTGATCTGGTTAACTGTACGAAAGCTACACGAAAGCTGGCCGCACAACG
CCAAAAGAAGAATTGAGAACTCAACCACGTGAGTCATCTGCTATGATGCA
ATTGATGTTGCTTGCTCACTATATGCATGGTGGATACTATCCGGTGGGTG
GTGCTAGTGAAATTGCTTATAATATCATTCCTGTCATCGAAAAAGCTGGT
GGTAAAGTCTTGGTTCGAGCTCCTGTCACCGAAATCGTCCTTGATTCATC
TGGGAAAGCTATCGAGAGTTCGAAGATTATACCCACAGACATTCATTTTC
AAAATCATCCCACTTTGGTTGTCCCGTTTCTTGCTAAACACTGGCATTTT
CAACTTGTTCTCAGACCTCCCTTACTTTTCCAACCTGTCTCTAGCTGATT
ATTTGGATAGTCTGACCAAAAACAAACGATTACAAGGGGCCGTTGCTTAT
TCCTATGGAGATTATGGCACTGGTAAAGACAGAACAACTCATTTGGTCAC
CAAAGGAAAGGACAACTTTAAAGCCGAGTTGAAGAAAAGCTTCCCTGCCC
CAGAGGACCAGAAATCAATTGACCAATTCTTTATTGATATGGGTGTTTTG
AATTCGACGTTGGTATTCACTATATTGGTGAATGTGCTAACAACACTTTG
ACTCATACCTTTGTCAATCAAATCACTGAAGGTCAATTAGAATGGGCACC
TGTTGGTGACGTCATCGATAAAGTTGAATTAGGGATTTACATCAAAGAAG
GTTCCAGAGGATCTTGATGCTATTGTTGTTGGTAGTGGTATAGGAGGGTT
ATCATGTGCCGCTCTTCTCGCCAAAGCTGGAAGAAAAGTGCTTGTCCTTG
AACAGCATGATCAAGCAGGAGGCTGTTGTCATACATTCATAGAAAAAGAT
GGGCCTGGTTGATAGTTTGATCACAAAGTTAACCTCATGTGTTTTAACAT
GTCCACTGACCAGCCTTTTTATTGCAGTTGTTTTGGGACTTGTCCTCTAC
ATCATGCAGAAACTCAAACCAAAAGGCAGGAATCCTTTCAATGTGAATTC
AGTGAGACCAAAAGAAGGATTGGAAAATGATTTGAAAAAAAGGGATGCTG
TTTTGAAGCAGGTGTGAAAGTCAAGAAAGGAGGTGAAGAGCACTTCATTT
CTGCACCAATGGTCATCTCTGGAGCTGGTGTCATCAACACATTCGAACAC
ATGATCAAAGACCAAAAATCACGCCCGGAATCACTCTTAAAGAAAGTCAA
CAGTGGACACGGTGCAGTGTCGATCTTCGCCGGTCTGGATGGAACGAATG
AAGAATTAAAATTGGAAAATACTAACACGTGGGCAATGGCTGAACCTGAC
CTTGACAAAGGATTGGATGATTTCTTGAACACACCAGCTGAGAAGGTTGG
TACTGAGGATATCCCATTGTTGTTCATATCTTTCCCCTCAACCAAAGATC
CAACATGGGACCAACGTTTCCCTGGTAAATCCAACTGCACCATTGTTACC
CTTGGCAACTGGAAATGGTTCGAAGAATGGGAGGAAGGGCGTGTTGGGAA
ACGTGGTCAAGACTATGACGAGTTGAAAACGAGGCTTGCTGAACGTGCTT
GGGAACAAGCATGTCGTTTCTATCCACAAATCAAAGATAAACGTGTTTAT
TTTGATGTTGGAACACCTCTTACCAACAAGTATTATATTGGTTCCCCTAG
AGGTGAGATTTATGGATTAGATCACAATTTAAATCGATTTAATCTGTCAA
CAAGCGCTGAGTTACGACCCACTACGAGCATTGACGGGTTATATCTTACT
GGCCAGGATATCTCTACTTGTGGTTTTGCTGGTGGCTTGTACGCAGGTTT
ATTAACTGCTGCTGTCATCTTGAATCGTAATTTGATGAGTGATCTGGTTA
ACTGTACGAAAGCTACACGAAAGCTGGCCGCACAACGCCAAAAGAAGAAT
TGAGAACTCAACCACGTGAGTCATCTGCTATGATGCAATTGATGTTGCTT
GCTCACTATATGCATGGTGGATACTATCCGGTGGGTGGTGCTAGTGAAAT
TGCTTATAATATCATTCCTGTCATCGAAAAAGCTGGTGGTAAAGTCTTGG
TTCGAGCTCCTGTCACCGAAATCGTCCTTGATTCATCTGGGAAAGCTATC
GAGAGTTCGAAGATTATACCCACAGACATTCATTTTCAAAATCATCCCAC
TTTGGTTGTCCCGTTTCTTGCTAAACACTGGCATTTTCAACTTGTTCTCA
GACCTCCCTTACTTTTCCAACCTGTCTCTAGCTGATTATTTGGATAGTCT
GACCAAAAACAAACGATTACAAGGGGCCGTTGCTTATTCCTATGGAGATT
ATGGCACTGGTAAAGACAGAACAACTCATTTGGTCACCAAAGGAAAGGAC
