Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001592 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001592
Unique NameTCONS_00001592
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1640

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001592 ID=TCONS_00001592|Name=TCONS_00001592|organism=Clytia hemisphaerica|type=transcript|length=1640bp
GTGAGTTAGGCGGGGTTAAGCTGTTTGGATCTACTAacaacgtgatcgtg
ataATTGTAAACAGTGTTTTCGGGTTTTCAAATGCCACGTTCATCAGAGA
CGCTGCACACAAGCTAGCAACAAAGATGGCGACGATTCTGAGTCTTGTAA
CTTTCTGTTTGTCACTGGTATTCCATGCAAATGGTTTGTCATTTACATTA
TCAGCAGGCAATAAGAAGTGCCTAAGGGAAGAAGTTCACAAAGATATCCT
TGTAACTGGCGAATACAAACTTTCAGACGCCCCTATTCAAACACATTTGA
CGGTGATTGACACAAATGGACATGTTTTGTACAAAAAGGAAGAAGCTTCC
AGAGGAAAGTTCGCTTTCACTACTGATGATTATGATATGTTTGAAGTATG
TTTCCAAAGTGAAGGAACTCACGGACAAGGAATTGATCGTGAAATTTCAT
TAGAAGTCAAAACTGGTGTAGAAGCTAAAAATTATGATGACCTTCAAAAG
ACTGAGAAATTGAAACCAATGGAATTAGAATTGAAGAAACTGGAAGATTT
ATCCGAAGCTATTGTCAACGATTTCGCTTACATGAGAGCGAGAGAAGAAC
AGATGAGAGATACTAACGAATCAACCAGCGACCGTGTCTTATACTTCAGC
GTTTTCTCCATGTTATGTTTAGTTGGGTTGGCCATGTGGCAAATCTTTTA
TCTTCGAAGATTTTTCATTGCCAAGAAGCTTATCGAAaactaaaatggaa
aaaaacgaaaacattcaaaaaagcATTCACCTACAATATCTGCTCTGTGG
AAAATATCTAATTTACATCTATTTTACTGAAATGTTTTGCGATTTAGTAT
TAAAATTAGATACCTCAACAAAAATGTAATCTATTTGACATTGTCCATCC
GTTCTCGGATTTGTCCATCCGTTCTCGGATTAAATATCTGTTTTTAAGTC
AAATCTcttaaaaaattgatgtttagaAAGAGATTTCGTTACTCCCTCTA
AATTTGTTgccttttgtttgaaaataagTGATACATTTTAAAAAGACTTT
TCTAAACTCTTAAAAATCTTCACAATGCTTAACCCTTGTTCTATAGGCTC
TTTTCTAAACATCCATTAGCTTTTTCCATTTCCTTGTTTAGAAAACAGTA
TTATATTCTATGTATTCCTTGAATAATTTtgtgttgatatttttattttg
tgtgaTATTCCAAACCAACCAAATAGGTTTTGTATATTTCAAACTAAAGa
ggaattttgcaatttttttttgggtgCTGTGTGGTGTAGTGGCATTGAGT
AGACTAGTTTTCAAATGTCAATATAGCTTGACTTCTTACATccacttctt
tctttctttctataCTGAATACATCATAACTCTTTTTAGTTTCTGAATAT
TCCCCTCGCAATTTGAACACTGTACTTTATAGTTAACAgaacaatattca
atttccaatTTTGAGTATAAATTTTTCGATTCTATGGTACAgctattttg
gtaattttttctCGACGACTTTAgaattttaacaattatttAATTTCATA
GGCTGGAAAGTAAACattgaaatttttagattttttactttctccacgca
atttttaatgaaaatacaaaCTTAAAATCCTATACGGCTA
Run BLAST on NCBI

protein sequence of TCONS_00001592-protein

>TCONS_00001592-protein ID=TCONS_00001592-protein|Name=TCONS_00001592-protein|organism=Clytia hemisphaerica|type=polypeptide|length=246bp
ELGGVKLFGSTNNVIVIIVNSVFGFSNATFIRDAAHKLATKMATILSLVT
FCLSLVFHANGLSFTLSAGNKKCLREEVHKDILVTGEYKLSDAPIQTHLT
VIDTNGHVLYKKEEASRGKFAFTTDDYDMFEVCFQSEGTHGQGIDREISL
EVKTGVEAKNYDDLQKTEKLKPMELELKKLEDLSEAIVNDFAYMRAREEQ
MRDTNESTSDRVLYFSVFSMLCLVGLAMWQIFYLRRFFIAKKLIEN
Run BLAST on NCBI

transcript from alignment at sc0000011:646851..659145+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001592 ID=TCONS_00001592|Name=TCONS_00001592|organism=Clytia hemisphaerica|type=transcript|length=12295bp|location=Sequence derived from alignment at sc0000011:646851..659145+ (Clytia hemisphaerica)
