Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001399 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001399
Unique NameTCONS_00001399
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3126

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001399 ID=TCONS_00001399|Name=TCONS_00001399|organism=Clytia hemisphaerica|type=transcript|length=3126bp
TGAGAAAATAGATTTATTTTGTGTGGCTAGCTGCTCAAGTTCCTCAAGTC
ACTGAAGTCAAGCAACGAGGATTTTTGATATCCTTTAATTATGAAGTGTA
CTTAGTTTAAAAAATGGAGTTTTTTAATTACCAATCTGTTTATATGGTTT
TCTTGGTTTCTTTTTGGCAAGCTCATTTAACATTACAACTTGATTTTGAA
TGTACTTACAATGGGACAACACTTGCTGACAACGTCAAAATCTTTCTCGA
CTTAGAGGAAAATGGAACATCAAATCTAGTGTGTATGAAAATGCAAAACC
AAGGCTTCGTTGAAGAGCTTAAAATGAGTGTTTCCAGCAGTGACACTGAT
TTGGTGACTCTAATCTTTAATTCCACATGGACTTCAGAAAAAGTCCTAAA
CATTTCTGACCATGATATATTTAAAACTAATAACCCACCGAGTTTCAACA
TGAAGATTTTGGTTTGTGAAATATATTACGTCGATGCTTTACATGAAAAT
GTTaccataataaaatttttggctGTTACAGCACATAGATCATTCAGTCA
ATATCAGAGGACTTTTGGTTTGGATGATTCAAAGCATGTTGTAGCTGAAA
GTCCATGTTCTAGCATTGTTTCTTACTGGATACCAAAGATGTTATCGGAA
ACGAAAAACTCACTTCACTTGAAGATCAGCAAAGAAACACTTCTAATGAT
ACCCATTCTTATGAGTGAAAGCCAAAAGATTTCAGAGAATTCAACGGTAA
CCCGTTTCGTTGTTATGAATAATCACATCATTCTGGTAGTTGATAACCAG
TGGCTATGGAAAGGAACATTAGAACTATCTGGGGATGTGAGAATTACCAA
AGCATCATCAAATCGAGTCCAAGTTCATTTGCTAACAACAACGATTCACT
GTCCAATCACTGATACCCCTGGAGTCGAAGGCTCTGAAACAGCGCTCTTG
GTACATCAAATTGGAAATGGCACCTTCCTCAACATTTACGCGCCGCCCAT
TGAATCAACGCCCCTTTACATTGTGACTTTGACAAATATCACTGGTGAAG
ATATCATAGATGTGAAATATGATTATGGTAAAAGACAAGTTGTCGTACTA
TTGGTTACAAATACAGTACACGCATTCTCGTTATCTGGAACACTGCAATG
TGCGCCGATAATTTTGAAGGATACACATATTAAAAACCAATCAAGACTTC
TCGTAAAGTGCAACCTTCTGTTGATCGTCACAAATGAAATAGTTGTTTGG
ACATCAACAAATGGTGGATGCAATTGGAAACGACCTATACAATGGAACAA
CATCCTCCATGCAGACTTTGAGTTCCATTCTGCCGATACATTGAAATTTA
CATCTAACATAACATCAAGTTACGGAACTCCGCTAGAAAGCTATCGGGAT
TATGATATTTTATGGACCAAAATTGGTTTCTTACGTCCACAAGCAGCATT
GAATAACTCTAATTACATGTTGCTCCTCAATGACAAGATTCCGGAAAGCA
ATAACCCTTATCTTGATTTAGACATTTTTGCCGTAACAGAAACCGCAGAA
GGATTCCAGTTAGAGTTTACGCCAAATGAGACGAAGTTTCCTGAAATTTG
GATTGGTTCCTTGGTAAAGCTTGGTGACTACTCATGTCGCGTCACGGCTG
TTTTCAACGCTACTGTCGAGATTTATTGCTACAATAGTAGTTTAACATTC
ACAAACATTATCGACTTTATCCAGCAACGACGCTGGTTTAGTGTCGATTT
CTTTTATGCAAGAAAAGTAGAATGTCACCTTAGTTTTAATGTGAATACCA
CAACCattgtttttcaaaagaaaccagACACGGAAATTGATCACGTGTTT
TTTTCAACGCCCCCTCTTCATGCTGGGACAAAGGAAACAAACAGTAGCGT
TGCTTGGACTTTCAAAGATCCGCTAACTTCAATACCAAGTTCGTCAAACC
AAGTTTGTCTTTACCAGAAATATAAAACCTTCCAAGAATATATTTATCAG
AATCCAACTGATTGTCCAATAACGTTCACAGTAACTGGAATCAACGAATC
TTACATACATCTAGATATTGATGAACATTTGGAAATCTCCGTCAATCTGA
CCATTGATATGATTGTACCGTTACATGAAGATATAAGCGATCTTGATTGG
CTCAAAACACAAGTTTCAAATCATGAAATTGTATGCTTAAGAACACATCG
TGAAAAATCGAGGAGAGCTGAGAAAATCCGTCTTCAATTCCATCAATCTT
TGGCAATATCAGGCATCAATGTTGTCACTATCAAATCAACTATTTATAAT
TCGAAATGTGGTGGACAAAGTCTAAAATTTCAGATTCTCAATGTTTGTCC
TCCAGACAAGAAAGTGATCTTCGAATATCCAAAATCCGTTCAACCAAACG
ATTTTGCTGACGATGATCAAAAACAAGACTCAGAAGGGATTATTCGGGTC
TTTCATTTACCAACCAACTATCAACCACCTTCTTCTAAAGGTATTGGTAT
ACCACAAACGCCGCATGTATATAATGCAGACCCGGCCAAACCAATGTTTC