AACTTTAAAGCCGAGTTGAAGAAAAGCTTCCCTGCCCCAGAGGACCAGAA
ATCAATTGACCAATTCTTTATTGATATGGGTGTTTTGAATTCGACGTTGG
TATTCACTATATTGGTGAATGTGCTAACAACACTTTGACTCATACCTTTG
TCAATCAAATCACTGAAGGTCAATTAGAATGGGCACCTGTTGGTGACGTC
ATCGATAAAGTTGAATTAGGGATTTACATCAAAGAAGGTTCCAGAGGATC
TTGATGCTATTGTTGTTGGTAGTGGTATAGGAGGGTTATCATGTGCCGCT
CTTCTCGCCAAAGCTGGAAGAAAAGTGCTTGTCCTTGAACAGCATGATCA
AGCAGGAGGCTGTTGTCATACATTCATAGAAAAAGATGGGCCTGGTTGAT
AGTTTGATCACAAAGTTAACCTCATGTGTTTTAACATGTCCACTGACCAG
CCTTTTTATTGCAGTTGTTTTGGGACTTGTCCTCTACATCATGCAGAAAC
TCAAACCAAAAGGCAGGAATCCTTTCAATGTGAATTCAGTGAGACCAAAA
GAAGGATTGGAAAATGATTTGAAAAAAAGGGATGCTGTTTTGAAGCAGGT
GTGAAAGTCAAGAAAGGAGGTGAAGAGCACTTCATTTCTGCACCAATGGT
CATCTCTGGAGCTGGTGTCATCAACACATTCGAACACATGATCAAAGACC
AAAAATCACGCCCGGAATCACTCTTAAAGAAAGTCAACAGTGGACACGGT
GCAGTGTCGATCTTCGCCGGTCTGGATGGAACGAATGAAGAATTAAAATT
GGAAAATACTAACACGTGGGCAATGGCTGAACCTGACCTTGACAAAGGAT
TGGATGATTTCTTGAACACACCAGCTGAGAAGGTTGGTACTGAGGATATC
CCATTGTTGTTCATATCTTTCCCCTCAACCAAAGATCCAACATGGGACCA
ACGTTTCCCTGGTAAATCCAACTGCACCATTGTTACCCTTGGCAACTGGA
AATGGTTCGAAGAATGGGAGGAAGGGCGTGTTGGGAAACGTGGTCAAGAC
TATGACGAGTTGAAAACGAGGCTTGCTGAACGTGCTTGGGAACAAGCATG
TCGTTTCTATCCACAAATCAAAGATAAACGTGTTTATTTTGATGTTGGAA
CACCTCTTACCAACAAGTATTATATTGGTTCCCCTAGAGGTGAGATTTAT
GGATTAGATCACAATTTAAATCGATTTAATCTGTCAACAAGCGCTGAGTT
ACGACCCACTACGAGCATTGACGGGTTATATCTTACTGGCCAGGATATCT
CTACTTGTGGTTTTGCTGGTGGCTTGTACGCAGGTTTATTAACTGCTGCT
GTCATCTTGAATCGTAATTTGATGAGTGATCTGGTTAACTGTACGAAAGC
TACACGAAAGCTGGCCGCACAACGCCAAAAGAAGAATTGAGAACTCAACC
ACGTGAGTCATCTGCTATGATGCAATTGATGTTGCTTGCTCACTATATGC
ATGGTGGATACTATCCGGTGGGTGGTGCTAGTGAAATTGCTTATAATATC
ATTCCTGTCATCGAAAAAGCTGGTGGTAAAGTCTTGGTTCGAGCTCCTGT
CACCGAAATCGTCCTTGATTCATCTGGGAAAGCTATCGAGAGTTCGAAGA
TTATACCCACAGACATTCATTTTCAAAATCATCCCACTTTGGTTGTCCCG
TTTCTTGCTAAACACTGGCATTTTCAACTTGTTCTCAGACCTCCCTTACT
TTTCCAACCTGTCTCTAGCTGATTATTTGGATAGTCTGACCAAAAACAAA
CGATTACAAGGGGCCGTTGCTTATTCCTATGGAGATTATGGCACTGGTAA
AGACAGAACAACTCATTTGGTCACCAAAGGAAAGGACAACTTTAAAGCCG
AGTTGAAGAAAAGCTTCCCTGCCCCAGAGGACCAGAAATCAATTGACCAA
TTCTTTATTGATATGGGTGTTTTGAATTCGACGTTGGTATTCACTATATT
GGTGAATGTGCTAACAACACTTTGACTCATACCTTTGTCAATCAAATCAC
TGAAGGTCAATTAGAATGGGCACCTGTTGGTGACGTCATCGATAAAGTTG
AATTAGGGATTTACATCAAAGAAGGTTCCAGAGGATCTTGATGCTATTGT
TGTTGGTAGTGGTATAGGAGGGTTATCATGTGCCGCTCTTCTCGCCAAAG
CTGGAAGAAAAGTGCTTGTCCTTGAACAGCATGATCAAGCAGGAGGCTGT
TGTCATACATTCATAGAAAAAGATGGGCCTGGTTGATAGTTTGATCACAA
AGTTAACCTCATGTGTTTTAACATGTCCACTGACCAGCCTTTTTATTGCA
GTTGTTTTGGGACTTGTCCTCTACATCATGCAGAAACTCAAACCAAAAGG