GTGAGTTAGGCGGGGTTAAGCTGTTTGGATCTACTAacaacgtgatcgtg atagtaagaaaatttaacttttaactTAATTTAACGTGATTTGGAATTTC TTTTGCGTGATCCTTTATCTTCTTCTTTTGCTTCAAATCATCAGGGTGGT GCCAGGACCCACTTTGACGTCGCGTTATCTCGTGATTTTGGGTCcctcaa attcaaaattttaagttcaatCTTTGAAATGATAATCATTTTGTTTGCAA AGCCGAATCGAACATTTTACTCCGATgtcttctttgaaattttggccgCT ATTTGTTGCTTTTAGGATTACGCATACATTTTATAGATTGTAAACAGTGT TTTCGGGTTTTCAAATGCCACGTTCATCAGAGACGCTGCACACAAGCTAG CAACAAAGATGGCGACGATTCTGAGTCTTGTAACTTTCTGTTTGTCACTG GTATTCCATGCAAATGGTTTGTCATTTACATTATCAGCAGGCAATAAGAA GTGCCTAAGGGAAGAAGTTCACAAAGATATCCTTGTAACTGGCGAATACA AACTTTCAGACGCCCCTATTCAAACACATTTGACGGTATGTTTTTTATAC TCTCCACTTCTTTCACTgacaattcaattcaattcaatttcaattcaaaa catatatttacccgAAGGAAGGGACACCAAGTTTAGAAACCTAATTACAA ATGGTGCAACCTGTACCGTCAGACCGTAAGGAtagcttgcatcagtggag gctaacatggatagccctcaaatgaatgacctggttggtctttaaaatat aaacttaaattaaaacaaaaatggtagagtagagctgcaagcggagctgc atagttccAGCAATCTCAATCatcgaacggaatcaacgatcgaaccagtc gaaccaaatcaaacgcaatcgaccgattgaaattcgattgtcgaacgcaa tcaaatctcaatcgaacgtcaaaattctgggaaatattcgatttggttcg attgttgttcgactggttagatcgtcgattccgttcgattcagattgtct ggctttatttttgcagcttcccaacatccaaactctcaaacatcacaagc cgaatgaaattaatttcgatttcccgtagaaattatgcgatgaacaatcc gggggtcaatgaatcgacgatcgaacgcaatcgaacatcaatcaaacaca atcgaatatcaattgaatctgaaaattgcggtaatattcgattgagattc gattgcgttcgacaatcaaatttcaatagaccttttttcaaagagaccag cctgttgaataattatgtagtccagcagaaaaacaacgatacagtcatgc ataattactgtatcatgcatattgtaataatttatGCATGGTTGTATCAT TTTTCTTCTGCTGGACtgcataattattcaacagggtggcctctttgaaa aaaggtctatcgattGATTGCactcgatttggtttgactggttggctggt catattgggcgttttggagttaccaccctcgaagcagtGGGCGCCTTTGC CATTccgcaactctgtccaccattttaaatgagttaacaatagatctGAA AGGGCGCTCTCATCAAGAGAGAtcatttgctttggtctccggctttggga agtagtaatgttttcgattgttttcgatggaaaatggtaagaaacttaag tttacaagtgtcattcagtttttgctggctgatagaatggcaggatcctg gatggtttccttAACtgtcgattgagatcgtctggatagttcatttgatt tgttttgaaatttttctgcttttggTTGGTCAGGCTaggcatttgatggc tatgaAAGTTTCTGTCCACTAATGCAAGTTACACGACTTCAGGGTATCAT CTCTTTTTATTGTATCAAAATATACTGTAATTGACCTTAAAATCACAGCT ATAGCCATCATCCACAATAGACAGTCAGGAGTTTTTGCCTAAGGACCACC CTGTCGATTCCCCGGACGATATAtggggcaaatgtctggggaacgaaaaa agaatatttctATCCCAGGACAAACAAACCGCGTGGCTGGAGAAAAGTGA ACGCGTGGTCACGAGTTAACACGCGGACGACACACGGCGGTCAACTAAGT TCATGTGAATGCATCAAAATTGACGCCCATGTAATCGCCTGATCATATAA GTACATTGCGCAGACCGCGCGTTCAGTCCAGGGTAAGtttaaataaacca gccgaggctggaaggtcagccaatagagcttagctagatagctttaataa gtgggttaacagatgtaagagatgtactgaaacaNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNaatactttggtacaacactgacttttatcacatctgac tatcgcttgagccgccatcttgaaacaccacattatgatctgttaAAACA ACGTACGCTAAAAGtaaccaaaaagttaacccgatcggaagaaagttaag aaatcaaagtgagatcggaaaatcggattttttttttgccgtcttatgga