ATAAGAAATATCTGGCAAATCAAATCGATCCAGTcttcaaaaaatgtaaa
gatAAACGAAACAGgaCGATGTGTGGGTGTACAAAAGCTATGGAAATTTC
TACGAagattagccaatcagattgcatcAAGAAAGTATATCGTCTTCTGT
ATCCAGAAAAGTTCATCCCTCGattacttttgcaaaaaaaagctaaaaac
aaTACTGCTTTCGATAAGCTGATGCGTTTATCTGAACTCAATGCCAGAAC
TGATTATACCCTAACCAATTCAGTTCGAGTCTCAAACGGAGCCGAAGCGG
TTAGTATGAAATCAAATACCACCATTGAACTTAAAGGATCGGGATTATAT
CATTTTCAAGTGGACGTATTTGATAAAAACGTGTCGTATTGTAATTTTGA
AACGGAATTTCTAGTCTATGTTGACGGGACACCGCTTCCAAAAGCCGTTG
AATCGCTTGTCGAGGCTTTTACCGCTTTtgtttttggttttattttgttg
GGCTTGTTCTTGTACCAATattacaaaaagtaaaaaaataggaaaaatca
CGCAAAAATGTTTTACTTCAGAAAGG
Run BLAST on NCBI

protein sequence of TCONS_00001399-protein

>TCONS_00001399-protein ID=TCONS_00001399-protein|Name=TCONS_00001399-protein|organism=Clytia hemisphaerica|type=polypeptide|length=989bp
MEFFNYQSVYMVFLVSFWQAHLTLQLDFECTYNGTTLADNVKIFLDLEEN
GTSNLVCMKMQNQGFVEELKMSVSSSDTDLVTLIFNSTWTSEKVLNISDH
DIFKTNNPPSFNMKILVCEIYYVDALHENVTIIKFLAVTAHRSFSQYQRT
FGLDDSKHVVAESPCSSIVSYWIPKMLSETKNSLHLKISKETLLMIPILM
SESQKISENSTVTRFVVMNNHIILVVDNQWLWKGTLELSGDVRITKASSN
RVQVHLLTTTIHCPITDTPGVEGSETALLVHQIGNGTFLNIYAPPIESTP
LYIVTLTNITGEDIIDVKYDYGKRQVVVLLVTNTVHAFSLSGTLQCAPII
LKDTHIKNQSRLLVKCNLLLIVTNEIVVWTSTNGGCNWKRPIQWNNILHA
DFEFHSADTLKFTSNITSSYGTPLESYRDYDILWTKIGFLRPQAALNNSN
YMLLLNDKIPESNNPYLDLDIFAVTETAEGFQLEFTPNETKFPEIWIGSL
VKLGDYSCRVTAVFNATVEIYCYNSSLTFTNIIDFIQQRRWFSVDFFYAR
KVECHLSFNVNTTTIVFQKKPDTEIDHVFFSTPPLHAGTKETNSSVAWTF
KDPLTSIPSSSNQVCLYQKYKTFQEYIYQNPTDCPITFTVTGINESYIHL
DIDEHLEISVNLTIDMIVPLHEDISDLDWLKTQVSNHEIVCLRTHREKSR
RAEKIRLQFHQSLAISGINVVTIKSTIYNSKCGGQSLKFQILNVCPPDKK
VIFEYPKSVQPNDFADDDQKQDSEGIIRVFHLPTNYQPPSSKGIGIPQTP
HVYNADPAKPMFHKKYLANQIDPVFKKCKDKRNRTMCGCTKAMEISTKIS
QSDCIKKVYRLLYPEKFIPRLLLQKKAKNNTAFDKLMRLSELNARTDYTL
TNSVRVSNGAEAVSMKSNTTIELKGSGLYHFQVDVFDKNVSYCNFETEFL
VYVDGTPLPKAVESLVEAFTAFVFGFILLGLFLYQYYKK
Run BLAST on NCBI

transcript from alignment at sc0000010:1052094..1061179+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001399 ID=TCONS_00001399|Name=TCONS_00001399|organism=Clytia hemisphaerica|type=transcript|length=9086bp|location=Sequence derived from alignment at sc0000010:1052094..1061179+ (Clytia hemisphaerica)
TGAGAAAATAGATTTATTTTGTGTGGCTAGCTGCTCAAGTTCCTCAAGTC ACTGAAGTCAAGCAACGAGGATTTTTGATATCCTTTAATTATGAAGTGTA CTTAGTTTAAAAAATGGAGTTTTTTAATTACCAATCTGTTTATATGGTTT TCTTGGTTTCTTTTTGGCAAGCTCATTTAACATTACAACTTGATTTTGAA TGTACTTACAATGGGACAACACTTGCTGACAACGTCAAAATCTTTCTCGA CTTAGAGGAAAATGGAACATCAAATCTAGTGTGTATGAAAATGCAAAACC AAGGCTTCGTTGAAGAGCTTAAAATGAGTGTTTCCAGCAGTGACACTGAT TTGGTGACTCTAATCTTTAATTCCACATGGACTTCAGAAAAAGTCCTAAA CATTTCTGACCATGATATATTTAAAACTAATAACCCACCGAGTTTCAACA TGAAGATTTTGGTTTGTGAAATATATTACGTCGATGCTTTACATGAAAAT GTTaccataataaaatttttggctGTTACAGCACATAGATCATTCAGTCA ATATCAGAGGACTTTTGGTTTGGATGATTCAAAGCATGTTGTAGCTGAAA GTCCATGTTCTAGCATTGTTTCTTACTGGATACCAAAGATGTTATCGGAA ACGAAAAACTGTAAGAATTGTTTcgtgtcccggggggggggtactaggtt ggTGAGTTTGTGAGGTGATGGGTATGTcagagccaaaaatcgaaaattga agctttgagaGGAACCCGTTTTGGGACCcttaaaaaaatctcaaaaattt