CAGGAATCCTTTCAATGTGAATTCAGTGAGACCAAAAGAAGGATTGGAAA
ATGATTTGAAAAAAAGGGATGCTGTTTTGAAGCAGGTGTGAAAGTCAAGA
AAGGAGGTGAAGAGCACTTCATTTCTGCACCAATGGTCATCTCTGGAGCT
GGTGTCATCAACACATTCGAACACATGATCAAAGACCAAAAATCACGCCC
GGAATCACTCTTAAAGAAAGTCAACAGTGGACACGGTGCAGTGTCGATCT
TCGCCGGTCTGGATGGAACGAATGAAGAATTAAAATTGGAAAATACTAAC
ACGTGGGCAATGGCTGAACCTGACCTTGACAAAGGATTGGATGATTTCTT
GAACACACCAGCTGAGAAGGTTGGTACTGAGGATATCCCATTGTTGTTCA
TATCTTTCCCCTCAACCAAAGATCCAACATGGGACCAACGTTTCCCTGGT
AAATCCAACTGCACCATTGTTACCCTTGGCAACTGGAAATGGTTCGAAGA
ATGGGAGGAAGGGCGTGTTGGGAAACGTGGTCAAGACTATGACGAGTTGA
AAACGAGGCTTGCTGAACGTGCTTGGGAACAAGCATGTCGTTTCTATCCA
CAAATCAAAGATAAACGTGTTTATTTTGATGTTGGAACACCTCTTACCAA
CAAGTATTATATTGGTTCCCCTAGAGGTGAGATTTATGGATTAGATCACA
ATTTAAATCGATTTAATCTGTCAACAAGCGCTGAGTTACGACCCACTACG
AGCATTGACGGGTTATATCTTACTGGCCAGGATATCTCTACTTGTGGTTT
TGCTGGTGGCTTGTACGCAGGTTTATTAACTGCTGCTGTCATCTTGAATC
GTAATTTGATGAGTGATCTGGTTAACTGTACGAAAGCTACACGAAAGCTG
GCCGCACAACGCCAAAAGAAGAATTGAGAACTCAACCACGTGAGTCATCT
GCTATGATGCAATTGATGTTGCTTGCTCACTATATGCATGGTGGATACTA
TCCGGTGGGTGGTGCTAGTGAAATTGCTTATAATATCATTCCTGTCATCG
AAAAAGCTGGTGGTAAAGTCTTGGTTCGAGCTCCTGTCACCGAAATCGTC
CTTGATTCATCTGGGAAAGCTATCGAGAGTTCGAAGATTATACCCACAGA
CATTCATTTTCAAAATCATCCCACTTTGGTTGTCCCGTTTCTTGCTAAAC
ACTGGCATTTTCAACTTGTTCTCAGACCTCCCTTACTTTTCCAACCTGTC
TCTAGCTGATTATTTGGATAGTCTGACCAAAAACAAACGATTACAAGGGG
CCGTTGCTTATTCCTATGGAGATTATGGCACTGGTAAAGACAGAACAACT
CATTTGGTCACCAAAGGAAAGGACAACTTTAAAGCCGAGTTGAAGAAAAG
CTTCCCTGCCCCAGAGGACCAGAAATCAATTGACCAATTCTTTATTGATA
TGGGTGTTTTGAATTCGACGTTGGTATTCACTATATTGGTGAATGTGCTA
ACAACACTTTGACTCATACCTTTGTCAATCAAATCACTGAAGGTCAATTA
GAATGGGCACCTGTTGGTGACGTCATCGATAAAGTTGAATTAGGGATTTA
CATCAAAGAAGGTTCCAGAGGATCTTGATGCTATTGTTGTTGGTAGTGGT
ATAGGAGGGTTATCATGTGCCGCTCTTCTCGCCAAAGCTGGAAGAAAAGT
GCTTGTCCTTGAACAGCATGATCAAGCAGGAGGCTGTTGTCATACATTCA
TAGAAAAAGATGGGCCTGGTTGATAGTTTGATCACAAAGTTAACCTCATG
TGTTTTAACATGTCCACTGACCAGCCTTTTTATTGCAGTTGTTTTGGGAC
TTGTCCTCTACATCATGCAGAAACTCAAACCAAAAGGCAGGAATCCTTTC
AATGTGAATTCAGTGAGACCAAAAGAAGGATTGGAAAATGATTTGAAAAA
AAGGGATGCTGTTTTGAAGCAGGTGTGAAAGTCAAGAAAGGAGGTGAAGA
GCACTTCATTTCTGCACCAATGGTCATCTCTGGAGCTGGTGTCATCAACA
CATTCGAACACATGATCAAAGACCAAAAATCACGCCCGGAATCACTCTTA
AAGAAAGTCAACAGTGGACACGGTGCAGTGTCGATCTTCGCCGGTCTGGA
TGGAACGAATGAAGAATTAAAATTGGAAAATACTAACACGTGGGCAATGG
CTGAACCTGACCTTGACAAAGGATTGGATGATTTCTTGAACACACCAGCT
GAGAAGGTTGGTACTGAGGATATCCCATTGTTGTTCATATCTTTCCCCTC
AACCAAAGATCCAACATGGGACCAACGTTTCCCTGGTAAATCCAACTGCA