agaagaagaagaaatgaattttacggatttgaatgctcagcttaggctga ccaaaaagTAGTGTTAAAATCCCCGGACACGCAACAAGAAAATCCCCGTC ATGCGCAAGATGATTGGAAGGTCAAAAATCAGcagagtaaaaaaaaatct cctAACTAAGGTAAAAGATATCTTTTAACTAGAGAATTATCcctggcagt tagtcacactagcgtcctgccaaaatgtgtatcaaagattaatgctgtga TAGCGCtttatcgtttacttgactctcaagcaaaaaaatgtggcgcaaaa cttctaaagggattcatgaaaaaataacccggcgctttttaatgaaatta acattttcaaaaactttgagaaattccctaaaatttgagccatagatgaa aaaatttgagccaagccaaccttgaaaactaatttgaagatcaacttccc aactTCCCATGCAGTCTAGCAGAATGttgtcccatgtttcgaccaatcgt ctcaagttagagcagttgactgtaacaagatgactataatgtcaagatgt caattaatgtacgatcaaaaaagtgtgagttgtaaaaataattacctcta ttattctgaatctgttgctcgtgtttaaaaaattaacaaatttgtaataa aaaattatgttttgtataaggagcaattattgttatttggttcaattggt tgagtgtgtcaaatctttcagtttagttgacactttggtatcttcatttc GTCACAGCGAAAGAGATtgttccctgcaatgcaggttcagTCTGATTGGC CAGATTTTGTGCCTATTACTTAGCAATACTTTTGCatgcattttgataat ttcgatctgcacgcataatttatggaaaaagctgactctgcagaaaaaag gaaaacaaatgaaaaatgaaaacatgcacacttttttttataagaatatc ttctataagaatatcagggtgaaaattggccaaatcgtaagatcGTAAGA AACTCTAGGGcgagtttcacagaatttgataataatacagtcattttgta tttggttaacagaaaaaaactaCTTCCTTTGTCAGAGAGGAATTGAAGCT TTGAGAAAGaaaggggggggtcggtactaaaatccaagacatatatgagt actaaaaggttttttgacaatttttgacatacccccacctaatttttgaa aaatgaattttagtactaaaaattttttttacagtttAGCATAGTGACCA CCTAAATTAGGAATTCGTTTCAGAGAATGGGTCTTTAGACTTTCAATAAA ATGCCAACTCTGGTTATTTAAGCTGGCAATGAACCTGATCTATCTCTCTA TTCTAGATATATAAAGACTCAAAAACAGTCAAGACACTTTTGCTCTGCTC TACTTTAGTTATTGCAaagattgattggttatttttcaccTCTAATTTAC AGCTTGCTATTTCTTTTCTGTTCAGTTATCCATGgttctttacaaaaaca aagcattcaactttgaaaacattttttgaaaacaaaatttcttgaagacc ccacctaatttaggattttagtacacatggtactaaaatgctttaatgct ttttttgtaataccaccacgtcactaaaagtcatgatgtctaaaatttta gtactgaccccccccctggaaaGAAACGTAGTTTTAATCCAAATGTttac tcaaaagtccaaaactctcaaattgatcatttctcatgtttgtaaaaaag tcaagtctaaaaaagtaagaatacgttaagaatatttcaccctcaatttt ggcactttcttaagaatacttgaccctcatccaaagtacactattctgaa aatccacttttttattgcgtgaatgcgtgaatctcggctattttgtgcgt gaatacgtgaatttctcttttttcccaCCAATtttgtgcagttttcccga ttttccaatgtttccctgatttttcccgaacattttctgattttctgaaa aatcgggttattgcgtgaaactcagggaaaatttgcgtgaatgcgtgaat ttcattctgtgtcagactaatccaCCTGCACCAAGGCGaacacgaaaaaa aaatttgtttccggtccaccgggtgacaaaaaaaacactcacccAGCCGG ccgcaaaataattttttttgcttaatttcgatcccaaaactcgatttttt aaagcactcgtaGAAGTAAAAATTATGGTCTTCTTTACCTTAAATCTGTA GTAACTTGACAACCCtacaggcttcggcataagaaaaattcacgtgtgat catcgcacgcctagattttgatttatagtggtctaggcgtgcgtttattc aaatacttaattttcatcttttatattttcaattgtgttacaatatctct aggaactggacactctctttcattttgaatatttatcttcaattgCTAAA GGCTCCAAACTGAAATTAAGAAgggaacttttttgagaaaaaagtagacT GAGAGAAATATttccacaattttttttttaaatcctcactttatgaatgt ttctttttattttactcacaagtcagcatgattccttttataaaaacaaa gctgtttacttactgaaaagtccccactttgctgaatgtttctatttatt