tatcgattttcactcgatttttgtcaaaattttgaaaattcacgACCGTT AGAGaggaaatttcagaatttttgaatttcgtgatttttggacCCTTGCA GAGAAtcgattttctttttaatggtgCTTGTACCTCTTTGAGTTTGAGAG ACTTTCAAGGgtgtagtagggggaaatttgttcgttttttttttaaggtc gctcgatttttttagtcaaaacacttgttatacatttttggaaagctaag gggtaggggaatcaaaataactttggtgccaatttttttttcggacaaat atgacggtctaaGGCAAAAATTaaagggtgaaaaattaacgaaaatttta gcttgTGAAAATGGAgatctgttgtatatttttggaaagctctcaaaaaa ttaagattagagatatattgcaagtataggtgatttctgtacctaactcg ataCATTAACcctgtttttcagccagaaacagctgttttgttcagttttt gcgctttcggaagctcaatatctcaagttaggtactgaaatcaccaatat atcactaatcttaatttttcagagctttccaaaaatatacaacagacgtc tctattttctcaagctaaaattttcattatttactGACTGATAATCTTTG CCTGAGACTGTCATATTTGTcgaaaaatcacaccaaagtgtccgaaaaac aattggcacccaagttattttgattcccctattagctttccaaaaatgta taacaagtgctttgactaaaagaATCGAGCGATTGCACAAATTTCCTCCT ACTAGTGTGAAAAAGGGGCCCTTATGGCTCGTACATACCCGgaacccatt ttgcctaagtgccccccccctcccccgagGGCTTTGTACCCGAGGGCTAA AAGTCAtgtaaagaaaattatttcagTTTCATCCAAGATTTTAACCCAAt cgtttttctcaaattttagagcattaaaatgttctttatctCTCCTCTCG CACATTCTAGAATTCTTACATGCCCTTTCGATTCTGACCTTGTTAAAGAT TAAAAATAGTTGGCACACACATTTGTCGATTCCTTTTTCAGCACTTCACT TGAAGATCAGCAAAGAAACACTTCTAATGATACCCATTCTTATGAGTGAA AGCCAAAAGATTTCAGAGAATTCAACGGTAACCCGTTTCGTTGTTATGAA TAATCACATCATTCTGGTAGTTGATAACCAGTGGCTATGGAAAGGAACAT TAGAACTATCTGGGGTGAggaactttttcaaaagttataacCTGATGAGA ACTTAGACTTATACCTTTTACAAATGCTTTCAGAAATCACTTGTGGCATT CTTCTTTAAGAAAAAACGTTGCGTTACTTCTTTGGTTTTCTGGTTAGAAC TCATTCTGACTCATTTTCAAAGCCTTACCTCTCATCAGAGACTTGATCTG ATGGCTTAATGTCTTATCAGAAAACACCCCTAACCGCTTCGCCCATATAG TGACCCGACTCCATATAATGATCTACTTTCTAGCCAATGAGAGTGATGTC TTAAGAGAACAAAATACTGTTGGGTCTTCAAAATGTCCGTTATTTTCAgc atggtttcagccccccagaaatctgaagggcacctatGCCAGGTTAGTAG TAGGGGGCTAATgttttgcaattctttggggttacctattcattaagggt acctagctgtcttgatatgatggaggctctgggggctggttatattttcc aaatcaaatatttcaaaatatttaaaattattgaatttttttaccccagc acctagtttcccatccaatttttctttcgtttcccatCACACCATccttt gctatatttttctaatgtgattgttttgatttacggccgccatctttata gcataacaacaaagctTACCAGCAGGTATTCATGCGTGAGCGCTTCCCAT GCTGAataggggtacctaactcaaagcaatttctcaaggggacctaacTC TTAGGGGGCACCATGCTTCAATGGGGCatctgaaaagtgggctgaaacca tgtttTAATGAGCCCTCTAGCGCTTTTCGTGTGATTGGGGTTTTTTCAAA CTCGTGATTTTACGATTGAAGATTTTAAAGTGCGTGATTGTGTGATCGGA GGAACCGACGTGATGATCAACATGATCgtgatagaaagaaaatttaactc gtgataACGTGACTGGGGGTCTCTTCAATTGGTAGGAAGTAAAGTTCTAa agtaaaattcaaaatccaGTGGTTACCCACAAAATTATAGTGTATTTCGT ATCTGGAATAAATACTCTGTTTACGTTTCTAAGGGTTATTGAAATTCATG GTTTCTTGCTAACCGGGACACATTTCTTCGGTAGGTATGGCTTCCGTCTA GGTCAGGGATGTAAACCTAATTGCTGAAATCTCTATAATTCTAGGATGTG AGAATTACCAAAGCATCATCAAATCGAGTCCAAGTTCATTTGCTAACAAC AACGATTCACTGTCCAATCACTGATACCCCTGGAGTCGAAGGCTCTGAAA CAGCGCTCTTGGTACATCAAATTGGAAATGGCACCTTCCTCAACATTTAC GCGCCGCCCATTGAATCAACGCCCCTTTACATTGTGACTTTGACAAATAT CACTGGTGAAGATATCATAGATGTGAAATATGATTATGGTAAAAGACAAG TTGTCGTACTATTGGTGAGTACTgtaaattttgtcaaatttgacaatttt aaAAATTCGTCAAATTAGCTTAATCGCCAAATTTAAAGGTGCGACCTCAC CAAAATATATCGATGTTGCTCTCtgcaataaaaaagaaaactccagttta ttgccaccgcaggaagcctaaagcttccgaggatggcattcatagcttca