Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001592-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001592-protein
Unique NameTCONS_00001592-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length246

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001592-protein ID=TCONS_00001592-protein|Name=TCONS_00001592-protein|organism=Clytia hemisphaerica|type=polypeptide|length=246bp
ELGGVKLFGSTNNVIVIIVNSVFGFSNATFIRDAAHKLATKMATILSLVT
FCLSLVFHANGLSFTLSAGNKKCLREEVHKDILVTGEYKLSDAPIQTHLT
VIDTNGHVLYKKEEASRGKFAFTTDDYDMFEVCFQSEGTHGQGIDREISL
EVKTGVEAKNYDDLQKTEKLKPMELELKKLEDLSEAIVNDFAYMRAREEQ
MRDTNESTSDRVLYFSVFSMLCLVGLAMWQIFYLRRFFIAKKLIEN
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000831XLOC_000831Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001592TCONS_00001592Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR009038GOLD_dom
Vocabulary: Biological Process
TermDefinition
GO:0006810transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006810 transport
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009038GOLD domainSMARTSM01190EMP24_GP25L_2coord: 61..239
e-value: 1.2E-68
score: 244.1
IPR009038GOLD domainPFAMPF01105EMP24_GP25Lcoord: 62..238
e-value: 1.2E-49
score: 168.6
IPR009038GOLD domainPROSITEPS50866GOLDcoord: 71..154
score: 13.337

Blast
BLAST of TCONS_00001592-protein vs. Swiss-Prot (Human)
Match: TMEDA (Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens GN=TMED10 PE=1 SV=2)

HSP 1 Score: 264.618 bits (675), Expect = 5.693e-90
Identity = 122/190 (64.21%), Postives = 160/190 (84.21%), Query Frame = 0
Query:   61 GLSFTLSAGNKKCLREEVHKDILVTGEYKLSD-----APIQTHLTVIDTNGHVLYKKEEASRGKFAFTTDDYDMFEVCFQSEGTHGQGIDREISLEVKTGVEAKNYDDLQKTEKLKPMELELKKLEDLSEAIVNDFAYMRAREEQMRDTNESTSDRVLYFSVFSMLCLVGLAMWQIFYLRRFFIAKKLIE 245
             +SF L   ++KCLREE+HKD+LVTG Y++SD       +++HL + D+ GH+LY KE+A++GKFAFTT+DYDMFEVCF+S+GT G+  D+ + L++K GVEAKNY+++ K EKLKP+E+EL++LEDLSE+IVNDFAYM+ REE+MRDTNEST+ RVLYFS+FSM CL+GLA WQ+FYLRRFF AKKLIE
Sbjct:   31 AISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGT-GRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE 219          
The following BLAST results are available for this feature:
BLAST of TCONS_00001592-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TMEDA5.693e-9064.21Transmembrane emp24 domain-containing protein 10 O... [more]
back to top