ttactcacaagtcagcatgattccttttataaaaacaaagctgtttactt actgaaaagtccccactttgctgaatgtttctatttattttactcacaaa tcagcatgattcttttataaaaaccaagttgtatattaaaaaaaatattc ttaaaagttgagttgcaagcaagaattaacaaaaacaatgcagggtttag tttgagatgaataaaatttcatttctataacaATGATCAGGATAAAACCT TCATTCCAAGTGATTTCTAGGCATGCATTTTACAGTGGAATATGAAATAT CACGTGACaaatcacacgcctcaaacTGCTCAAACACTGattcacaaaag tttttcaagcaaacaaactaaccctaaccctaacaatgCTGTAcaaaaaa aatgcggccgggtgacgacgaaataaattttcatcctgccggtggaccgg aaacaaaaatttttttgggttcgcccaagctctataattttagaactttg tgaggtgaggtatttttttgtttttttctaaaattatgaactTGTATTCC CAGGCTAGAAGCAAACTAACtgttttaaatgatcaattaggtcaATAAGA TTGCAAAAACGAGTggagagaaaaattttgaccattttgctggtccccat gtgaCATCATCACTTTTTGTgaggcttgaaaatgaaagtgaaaataagAA GTTCAAATATGGCTCAAATAAAAGATATTCATCCCaaggtttcaaaaaat atcacaacatatatctgaaaatcaatatttcagaAGCTATAAAAGAAAAT AGctcaaaaaatgacgtcatcggcaattcaaaaatcatcaaaatcgaaaa ttttttgtttcatttgataGAGGATGAGCTAGGGAACAAAGAGTATTACT ACAAAAAAATCGCCTAAAAAATAGGCCCCTGTCAGCCAAattgtaattca ttaaatttgccTGCAAAATGTTAGGTTAGGGCACACCCAGAAATCTTTAa aagcttgagagtcaagtcaaACGCATTTCACAAAATAACGTTTTTCTTAG CAATATTTATTGCCCTCtatcaaatgaaacaaaaaaaaaattaattgccG ATggatgacgtcaattttttagcaatttataAATTTGATCCATGCTAGCC TCAAAAATTAATCAGAGAAAAATCTACAGGTCAAAAGACACCCACCTAGA TCCATTCACAGCCAGACAGGCTTTTTCCTGatatttcaccatttttgagC AGCAATTATTTTAATTCAGCATGTAATTGAGGCCTTATAAATGGAAGGGC TAGCTTGgtaattgaataacaaattttaGGTGGTTGAACTTTAGCAATCA GTCCTTTAATTTTGTTTCTAGCTTTCAATTTTCATGACATTGTCTTAGGA TTTGGAACTTGATTCAGTTAACtatcatccttgttgttgcaaacaCATCT ATAGATGACTGatgtatttttttctaaaactaaCCTTTAACAACTCTGCA TTGATAGAATCattattattaatattattgGGATAAGTTAAGATTTCTCC TTGGTTCCCTCCACTTGAAAATTGTCACAAGCAATCAATTGACTGCATTC TCTAATTCATTGTCTCTTTGCTGCTTATATAACTTAAACGACTCCCTGCA GCAAAGAGACAATATTTGAagtttggtttttttattcaggcaccattttt caatttctactATTCACTATAACATTTTCAGGTGATTGACACAAATGGAC ATGTTTTGTACAAAAAGGAAGAAGCTTCCAGAGGAAAGTTCGCTTTCACT ACTGATGATTATGATATGTTTGAAGTATGTTTCCAAAGTGAAGGTAAGCA ACCCCGACCAACTATTACTCATTTTCTAGCTGTTATTTGCAAAGTCTTAT TGGATATTACATATACGAGAAattaattctcaacttcagttgagctagat aaaatctgagaatgtctgtctgtctgtctgtctgtctgtctgtctgtctg tctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtcagtcacct caaaactttggggcaggctggagactttaaaaatggtccgatttggctga aattttgcacacttgatccttgggtgaatccctagttgtttttttcattt ttaagggcgtggtcacgagttttagtCTCAAAACGTGGCTAAAACTTTAG AGCAGGCTGGAGACCTCAAAAacggtcggatttggctgaagtTTGACACC CTTGTTccttgggaaaatattttgggatgattttttatttttcgaaaatt atcatttttgaggcctggggacgagtttttagcctaaacgaggctaaaac ctatttaagaaatgctaaaattttccttaagccattaagtttacaattgg gcctacgaattatttcaaagatactgaagttNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNTTTTTTAtaatcaaaaagaagaaagattatAAAGATCATA TTTGACAACGCTTCAAGCAACATAATAGTTATTTTCTTATTGACTTTACA GGAACTCACGGACAAGGAATTGATCGTGAAATTTCATTAGAAGTCAAAAC TGGTGTAGAAGCTAAAAATTATGATGACGTAAGTATGATGAAACCTTTTT