cgcataaggaagttgggcaaacatctcataattttgcgcgcgttttNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNggtaacattcttagcttgactgtatttctattgttt tatcatcattaaaaacacttttccggattttttttgatctgattacccat tttcaaagctctatgtctttttttattacctcagggagtcgaattaaggg aaattcctttttttgttggaaaattccctatttaaaccacaagtagttat taaccgctTTGAGCAAtgcaaattagaaatttttatcctttcaaaaactt gtcgtttgactattacagtaaaatggcagtttagtacagtagcgtttagt atgCTATAAACAAACCATAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNTATCTATGAGCTGGACACaaattgctaatatttgta gactagattttgcttcagatgagatgccattctaacagaagtaacggcta taagtaacatttctttccgaattcaacaatttatttgatcgtttttctgc ggtggcactttaatgaaaattatggctagtaaaatcttctattttgaaat ttcaaagaatCCTGTATTCGGTTCTGAGAAGAACTTCCAGTTTAAAAATC GAATTCAAAAACCTCtcatataaaacttactaatcaaattcaaaaaccTC TCATATACAACTTACTAATCGagctaatcaagtttctaaaacttaAGAAC ACAAAGACGAGGGTAACTCTCAGACAGGAATTCTATACACTTTGTGCATT TTCTATATTacaacatatcagaggggatgcgtgcagtcTACAGTCAAAGC AACGAGCAGAAACGTGAAATTAAAATTTAGACTCCGTTCTCTTTTTAGAT TTCATTACTTTCGGCAATCGAATTGATATTtctcgattgtgttcgattac gttcatCAACAAAGTGTCAATCAACTTCTATTTAATTTGTTCATTATTAT TCCTTTTAGGTTACAAATACAGTACACGCATTCTCGTTATCTGGAACACT GCAATGTGCGCCGATAATTTTGAAGGATACACATATTAAAAACCAATCAA GACTTCTCGTAAAGTGCAACCTTCTGTTGATCGTCACAAATGTTAGTACA TTTCTGCCCAgttctgacaaaaggaagtaactgacatttttatgaatttt cattttttagcaaaaatggATTCTTTGGgtcaaaacttaatttttttagc ttggaaaaaagttttttgtgttGTCaatctggaaaaaaaatttgaatata gtAAAGAAGCAACTGACAGGTTTCTGGAGAAtattttctgacaaaaagaa gtTAATGACTGTTTTGCTTCTTTCTGTCAGAAAAAGTCATCACTTTTGTC AGAAATGTTCTTTCAGGAAACTGGTCAGCTACCTCTTTACTGACAAAGCA ACTGTCTTGTTTTTCTCTGCAACAATGAAAATTTGGAGAAAAGCAGTGAT GCTCAAAACTTATCTTCGATGAGTAGAACAATAATCAGTCATTTGTTTTT TGATATGTACAGTACTTTCTGCATCCGATGCCAGCATAAAGCGCGCTTGG TCAATTTTCTCAACTTCAACTTCATGTcagttacttccttttgtcagaaa tGGGCAGATTTCTAATCTTcatgatattttttaattatatatATGCAGCA ATCAGAGTTTAATTAAGATGTGGTGGGGTCAGATAGAATCTAACTTGAAC TTCAAAAGAGCCAAGTCAATACTCAAGAGattattactttttttaaacac cCGACCCCCGTATCAGCCATAACTCGATAGAATCACACTCTCCATAGATA TTCTATCATGCagaatttttaacaaagaaaaatctATAATAACTTTTTAC ATACAAATACTCCACATTTAGGAAATAGTTGTTTGGACATCAACAAATGG TGGATGCAATTGGAAACGACCTATACAATGGAACAACATCCTCCATGCAG ACTTTGAGTTCCATTCTGCCGATACATTGAAATTTACATCTAACATAACA TCAAGTTACGGAACTCCGCTAGAAAGCTATCGGGATTATGATATTTTATG GACCAAAATTGGTTTCTTACGTCCACAAGCAGCATTGAATAACTCTAATT ACATGTTGCTCCTCAATGACAAGATTCCGGAAAGCAATAACCCTTATCTT GATTTAGACATTTTTGCCGTAACAGAAACCGCAGAAGGATTCCAGTTAGA GTTTACGCCAAATGAGACGAAGTTTCCTGAAATTTGGATTGGTTCCTTGG TAAAGCTTGGTGACTACTCATGTCGCGTCACGGCTGTTTTCAACGCTACT GTCGAGATTTATTGCTACAATAGTAGTTTAACATTCACAAACATTATCGA CTTTATCCAGCAACGACGCTGGTTTAGTGTCGATTTCTTTTATGCAAGAA AAGTAGAATGTCACCTTAGTTTTAATGTGAATACCACAACCattgttttt caaaagaaaccagACACGGAAATTGATCACGTGTTTTTTTCAACGCCCCC TCTTCATGCTGGGACAAAGGAAACAAACAGTAGCGTTGCTTGGACTTTCA AAGATCCGCTAACTTCAATACCAAGTTCGTCAAACCAAGTTTGTCTTTAC CAGAAATATAAAACCTTCCAAGAATATATTTATCAGAATCCAACTGATTG TCCAATAACGTTCACAGTAACTGGAATCAACGAATCTTACATACATCTAG ATATTGATGAACATTTGGAAATCTCCGTCAATCTGACCATTGATATGATT GTACCGTTACATGAAGATATAAGCGATCTTGATTGGCTCAAAACACAAGT TTCAAATCATGAAATTGTATGCTTAAGAACACATCGTGAAAAATCGAGGA