CCATTGTTACCCTTGGCAACTGGAAATGGTTCGAAGAATGGGAGGAAGGG
CGTGTTGGGAAACGTGGTCAAGACTATGACGAGTTGAAAACGAGGCTTGC
TGAACGTGCTTGGGAACAAGCATGTCGTTTCTATCCACAAATCAAAGATA
AACGTGTTTATTTTGATGTTGGAACACCTCTTACCAACAAGTATTATATT
GGTTCCCCTAGAGGTGAGATTTATGGATTAGATCACAATTTAAATCGATT
TAATCTGTCAACAAGCGCTGAGTTACGACCCACTACGAGCATTGACGGGT
TATATCTTACTGGCCAGGATATCTCTACTTGTGGTTTTGCTGGTGGCTTG
TACGCAGGTTTATTAACTGCTGCTGTCATCTTGAATCGTAATTTGATGAG
TGATCTGGTTAACTGTACGAAAGCTACACGAAAGCTGGCCGCACAACGCC
AAAAGAAGAATTGAGAACTCAACCACGTGAGTCATCTGCTATGATGCAAT
TGATGTTGCTTGCTCACTATATGCATGGTGGATACTATCCGGTGGGTGGT
GCTAGTGAAATTGCTTATAATATCATTCCTGTCATCGAAAAAGCTGGTGG
TAAAGTCTTGGTTCGAGCTCCTGTCACCGAAATCGTCCTTGATTCATCTG
GGAAAGCTATCGAGAGTTCGAAGATTATACCCACAGACATTCATTTTCAA
AATCATCCCACTTTGGTTGTCCCGTTTCTTGCTAAACACTGGCATTTTCA
ACTTGTTCTCAGACCTCCCTTACTTTTCCAACCTGTCTCTAGCTGATTAT
TTGGATAGTCTGACCAAAAACAAACGATTACAAGGGGCCGTTGCTTATTC
CTATGGAGATTATGGCACTGGTAAAGACAGAACAACTCATTTGGTCACCA
AAGGAAAGGACAACTTTAAAGCCGAGTTGAAGAAAAGCTTCCCTGCCCCA
GAGGACCAGAAATCAATTGACCAATTCTTTATTGATATGGGTGTTTTGAA
TTCGACGTTGGTATTCACTATATTGGTGAATGTGCTAACAACACTTTGAC
TCATACCTTTGTCAATCAAATCACTGAAGGTCAATTAGAATGGGCACCTG
TTGGTGACGTCATCGATAAAGTTGAATTAGGGATTTACATCAAAGAAGGT
TCCAGAGGATCTTGATGCTATTGTTGTTGGTAGTGGTATAGGAGGGTTAT
CATGTGCCGCTCTTCTCGCCAAAGCTGGAAGAAAAGTGCTTGTCCTTGAA
CAGCATGATCAAGCAGGAGGCTGTTGTCATACATTCATAGAAAAAGATGG
GCCTGGTTGATAGTTTGATCACAAAGTTAACCTCATGTGTTTTAACATGT
CCACTGACCAGCCTTTTTATTGCAGTTGTTTTGGGACTTGTCCTCTACAT
CATGCAGAAACTCAAACCAAAAGGCAGGAATCCTTTCAATGTGAATTCAG
TGAGACCAAAAGAAGGATTGGAAAATGATTTGAAAAAAAGGGATGCTGTT
TTGAAGCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000867XLOC_000867Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001661-proteinTCONS_00001661-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001661-exon-sc0000011-1575043694:403299..404288TCONS_00001661-exon-sc0000011-1575043694:403299..404288Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1575043694:399712..399877TCONS_00001661-exon-sc0000011-1575043694:399712..399877Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1575043694:399292..399429TCONS_00001661-exon-sc0000011-1575043694:399292..399429Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1575043694:398253..398380TCONS_00001661-exon-sc0000011-1575043694:398253..398380Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1575043694:397681..397882TCONS_00001661-exon-sc0000011-1575043694:397681..397882Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1575043694:397024..397221TCONS_00