GGTTTGCAGGGTTAAAACAGGCCCACCAAAACCtagaaaaaatgtgtttt tttttttcaaaaaagttaccAGAGATCTTTTTACGGACATACTGTATGAG ATACAAGCCAGGGAGTTTCTGTAGAGCCAGAGCCAGGAAACTATGTTTCT TAGATTCATATTTCATATTTGGCGCACCGAATAAAAGACtttcttttgta aaagattGACTGACTTCAATTATTCGACCAAAGATTTTAAGATGTAATTT TACTTCACTTTACAGCTTCAAAAGACTGAGAAATTGAAACCAATGGAATT AGAATTGAAGAAACTGGAAGATTTATCCGAAGCTATTGTCAACGATTTCG CTTACATGAGAGCGAGAGAAGAACAGATGAGAGATACTAACGGTAAGATC GACTTTTTCTTTTACCTTATCGGCCcattttacaccggcccttattggcg ttatctttgggctcgtggcgtaataagggccggtgttaaaAGGTCCGGCG TAAAAAGAGCCGATAAGGTAGTTGTAAACTATAtgtaaattttctttgtt cAGCCAAGGATCTTAAGTAGGATTCGGAGATTAATTAATAGCATTTTGTT TCATAATTTGGAAAAGTTTGTGAAATTTTTGCTTCAGCGTACAAGCAAGG TGAGTTAGCAAATTCAGGTAAATTCGATAAAAAGTAAGAAAACAGCCAAG TCTCAAGAAAATTACTGTTTTTCGCAAATCGAATCATTACATTAAtcctt tttatcttttttttaattcacaGAATCAACCAGCGACCGTGTCTTATACT TCAGCGTTTTCTCCATGTTATGTTTAGTTGGGTTGGCCATGTGGCAAATC TTTTATCTTCGAAGATTTTTCATTGCCAAGAAGCTTATCGAAaactaaaa tggaaaaaaacgaaaacattcaaaaaagcATTCACCTACAATATCTGCTC TGTGGAAAATATCTAATTTACATCTATTTTACTGAAATGTTTTGCGATTT AGTATTAAAATTAGATACCTCAACAAAAATGTAATCTATTTGACATTGTC CATCCGTTCTCGGATTTGTCCATCCGTTCTCGGATTAAATATCTGTTTTT AAGTCAAATCTcttaaaaaattgatgtttagaAAGAGATTTCGTTACTCC CTCTAAATTTGTTgccttttgtttgaaaataagTGATACATTTTAAAAAG ACTTTTCTAAACTCTTAAAAATCTTCACAATGCTTAACCCTTGTTCTATA GGCTCTTTTCTAAACATCCATTAGCTTTTTCCATTTCCTTGTTTAGAAAA CAGTATTATATTCTATGTATTCCTTGAATAATTTtgtgttgatattttta ttttgtgtgaTATTCCAAACCAACCAAATAGGTTTTGTATATTTCAAACT AAAGaggaattttgcaatttttttttgggtgCTGTGTGGTGTAGTGGCAT TGAGTAGACTAGTTTTCAAATGTCAATATAGCTTGACTTCTTACATccac ttctttctttctttctataCTGAATACATCATAACTCTTTTTAGTTTCTG AATATTCCCCTCGCAATTTGAACACTGTACTTTATAGTTAACAgaacaat attcaatttccaatTTTGAGTATAAATTTTTCGATTCTATGGTACAgcta ttttggtaattttttctCGACGACTTTAgaattttaacaattatttAATT TCATAGGCTGGAAAGTAAACattgaaatttttagattttttactttctcc acgcaatttttaatgaaaatacaaaCTTAAAATCCTATACGGCTA

Coding sequence (CDS) from alignment at sc0000011:646851..659145+

>TCONS_00001592 ID=TCONS_00001592|Name=TCONS_00001592|organism=Clytia hemisphaerica|type=CDS|length=4446bp|location=Sequence derived from alignment at sc0000011:646851..659145+ (Clytia hemisphaerica)
GAGTTAGGCGGGGTTAAGCTGTTTGGATCTACTAacaacgtgatcgtgat
aATTGTAAACAGTGTTTTCGGGTTTTCAAATGCCACGTTCATCAGAGACG
CTGCACACAAGCTAGCAACAAAGATGGCGACGATTCTGAGTCTTGTAACT
TTCTGTTTGTCACTGGTATTCCATGCAAATGGTTTGTCATTTACATTATC
AGCAGGCAATAAGAAGTGCCTAAGGGAAGAAGTTCACAAAGATATCCTTG
TAACTGGCGAATACAAACTTTCAGACGCCCCTATTCAAACACATTTGACG
GTGATTGACACAAATGGACATGTTTTGTACAAAAAGGAAGAAGCTTCCAG
AGGAAAGTTCGCTTTCACTACTGATGATTATGATATGTTTGAAGTATGTT
TCCAAAGTGAAGGAACTCACGGACAAGGAATTGATCGTGAAATTTCATTA
GAAGTCAAAACTGGTGTAGAAGCTAAAAATTATGATGACCTTCAAAAGAC
TGAGAAATTGAAACCAATGGAATTAGAATTGAAGAAACTGGAAGATTTAT
CCGAAGCTATTGTCAACGATTTCGCTTACATGAGAGCGAGAGAAGAACAG