GAGCTGAGAAAATCCGTCTTCAATTCCATCAATCTTTGGCAATATCAGGC ATCAATGTTGTCACTATCAAATCAACTATTTATAATTCGAAATGTGGTGG ACAAAGTCTAAAATTTCAGATTCTCAATGTTTGTCCTCCAGACAAGAAAG TGATCTTCGAATATCCAAAATCCGTTCAACCAAACGATTTTGCTGACGAT GATCAAAAACAAGACTCAGAAGGGATTATTCGGGTCTTTCATTTACCAAC CAACTATCAACCACCTTCTTCTAAAGGTATTGGTATACCACAAACGCCGC ATGTATATAATGCAGACCCGGCCAAACCAATGTTTCATAAGAAATATCTG GCAAATCAAATCGATCCAGTcttcaaaaaatgtaaagatAAACGAAACAG GTGATTCATATTCTCTATTTTgtattgtacacgttttttttttataagaa cgtcaaaaaatttcgaagccttcggatgttcttagttttttggatttgaa gcctaaaaatgttcttaaaatgttNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTCCAAAGCCTtggtat gttcttagaatgttcttaaatttttgggcctcgaagccttatgttcttat atagtttgttcttataaaaaaaacgtgtactgtatTCAGTTGTGAAGGTG GGTGTTGCTTGTGATCTTGTCTATAACacgttttctataagaacaaacta tgttagaacataaggctttgcaGACAAAACATCtcatttcttaggaaaat aaacaaaaatgctCAGAAagtggtaaaaataagaacatgttaagaacatt tttatgcttaaaactaaagaaattaagaacatccgaaggattcaaaaatt ttggatgttcttataaaaaatatgtacttgaagttatatatcaaatttaa aatttggttAAAATGCATTTGTTTGTAATCAAATGGATAACTGCGCTCGT AGTAGTAGAGCCGTCCCTCGATCGAAGACTGACTGTGAAGATTGTAATCT TCCCTGGATCAAAAGATGTTTGCGTGAAAGTTCAGCCTACACTACTCACT TTtgatgatttatttatttttcaggaCGATGTGTGGGTGTACAAAAGCTA TGGAAATTTCTACGAagattagccaatcagattgcatcAAGAAAGTATAT CGTCTTCTGTATCCAGAAAAGTTCATCCCTCGattacttttgcaaaaaaa agctaaaaacaaTACTGCTTTCGATAAGCTGATGCGTTTATCTGAACTCA ATGCCAGAACTGATTATACCCTAACCAATTCAGTTCGAGTCTCAAACGGA GCCGAAGCGGTTAGTATGAAATCAAATACCACCATTGAACTTAAAGGATC GGGATTATATCATTTTCAAGTGGACGTATTTGATAAAAACGTGTCGTATT GTAATTTTGAAACGGAATTTCTAGTCTATGTTGACGGGACACCGCTTCCA AAAGCCGTTGAATCGCTTGTCGAGGCTTTTACCGCTTTtgtttttggttt tattttgttgGGCTTGTTCTTGTACCAATattacaaaaagtaaaaaaata ggaaaaatcaCGCAAAAATGTTTTACTTCAGAAAGG

Coding sequence (CDS) from alignment at sc0000010:1052094..1061179+

>TCONS_00001399 ID=TCONS_00001399|Name=TCONS_00001399|organism=Clytia hemisphaerica|type=CDS|length=17820bp|location=Sequence derived from alignment at sc0000010:1052094..1061179+ (Clytia hemisphaerica)
ATGGAGTTTTTTAATTACCAATCTGTTTATATGGTTTTCTTGGTTTCTTT
TTGGCAAGCTCATTTAACATTACAACTTGATTTTGAATGTACTTACAATG
GGACAACACTTGCTGACAACGTCAAAATCTTTCTCGACTTAGAGGAAAAT
GGAACATCAAATCTAGTGTGTATGAAAATGCAAAACCAAGGCTTCGTTGA
AGAGCTTAAAATGAGTGTTTCCAGCAGTGACACTGATTTGGTGACTCTAA
TCTTTAATTCCACATGGACTTCAGAAAAAGTCCTAAACATTTCTGACCAT
GATATATTTAAAACTAATAACCCACCGAGTTTCAACATGAAGATTTTGGT
TTGTGAAATATATTACGTCGATGCTTTACATGAAAATGTTaccataataa
aatttttggctGTTACAGCACATAGATCATTCAGTCAATATCAGAGGACT
TTTGGTTTGGATGATTCAAAGCATGTTGTAGCTGAAAGTCCATGTTCTAG
CATTGTTTCTTACTGGATACCAAAGATGTTATCGGAAACGAAAAACTCAC
TTCACTTGAAGATCAGCAAAGAAACACTTCTAATGATACCCATTCTTATG
AGTGAAAGCCAAAAGATTTCAGAGAATTCAACGGTAACCCGTTTCGTTGT
TATGAATAATCACATCATTCTGGTAGTTGATAACCAGTGGCTATGGAAAG
GAACATTAGAACTATCTGGGGATGTGAGAATTACCAAAGCATCATCAAAT
CGAGTCCAAGTTCATTTGCTAACAACAACGATTCACTGTCCAATCACTGA
TACCCCTGGAGTCGAAGGCTCTGAAACAGCGCTCTTGGTACATCAAATTG
GAAATGGCACCTTCCTCAACATTTACGCGCCGCCCATTGAATCAACGCCC
CTTTACATTGTGACTTTGACAAATATCACTGGTGAAGATATCATAGATGT
GAAATATGATTATGGTAAAAGACAAGTTGTCGTACTATTGGTTACAAATA