001661-exon-sc0000011-1575043694:397024..397221Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1575043694:395188..396521TCONS_00001661-exon-sc0000011-1575043694:395188..396521Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1510915933:403299..404288TCONS_00001661-exon-sc0000011-1510915933:403299..404288Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1510915933:399712..399877TCONS_00001661-exon-sc0000011-1510915933:399712..399877Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1510915933:399292..399429TCONS_00001661-exon-sc0000011-1510915933:399292..399429Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1510915933:398253..398380TCONS_00001661-exon-sc0000011-1510915933:398253..398380Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1510915933:397681..397882TCONS_00001661-exon-sc0000011-1510915933:397681..397882Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1510915933:397024..397221TCONS_00001661-exon-sc0000011-1510915933:397024..397221Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1510915933:395188..396521TCONS_00001661-exon-sc0000011-1510915933:395188..396521Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1491911889:403299..404288TCONS_00001661-exon-sc0000011-1491911889:403299..404288Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1491911889:399712..399877TCONS_00001661-exon-sc0000011-1491911889:399712..399877Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1491911889:399292..399429TCONS_00001661-exon-sc0000011-1491911889:399292..399429Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1491911889:398253..398380TCONS_00001661-exon-sc0000011-1491911889:398253..398380Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1491911889:397681..397882TCONS_00001661-exon-sc0000011-1491911889:397681..397882Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1491911889:397024..397221TCONS_00001661-exon-sc0000011-1491911889:397024..397221Clytia hemisphaericaexon
TCONS_00001661-exon-sc0000011-1491911889:395188..396521TCONS_00001661-exon-sc0000011-1491911889:395188..396521Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:395188..404288 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
102.154 99.587 59.2767 51.5648 21.2733 16.645 24.1244 25.6552 33.6659 39.0289 52.3358 33.0745 59.3879 60.5734 34.8358 46.3878 37.0172 33.7853 27.7452 44.7412 21.1975 22.4722 39.513 39.8632 58.0099 59.0064 30.2729 34.5674 52.3541 38.795
