Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001661-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001661-protein
Unique NameTCONS_00001661-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length628

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001661-protein ID=TCONS_00001661-protein|Name=TCONS_00001661-protein|organism=Clytia hemisphaerica|type=polypeptide|length=628bp
MGLVDSLITKLTSCVLTCPLTSLFIAVVLGLVLYIMQKLKPKGRNPFNVN
SVRPKEGLENDLKKRDAVLKQGFTSKKVPEDLDAIVVGSGIGGLSCAALL
AKAGRKVLVLEQHDQAGGCCHTFIEKGFEFDVGIHYIGECANNTLTHTFV
NQITEGQLEWAPVGDVIDKVELGTGKDRTTHLVTKGKDNFKAELKKSFPA
PEDQKSIDQFFIDMGRVRRLYPQTFIFKIIPLWLSRFLLNTGIFNLFSDL
PYFSNLSLADYLDSLTKNKRLQGAVAYSYGDYGTQPRESSAMMQLMLLAH
YMHGGYYPVGGASEIAYNIIPVIEKAGGKVLVRAPVTEIVLDSSGKAIGV
KVKKGGEEHFISAPMVISGAGVINTFEHMIKDQKSRPESLLKKVNSGHGA
VSIFAGLDGTNEELKLENTNTWAMAEPDLDKGLDDFLNTPAEKVGTEDIP
LLFISFPSTKDPTWDQRFPGKSNCTIVTLGNWKWFEEWEEGRVGKRGQDY
DELKTRLAERAWEQACRFYPQIKDKRVYFDVGTPLTNKYYIGSPRGEIYG
LDHNLNRFNLSTSAELRPTTSIDGLYLTGQDISTCGFAGGLYAGLLTAAV
ILNRNLMSDLVNCTKATRKLAAQRQKKN
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000867XLOC_000867Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001661TCONS_00001661Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR023753FAD/NAD-binding_dom
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0016491 oxidoreductase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13450NAD_binding_8coord: 86..151
e-value: 7.1E-17
score: 61.3
IPR023753FAD/NAD(P)-binding domainGENE3D3.50.50.60coord: 69..605
e-value: 1.5E-33
score: 116.3
IPR023753FAD/NAD(P)-binding domainSUPERFAMILY51905FAD/NAD(P)-binding domaincoord: 79..375

Blast
BLAST of TCONS_00001661-protein vs. Swiss-Prot (Human)
Match: RETST (All-trans-retinol 13,14-reductase OS=Homo sapiens GN=RETSAT PE=1 SV=2)

HSP 1 Score: 462.996 bits (1190), Expect = 1.893e-156
Identity = 249/585 (42.56%), Postives = 352/585 (60.17%), Query Frame = 0
Query:   45 NPFNVNSVRPKEGLENDLKKRDAVLKQGFTSKKVPEDLDAIVVGSGIGGLSCAALLAKAGRKVLVLEQHDQAGGCCHTFIEKGFEFDVGIHYIGECANNTLTHTFVNQITEGQLEWAPVGDVIDKVELGTGKDRTTHLVTKGKDNFKAELKKSFPAPEDQKSIDQFFIDMGRVRRLYPQTFIFKIIPLWLSRFLLNTGIFNLFSDLPYFSNLSLADYLDSLTKNKRLQGAVAYSYGDYGTQPRESSAMMQLMLLAHYMHGGYYPVGGASEIAYNIIPVIEKAGGKVLVRAPVTEIVLDSSGKAIGVKVKKGGEEHFISAPMVISGAGVINTFEHMIK-DQKSRP--ESLLKKVNSGHGAVSIFAGLDGTNEELKLENTNTWAMAEPDLDKGLDDFLNTPAEKVGTEDIPLLFISFPSTKDPTWDQRFPGKSNCTIVTLGNWKWFEEWEEGRVGKRGQDYDELKTRLAERAWEQACRFYPQIKDKRVYFDVGTPLTNKYYIGSPRGEIYGLDHNLNRFNLSTSAELRPTTSIDGLYLTGQDISTCGFAGGLYAGLLTAAVILNRNLMSDLVNCTKATRKLAAQRQK 626
            NPF+ +  RP   L  D + R  VLKQ F++ +VPE LD +V+GSG GGL+ AA+LAKAG++VLVLEQH +AGGCCHTF + G EFD GIHYIG     ++    ++QITEGQL+WAP+    D + L     R  + +  G+  +   LK+ FP  +++  ID++   +  V    P   + K +PL + + L   G+   FS     S  SLA+ L  L  +  LQ  ++Y +  YG  P  S+  M  +L+ HYM GG+YP GG+SEIA++ IPVI++AGG VL +A V  ++LDS+GKA GV VKKG E   I  P+V+S AG+ NT+EH++  + +  P  +  L  V  G G  S+F  L GT E+L L +TN +   + D+D+ ++ +++ P E+   E IPLLF +FPS KDPTW+ RFPG+S   ++    ++WFEEW+    GKRG DY+  K    E +     + +PQ++ K      G+PLTN++Y+ +PRG  YG DH+L R +    A LR  + I  LYLTGQDI TCG  G L   LL ++ IL RNL SDL N     R   AQ++K
Sbjct:   31 NPFSEDVKRPPAPLVTDKEARKKVLKQAFSANQVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGIHYIGRMEEGSIGRFILDQITEGQLDWAPLSSPFDIMVLEGPNGRKEYPMYSGEKAYIQGLKEKFP--QEEAIIDKYIKLVKVVSSGAPHAILLKFLPLPVVQLLDRCGLLTRFSPFLQASTQSLAEVLQQLGASSELQAVLSYIFPTYGVTPNHSAFSMHALLVNHYMKGGFYPRGGSSEIAFHTIPVIQRAGGAVLTKATVQSVLLDSAGKACGVSVKKGHELVNIYCPIVVSNAGLFNTYEHLLPGNARCLPGVKQQLGTVRPGLGMTSVFICLRGTKEDLHLPSTNYYVYYDTDMDQAMERYVSMPREE-AAEHIPLLFFAFPSAKDPTWEDRFPGRSTMIMLIPTAYEWFEEWQAELKGKRGSDYETFKNSFVEASMSVVLKLFPQLEGKVESVTAGSPLTNQFYLAAPRGACYGADHDLGRLHPCVMASLRAQSPIPNLYLTGQDIFTCGLVGALQGALLCSSAILKRNLYSDLKNLDSRIR---AQKKK 609          
The following BLAST results are available for this feature:
BLAST of TCONS_00001661-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RETST1.893e-15642.56All-trans-retinol 13,14-reductase OS=Homo sapiens ... [more]
back to top