CAGTACACGCATTCTCGTTATCTGGAACACTGCAATGTGCGCCGATAATT
TTGAAGGATACACATATTAAAAACCAATCAAGACTTCTCGTAAAGTGCAA
CCTTCTGTTGATCGTCACAAATGAAATAGTTGTTTGGACATCAACAAATG
GTGGATGCAATTGGAAACGACCTATACAATGGAACAACATCCTCCATGCA
GACTTTGAGTTCCATTCTGCCGATACATTGAAATTTACATCTAACATAAC
ATCAAGTTACGGAACTCCGCTAGAAAGCTATCGGGATTATGATATTTTAT
GGACCAAAATTGGTTTCTTACGTCCACAAGCAGCATTGAATAACTCTAAT
TACATGTTGCTCCTCAATGACAAGATTCCGGAAAGCAATAACCCTTATCT
TGATTTAGACATTTTTGCCGTAACAGAAACCGCAGAAGGATTCCAGTTAG
AGTTTACGCCAAATGAGACGAAGTTTCCTGAAATTTGGATTGGTTCCTTG
GTAAAGCTTGGTGACTACTCATGTCGCGTCACGGCTGTTTTCAACGCTAC
TGTCGAGATTTATTGCTACAATAGTAGTTTAACATTCACAAACATTATCG
ACTTTATCCAGCAACGACGCTGGTTTAGTGTCGATTTCTTTTATGCAAGA
AAAGTAGAATGTCACCTTAGTTTTAATGTGAATACCACAACCattgtttt
tcaaaagaaaccagACACGGAAATTGATCACGTGTTTTTTTCAACGCCCC
CTCTTCATGCTGGGACAAAGGAAACAAACAGTAGCGTTGCTTGGACTTTC
AAAGATCCGCTAACTTCAATACCAAGTTCGTCAAACCAAGTTTGTCTTTA
CCAGAAATATAAAACCTTCCAAGAATATATTTATCAGAATCCAACTGATT
GTCCAATAACGTTCACAGTAACTGGAATCAACGAATCTTACATACATCTA
GATATTGATGAACATTTGGAAATCTCCGTCAATCTGACCATTGATATGAT
TGTACCGTTACATGAAGATATAAGCGATCTTGATTGGCTCAAAACACAAG
TTTCAAATCATGAAATTGTATGCTTAAGAACACATCGTGAAAAATCGAGG
AGAGCTGAGAAAATCCGTCTTCAATTCCATCAATCTTTGGCAATATCAGG
CATCAATGTTGTCACTATCAAATCAACTATTTATAATTCGAAATGTGGTG
GACAAAGTCTAAAATTTCAGATTCTCAATGTTTGTCCTCCAGACAAGAAA
GTGATCTTCGAATATCCAAAATCCGTTCAACCAAACGATTTTGCTGACGA
TGATCAAAAACAAGACTCAGAAGGGATTATTCGGGTCTTTCATTTACCAA
CCAACTATCAACCACCTTCTTCTAAAGGTATTGGTATACCACAAACGCCG
CATGTATATAATGCAGACCCGGCCAAACCAATGTTTCATAAGAAATATCT
GGCAAATCAAATCGATCCAGTcttcaaaaaatgtaaagatAAACGAAACA
GgaCGATGTGTGGGTGTACAAAAGCTATGGAAATTTCTACGAagattagc
caatcagattgcatcAAGAAAGTATATCGTCTTCTGTATCCAGAAAAGTT
CATCCCTCGattacttttgcaaaaaaaagctaaaaacaaTACTGCTTTCG
ATAAGCTGATGCGTTTATCTGAACTCAATGCCAGAACTGATTATACCCTA
ACCAATTCAGTTCGAGTCTCAAACGGAGCCGAAGCGGTTAGTATGAAATC
AAATACCACCATTGAACTTAAAGGATCGGGATTATATCATTTTCAAGTGG
ACGTATTTGATAAAAACGTGTCGTATTGTAATTTTGAAACGGAATTTCTA
GTCTATGTTGACGGGACACCGCTTCCAAAAGCCGTTGAATCGCTTGTCGA
GGCTTTTACCGCTTTtgtttttggttttattttgttgGGCTTGTTCTTGT
ACCAATattacaaaaagtaaATGGAGTTTTTTAATTACCAATCTGTTTAT
ATGGTTTTCTTGGTTTCTTTTTGGCAAGCTCATTTAACATTACAACTTGA
TTTTGAATGTACTTACAATGGGACAACACTTGCTGACAACGTCAAAATCT
TTCTCGACTTAGAGGAAAATGGAACATCAAATCTAGTGTGTATGAAAATG
CAAAACCAAGGCTTCGTTGAAGAGCTTAAAATGAGTGTTTCCAGCAGTGA
CACTGATTTGGTGACTCTAATCTTTAATTCCACATGGACTTCAGAAAAAG
TCCTAAACATTTCTGACCATGATATATTTAAAACTAATAACCCACCGAGT
TTCAACATGAAGATTTTGGTTTGTGAAATATATTACGTCGATGCTTTACA
TGAAAATGTTaccataataaaatttttggctGTTACAGCACATAGATCAT
TCAGTCAATATCAGAGGACTTTTGGTTTGGATGATTCAAAGCATGTTGTA
GCTGAAAGTCCATGTTCTAGCATTGTTTCTTACTGGATACCAAAGATGTT
ATCGGAAACGAAAAACTCACTTCACTTGAAGATCAGCAAAGAAACACTTC
TAATGATACCCATTCTTATGAGTGAAAGCCAAAAGATTTCAGAGAATTCA
ACGGTAACCCGTTTCGTTGTTATGAATAATCACATCATTCTGGTAGTTGA
TAACCAGTGGCTATGGAAAGGAACATTAGAACTATCTGGGGATGTGAGAA
TTACCAAAGCATCATCAAATCGAGTCCAAGTTCATTTGCTAACAACAACG
ATTCACTGTCCAATCACTGATACCCCTGGAGTCGAAGGCTCTGAAACAGC
GCTCTTGGTACATCAAATTGGAAATGGCACCTTCCTCAACATTTACGCGC
CGCCCATTGAATCAACGCCCCTTTACATTGTGACTTTGACAAATATCACT