ATGAGAGATACTAACGAATCAACCAGCGACCGTGTCTTATACTTCAGCGT
TTTCTCCATGTTATGTTTAGTTGGGTTGGCCATGTGGCAAATCTTTTATC
TTCGAAGATTTTTCATTGCCAAGAAGCTTATCGAAaactaaGAGTTAGGC
GGGGTTAAGCTGTTTGGATCTACTAacaacgtgatcgtgataATTGTAAA
CAGTGTTTTCGGGTTTTCAAATGCCACGTTCATCAGAGACGCTGCACACA
AGCTAGCAACAAAGATGGCGACGATTCTGAGTCTTGTAACTTTCTGTTTG
TCACTGGTATTCCATGCAAATGGTTTGTCATTTACATTATCAGCAGGCAA
TAAGAAGTGCCTAAGGGAAGAAGTTCACAAAGATATCCTTGTAACTGGCG
AATACAAACTTTCAGACGCCCCTATTCAAACACATTTGACGGTGATTGAC
ACAAATGGACATGTTTTGTACAAAAAGGAAGAAGCTTCCAGAGGAAAGTT
CGCTTTCACTACTGATGATTATGATATGTTTGAAGTATGTTTCCAAAGTG
AAGGAACTCACGGACAAGGAATTGATCGTGAAATTTCATTAGAAGTCAAA
ACTGGTGTAGAAGCTAAAAATTATGATGACCTTCAAAAGACTGAGAAATT
GAAACCAATGGAATTAGAATTGAAGAAACTGGAAGATTTATCCGAAGCTA
TTGTCAACGATTTCGCTTACATGAGAGCGAGAGAAGAACAGATGAGAGAT
ACTAACGAATCAACCAGCGACCGTGTCTTATACTTCAGCGTTTTCTCCAT
GTTATGTTTAGTTGGGTTGGCCATGTGGCAAATCTTTTATCTTCGAAGAT
TTTTCATTGCCAAGAAGCTTATCGAAaactaaGAGTTAGGCGGGGTTAAG
CTGTTTGGATCTACTAacaacgtgatcgtgataATTGTAAACAGTGTTTT
CGGGTTTTCAAATGCCACGTTCATCAGAGACGCTGCACACAAGCTAGCAA
CAAAGATGGCGACGATTCTGAGTCTTGTAACTTTCTGTTTGTCACTGGTA
TTCCATGCAAATGGTTTGTCATTTACATTATCAGCAGGCAATAAGAAGTG
CCTAAGGGAAGAAGTTCACAAAGATATCCTTGTAACTGGCGAATACAAAC
TTTCAGACGCCCCTATTCAAACACATTTGACGGTGATTGACACAAATGGA
CATGTTTTGTACAAAAAGGAAGAAGCTTCCAGAGGAAAGTTCGCTTTCAC
TACTGATGATTATGATATGTTTGAAGTATGTTTCCAAAGTGAAGGAACTC
ACGGACAAGGAATTGATCGTGAAATTTCATTAGAAGTCAAAACTGGTGTA
GAAGCTAAAAATTATGATGACCTTCAAAAGACTGAGAAATTGAAACCAAT
GGAATTAGAATTGAAGAAACTGGAAGATTTATCCGAAGCTATTGTCAACG
ATTTCGCTTACATGAGAGCGAGAGAAGAACAGATGAGAGATACTAACGAA
TCAACCAGCGACCGTGTCTTATACTTCAGCGTTTTCTCCATGTTATGTTT
AGTTGGGTTGGCCATGTGGCAAATCTTTTATCTTCGAAGATTTTTCATTG
CCAAGAAGCTTATCGAAaactaaGAGTTAGGCGGGGTTAAGCTGTTTGGA
TCTACTAacaacgtgatcgtgataATTGTAAACAGTGTTTTCGGGTTTTC
AAATGCCACGTTCATCAGAGACGCTGCACACAAGCTAGCAACAAAGATGG
CGACGATTCTGAGTCTTGTAACTTTCTGTTTGTCACTGGTATTCCATGCA
AATGGTTTGTCATTTACATTATCAGCAGGCAATAAGAAGTGCCTAAGGGA
AGAAGTTCACAAAGATATCCTTGTAACTGGCGAATACAAACTTTCAGACG
CCCCTATTCAAACACATTTGACGGTGATTGACACAAATGGACATGTTTTG
TACAAAAAGGAAGAAGCTTCCAGAGGAAAGTTCGCTTTCACTACTGATGA
TTATGATATGTTTGAAGTATGTTTCCAAAGTGAAGGAACTCACGGACAAG
GAATTGATCGTGAAATTTCATTAGAAGTCAAAACTGGTGTAGAAGCTAAA
AATTATGATGACCTTCAAAAGACTGAGAAATTGAAACCAATGGAATTAGA
ATTGAAGAAACTGGAAGATTTATCCGAAGCTATTGTCAACGATTTCGCTT
ACATGAGAGCGAGAGAAGAACAGATGAGAGATACTAACGAATCAACCAGC
GACCGTGTCTTATACTTCAGCGTTTTCTCCATGTTATGTTTAGTTGGGTT
GGCCATGTGGCAAATCTTTTATCTTCGAAGATTTTTCATTGCCAAGAAGC
TTATCGAAaactaaGAGTTAGGCGGGGTTAAGCTGTTTGGATCTACTAac
aacgtgatcgtgataATTGTAAACAGTGTTTTCGGGTTTTCAAATGCCAC
GTTCATCAGAGACGCTGCACACAAGCTAGCAACAAAGATGGCGACGATTC
TGAGTCTTGTAACTTTCTGTTTGTCACTGGTATTCCATGCAAATGGTTTG
TCATTTACATTATCAGCAGGCAATAAGAAGTGCCTAAGGGAAGAAGTTCA
CAAAGATATCCTTGTAACTGGCGAATACAAACTTTCAGACGCCCCTATTC