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR023753FAD/NAD-binding_dom
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0016491 oxidoreductase activity
Blast
BLAST of TCONS_00001661 vs. Swiss-Prot (Human)
Match: RETST (All-trans-retinol 13,14-reductase OS=Homo sapiens GN=RETSAT PE=1 SV=2)

HSP 1 Score: 427.172 bits (1097), Expect = 7.016e-136
Identity = 249/585 (42.56%), Postives = 352/585 (60.17%), Query Frame = 1
Query:  910 NPFNVNSVRPKEGLENDLKKRDAVLKQGFTSKKVPEDLDAIVVGSGIGGLSCAALLAKAGRKVLVLEQHDQAGGCCHTFIEKGFEFDVGIHYIGECANNTLTHTFVNQITEGQLEWAPVGDVIDKVELGTGKDRTTHLVTKGKDNFKAELKKSFPAPEDQKSIDQFFIDMGRVRRLYPQTFIFKIIPLWLSRFLLNTGIFNLFSDLPYFSNLSLADYLDSLTKNKRLQGAVAYSYGDYGTQPRESSAMMQLMLLAHYMHGGYYPVGGASEIAYNIIPVIEKAGGKVLVRAPVTEIVLDSSXXXXXXXXXXXXEEHFISAPMVISGAGVINTFEHMIK-DQKSRP--ESLLKKVNSGHGAVSIFAGLDGTNEELKLENTNTWAMAEPDLDKGLDDFLNTPAEKVGTEDIPLLFISFPSTKDPTWDQRFPGKSNCTIVTLGNWKWFEEWEEGRVGKRGQDYDELKTRLAERAWEQACRFYPQIKDKRVYFDVGTPLTNKYYIGSPRGEIYGLDHNLNRFNLSTSAELRPTTSIDGLYLTGQDISTCXXXXXXXXXXXXXXVILNRNLMSDLVNCTKATRKLAAQRQK 2655
            NPF+ +  RP   L  D + R  VLKQ F++ +VPE LD +V+GSG GGL+ AA+LAKAG++VLVLEQH +AGGCCHTF + G EFD GIHYIG     ++    ++QITEGQL+WAP+    D + L     R  + +  G+  +   LK+ F  P+++  ID++   +  V    P   + K +PL + + L   G+   FS     S  SLA+ L  L  +  LQ  ++Y +  YG  P  S+  M  +L+ HYM GG+YP GG+SEIA++ IPVI++AGG VL +A V  ++LDS+GKA GV VKKG E   I  P+V+S AG+ NT+EH++  + +  P  +  L  V  G G  S+F  L GT E+L L +TN +   + D+D+ ++ +++ P E+   E IPLLF +FPS KDPTW+ RFPG+S   ++    ++WFEEW+    GKRG DY+  K    E +     + +PQ++ K      G+PLTN++Y+ +PRG  YG DH+L R +    A LR  + I  LYLTGQDI TCG  G L   LL ++ IL RNL SDL N     R   AQ++K
Sbjct:   31 NPFSEDVKRPPAPLVTDKEARKKVLKQAFSANQVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGIHYIGRMEEGSIGRFILDQITEGQLDWAPLSSPFDIMVLEGPNGRKEYPMYSGEKAYIQGLKEKF--PQEEAIIDKYIKLVKVVSSGAPHAILLKFLPLPVVQLLDRCGLLTRFSPFLQASTQSLAEVLQQLGASSELQAVLSYIFPTYGVTPNHSAFSMHALLVNHYMKGGFYPRGGSSEIAFHTIPVIQRAGGAVLTKATVQSVLLDSAGKACGVSVKKGHELVNIYCPIVVSNAGLFNTYEHLLPGNARCLPGVKQQLGTVRPGLGMTSVFICLRGTKEDLHLPSTNYYVYYDTDMDQAMERYVSMPREE-AAEHIPLLFFAFPSAKDPTWEDRFPGRSTMIMLIPTAYEWFEEWQAELKGKRGSDYETFKNSFVEASMSVVLKLFPQLEGKVESVTAGSPLTNQFYLAAPRGACYGADHDLGRLHPCVMASLRAQSPIPNLYLTGQDIFTCGLVGALQGALLCSSAILKRNLYSDLKNLDSRIR---AQKKK 609          
The following BLAST results are available for this feature:
BLAST of TCONS_00001661 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RETST7.016e-13642.56All-trans-retinol 13,14-reductase OS=Homo sapiens ... [more]
back to top