GGTGAAGATATCATAGATGTGAAATATGATTATGGTAAAAGACAAGTTGT
CGTACTATTGGTTACAAATACAGTACACGCATTCTCGTTATCTGGAACAC
TGCAATGTGCGCCGATAATTTTGAAGGATACACATATTAAAAACCAATCA
AGACTTCTCGTAAAGTGCAACCTTCTGTTGATCGTCACAAATGAAATAGT
TGTTTGGACATCAACAAATGGTGGATGCAATTGGAAACGACCTATACAAT
GGAACAACATCCTCCATGCAGACTTTGAGTTCCATTCTGCCGATACATTG
AAATTTACATCTAACATAACATCAAGTTACGGAACTCCGCTAGAAAGCTA
TCGGGATTATGATATTTTATGGACCAAAATTGGTTTCTTACGTCCACAAG
CAGCATTGAATAACTCTAATTACATGTTGCTCCTCAATGACAAGATTCCG
GAAAGCAATAACCCTTATCTTGATTTAGACATTTTTGCCGTAACAGAAAC
CGCAGAAGGATTCCAGTTAGAGTTTACGCCAAATGAGACGAAGTTTCCTG
AAATTTGGATTGGTTCCTTGGTAAAGCTTGGTGACTACTCATGTCGCGTC
ACGGCTGTTTTCAACGCTACTGTCGAGATTTATTGCTACAATAGTAGTTT
AACATTCACAAACATTATCGACTTTATCCAGCAACGACGCTGGTTTAGTG
TCGATTTCTTTTATGCAAGAAAAGTAGAATGTCACCTTAGTTTTAATGTG
AATACCACAACCattgtttttcaaaagaaaccagACACGGAAATTGATCA
CGTGTTTTTTTCAACGCCCCCTCTTCATGCTGGGACAAAGGAAACAAACA
GTAGCGTTGCTTGGACTTTCAAAGATCCGCTAACTTCAATACCAAGTTCG
TCAAACCAAGTTTGTCTTTACCAGAAATATAAAACCTTCCAAGAATATAT
TTATCAGAATCCAACTGATTGTCCAATAACGTTCACAGTAACTGGAATCA
ACGAATCTTACATACATCTAGATATTGATGAACATTTGGAAATCTCCGTC
AATCTGACCATTGATATGATTGTACCGTTACATGAAGATATAAGCGATCT
TGATTGGCTCAAAACACAAGTTTCAAATCATGAAATTGTATGCTTAAGAA
CACATCGTGAAAAATCGAGGAGAGCTGAGAAAATCCGTCTTCAATTCCAT
CAATCTTTGGCAATATCAGGCATCAATGTTGTCACTATCAAATCAACTAT
TTATAATTCGAAATGTGGTGGACAAAGTCTAAAATTTCAGATTCTCAATG
TTTGTCCTCCAGACAAGAAAGTGATCTTCGAATATCCAAAATCCGTTCAA
CCAAACGATTTTGCTGACGATGATCAAAAACAAGACTCAGAAGGGATTAT
TCGGGTCTTTCATTTACCAACCAACTATCAACCACCTTCTTCTAAAGGTA
TTGGTATACCACAAACGCCGCATGTATATAATGCAGACCCGGCCAAACCA
ATGTTTCATAAGAAATATCTGGCAAATCAAATCGATCCAGTcttcaaaaa
atgtaaagatAAACGAAACAGgaCGATGTGTGGGTGTACAAAAGCTATGG
AAATTTCTACGAagattagccaatcagattgcatcAAGAAAGTATATCGT
CTTCTGTATCCAGAAAAGTTCATCCCTCGattacttttgcaaaaaaaagc
taaaaacaaTACTGCTTTCGATAAGCTGATGCGTTTATCTGAACTCAATG
CCAGAACTGATTATACCCTAACCAATTCAGTTCGAGTCTCAAACGGAGCC
GAAGCGGTTAGTATGAAATCAAATACCACCATTGAACTTAAAGGATCGGG
ATTATATCATTTTCAAGTGGACGTATTTGATAAAAACGTGTCGTATTGTA
ATTTTGAAACGGAATTTCTAGTCTATGTTGACGGGACACCGCTTCCAAAA
GCCGTTGAATCGCTTGTCGAGGCTTTTACCGCTTTtgtttttggttttat
tttgttgGGCTTGTTCTTGTACCAATattacaaaaagtaaATGGAGTTTT
TTAATTACCAATCTGTTTATATGGTTTTCTTGGTTTCTTTTTGGCAAGCT
CATTTAACATTACAACTTGATTTTGAATGTACTTACAATGGGACAACACT
TGCTGACAACGTCAAAATCTTTCTCGACTTAGAGGAAAATGGAACATCAA
ATCTAGTGTGTATGAAAATGCAAAACCAAGGCTTCGTTGAAGAGCTTAAA
ATGAGTGTTTCCAGCAGTGACACTGATTTGGTGACTCTAATCTTTAATTC
CACATGGACTTCAGAAAAAGTCCTAAACATTTCTGACCATGATATATTTA
AAACTAATAACCCACCGAGTTTCAACATGAAGATTTTGGTTTGTGAAATA
TATTACGTCGATGCTTTACATGAAAATGTTaccataataaaatttttggc
tGTTACAGCACATAGATCATTCAGTCAATATCAGAGGACTTTTGGTTTGG
ATGATTCAAAGCATGTTGTAGCTGAAAGTCCATGTTCTAGCATTGTTTCT
TACTGGATACCAAAGATGTTATCGGAAACGAAAAACTCACTTCACTTGAA
GATCAGCAAAGAAACACTTCTAATGATACCCATTCTTATGAGTGAAAGCC
AAAAGATTTCAGAGAATTCAACGGTAACCCGTTTCGTTGTTATGAATAAT
CACATCATTCTGGTAGTTGATAACCAGTGGCTATGGAAAGGAACATTAGA
ACTATCTGGGGATGTGAGAATTACCAAAGCATCATCAAATCGAGTCCAAG
TTCATTTGCTAACAACAACGATTCACTGTCCAATCACTGATACCCCTGGA
GTCGAAGGCTCTGAAACAGCGCTCTTGGTACATCAAATTGGAAATGGCAC