AAACACATTTGACGGTGATTGACACAAATGGACATGTTTTGTACAAAAAG
GAAGAAGCTTCCAGAGGAAAGTTCGCTTTCACTACTGATGATTATGATAT
GTTTGAAGTATGTTTCCAAAGTGAAGGAACTCACGGACAAGGAATTGATC
GTGAAATTTCATTAGAAGTCAAAACTGGTGTAGAAGCTAAAAATTATGAT
GACCTTCAAAAGACTGAGAAATTGAAACCAATGGAATTAGAATTGAAGAA
ACTGGAAGATTTATCCGAAGCTATTGTCAACGATTTCGCTTACATGAGAG
CGAGAGAAGAACAGATGAGAGATACTAACGAATCAACCAGCGACCGTGTC
TTATACTTCAGCGTTTTCTCCATGTTATGTTTAGTTGGGTTGGCCATGTG
GCAAATCTTTTATCTTCGAAGATTTTTCATTGCCAAGAAGCTTATCGAAa
actaaGAGTTAGGCGGGGTTAAGCTGTTTGGATCTACTAacaacgtgatc
gtgataATTGTAAACAGTGTTTTCGGGTTTTCAAATGCCACGTTCATCAG
AGACGCTGCACACAAGCTAGCAACAAAGATGGCGACGATTCTGAGTCTTG
TAACTTTCTGTTTGTCACTGGTATTCCATGCAAATGGTTTGTCATTTACA
TTATCAGCAGGCAATAAGAAGTGCCTAAGGGAAGAAGTTCACAAAGATAT
CCTTGTAACTGGCGAATACAAACTTTCAGACGCCCCTATTCAAACACATT
TGACGGTGATTGACACAAATGGACATGTTTTGTACAAAAAGGAAGAAGCT
TCCAGAGGAAAGTTCGCTTTCACTACTGATGATTATGATATGTTTGAAGT
ATGTTTCCAAAGTGAAGGAACTCACGGACAAGGAATTGATCGTGAAATTT
CATTAGAAGTCAAAACTGGTGTAGAAGCTAAAAATTATGATGACCTTCAA
AAGACTGAGAAATTGAAACCAATGGAATTAGAATTGAAGAAACTGGAAGA
TTTATCCGAAGCTATTGTCAACGATTTCGCTTACATGAGAGCGAGAGAAG
AACAGATGAGAGATACTAACGAATCAACCAGCGACCGTGTCTTATACTTC
AGCGTTTTCTCCATGTTATGTTTAGTTGGGTTGGCCATGTGGCAAATCTT
TTATCTTCGAAGATTTTTCATTGCCAAGAAGCTTATCGAAaactaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000831XLOC_000831Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001592-proteinTCONS_00001592-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001592-exon-sc0000011-1491911889:646851..646903TCONS_00001592-exon-sc0000011-1491911889:646851..646903Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1510915933:646851..646903TCONS_00001592-exon-sc0000011-1510915933:646851..646903Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1575043694:646851..646903TCONS_00001592-exon-sc0000011-1575043694:646851..646903Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1491911889:647187..647435TCONS_00001592-exon-sc0000011-1491911889:647187..647435Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1510915933:647187..647435TCONS_00001592-exon-sc0000011-1510915933:647187..647435Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1575043694:647187..647435TCONS_00001592-exon-sc0000011-1575043694:647187..647435Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1491911889:655832..655943TCONS_00001592-exon-sc0000011-1491911889:655832..655943Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1510915933:655832..655943TCONS_00001592-exon-sc0000011-1510915933:655832..655943Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1575043694:655832..655943TCONS_00001592-exon-sc0000011-1575043694:655832..655943Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1491911889:657252..657328TCONS_00001592-exon-sc0000011-1491911889:657252..657328Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1510915933:657252..657328TCONS_00001592-exon-sc0000011-1510915933:657252..657328Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1575043694:657252..657328TCONS_00001592-exon-sc0000011-1575043694:657252..657328Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1491911889:657616..657742TCONS_00001592-exon-sc0000011-1491911889:657616..657742Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1510915933:657616..657742TCONS_00001592-exon-sc0000011-1510915933:657616..657742Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1575043694:657616..657742TCONS_00001592-exon-sc0000011-1575043694:657616..657742Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1491911889:658124..659145TCONS_00001592-exon-sc0000011-1491911889:658124..659145Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1510915933:658124..659145TCONS_00001592-exon-sc0000011-1510915933:658124..659145Clytia hemisphaericaexon
TCONS_00001592-exon-sc0000011-1575043694:658124..659145TCONS_00001592-exon-sc0000011-1575043694:658124..659145Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:646851..659145 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
133.68 132.946 136.004 138.826 117.72 91.6503 263.027 267.281 152.302 161.22 102.707 113.054 57.611 52.0384 75.4855 92.3988 67.5968 68.7123 27.6198 54.2742 51.0813 52.7193 76.9501 76.0579 46.6354 52.7151 56.1939 37.3689 95.238 68.4358
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR009038GOLD_dom
Vocabulary: Biological Process
TermDefinition
GO:0006810transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006810 transport
cellular_component GO:0016021 integral component of membrane
Blast
BLAST of TCONS_00001592 vs. Swiss-Prot (Human)
Match: TMEDA (Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens GN=TMED10 PE=1 SV=2)

HSP 1 Score: 226.098 bits (575), Expect = 1.505e-69
Identity = 122/190 (64.21%), Postives = 160/190 (84.21%), Query Frame = 3
Query:  183 GLSFTLSAGNKKCLREEVHKDILVTGEYKLSDAP-----IQTHLTVIDTNGHVLYKKEEASRGKFAFTTDDYDMFEVCFQSEGTHGQGIDREISLEVKTGVEAKNYDDLQXXXXXXXXXXXXXXXXXXXXAIVNDFAYMRAREEQMRDTNESTSDRVLYFSVFSMLCLVGLAMWQIFYLRRFFIAKKLIE 737
             +SF L   ++KCLREE+HKD+LVTG Y++SD       +++HL + D+ GH+LY KE+A++GKFAFTT+DYDMFEVCF+S+GT G+  D+ + L++K GVEAKNY+++ K EKLKP+E+EL++LEDLSE+IVNDFAYM+ REE+MRDTNEST+ RVLYFS+FSM CL+GLA WQ+FYLRRFF AKKLIE
Sbjct:   31 AISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGT-GRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE 219          
The following BLAST results are available for this feature:
BLAST of TCONS_00001592 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TMEDA1.505e-6964.21Transmembrane emp24 domain-containing protein 10 O... [more]
back to top