CTTCCTCAACATTTACGCGCCGCCCATTGAATCAACGCCCCTTTACATTG
TGACTTTGACAAATATCACTGGTGAAGATATCATAGATGTGAAATATGAT
TATGGTAAAAGACAAGTTGTCGTACTATTGGTTACAAATACAGTACACGC
ATTCTCGTTATCTGGAACACTGCAATGTGCGCCGATAATTTTGAAGGATA
CACATATTAAAAACCAATCAAGACTTCTCGTAAAGTGCAACCTTCTGTTG
ATCGTCACAAATGAAATAGTTGTTTGGACATCAACAAATGGTGGATGCAA
TTGGAAACGACCTATACAATGGAACAACATCCTCCATGCAGACTTTGAGT
TCCATTCTGCCGATACATTGAAATTTACATCTAACATAACATCAAGTTAC
GGAACTCCGCTAGAAAGCTATCGGGATTATGATATTTTATGGACCAAAAT
TGGTTTCTTACGTCCACAAGCAGCATTGAATAACTCTAATTACATGTTGC
TCCTCAATGACAAGATTCCGGAAAGCAATAACCCTTATCTTGATTTAGAC
ATTTTTGCCGTAACAGAAACCGCAGAAGGATTCCAGTTAGAGTTTACGCC
AAATGAGACGAAGTTTCCTGAAATTTGGATTGGTTCCTTGGTAAAGCTTG
GTGACTACTCATGTCGCGTCACGGCTGTTTTCAACGCTACTGTCGAGATT
TATTGCTACAATAGTAGTTTAACATTCACAAACATTATCGACTTTATCCA
GCAACGACGCTGGTTTAGTGTCGATTTCTTTTATGCAAGAAAAGTAGAAT
GTCACCTTAGTTTTAATGTGAATACCACAACCattgtttttcaaaagaaa
ccagACACGGAAATTGATCACGTGTTTTTTTCAACGCCCCCTCTTCATGC
TGGGACAAAGGAAACAAACAGTAGCGTTGCTTGGACTTTCAAAGATCCGC
TAACTTCAATACCAAGTTCGTCAAACCAAGTTTGTCTTTACCAGAAATAT
AAAACCTTCCAAGAATATATTTATCAGAATCCAACTGATTGTCCAATAAC
GTTCACAGTAACTGGAATCAACGAATCTTACATACATCTAGATATTGATG
AACATTTGGAAATCTCCGTCAATCTGACCATTGATATGATTGTACCGTTA
CATGAAGATATAAGCGATCTTGATTGGCTCAAAACACAAGTTTCAAATCA
TGAAATTGTATGCTTAAGAACACATCGTGAAAAATCGAGGAGAGCTGAGA
AAATCCGTCTTCAATTCCATCAATCTTTGGCAATATCAGGCATCAATGTT
GTCACTATCAAATCAACTATTTATAATTCGAAATGTGGTGGACAAAGTCT
AAAATTTCAGATTCTCAATGTTTGTCCTCCAGACAAGAAAGTGATCTTCG
AATATCCAAAATCCGTTCAACCAAACGATTTTGCTGACGATGATCAAAAA
CAAGACTCAGAAGGGATTATTCGGGTCTTTCATTTACCAACCAACTATCA
ACCACCTTCTTCTAAAGGTATTGGTATACCACAAACGCCGCATGTATATA
ATGCAGACCCGGCCAAACCAATGTTTCATAAGAAATATCTGGCAAATCAA
ATCGATCCAGTcttcaaaaaatgtaaagatAAACGAAACAGgaCGATGTG
TGGGTGTACAAAAGCTATGGAAATTTCTACGAagattagccaatcagatt
gcatcAAGAAAGTATATCGTCTTCTGTATCCAGAAAAGTTCATCCCTCGa
ttacttttgcaaaaaaaagctaaaaacaaTACTGCTTTCGATAAGCTGAT
GCGTTTATCTGAACTCAATGCCAGAACTGATTATACCCTAACCAATTCAG
TTCGAGTCTCAAACGGAGCCGAAGCGGTTAGTATGAAATCAAATACCACC
ATTGAACTTAAAGGATCGGGATTATATCATTTTCAAGTGGACGTATTTGA
TAAAAACGTGTCGTATTGTAATTTTGAAACGGAATTTCTAGTCTATGTTG
ACGGGACACCGCTTCCAAAAGCCGTTGAATCGCTTGTCGAGGCTTTTACC
GCTTTtgtttttggttttattttgttgGGCTTGTTCTTGTACCAATatta
caaaaagtaaATGGAGTTTTTTAATTACCAATCTGTTTATATGGTTTTCT
TGGTTTCTTTTTGGCAAGCTCATTTAACATTACAACTTGATTTTGAATGT
ACTTACAATGGGACAACACTTGCTGACAACGTCAAAATCTTTCTCGACTT
AGAGGAAAATGGAACATCAAATCTAGTGTGTATGAAAATGCAAAACCAAG
GCTTCGTTGAAGAGCTTAAAATGAGTGTTTCCAGCAGTGACACTGATTTG
GTGACTCTAATCTTTAATTCCACATGGACTTCAGAAAAAGTCCTAAACAT
TTCTGACCATGATATATTTAAAACTAATAACCCACCGAGTTTCAACATGA
AGATTTTGGTTTGTGAAATATATTACGTCGATGCTTTACATGAAAATGTT
accataataaaatttttggctGTTACAGCACATAGATCATTCAGTCAATA
TCAGAGGACTTTTGGTTTGGATGATTCAAAGCATGTTGTAGCTGAAAGTC
CATGTTCTAGCATTGTTTCTTACTGGATACCAAAGATGTTATCGGAAACG
AAAAACTCACTTCACTTGAAGATCAGCAAAGAAACACTTCTAATGATACC
CATTCTTATGAGTGAAAGCCAAAAGATTTCAGAGAATTCAACGGTAACCC
GTTTCGTTGTTATGAATAATCACATCATTCTGGTAGTTGATAACCAGTGG
CTATGGAAAGGAACATTAGAACTATCTGGGGATGTGAGAATTACCAAAGC
ATCATCAAATCGAGTCCAAGTTCATTTGCTAACAACAACGATTCACTGTC
CAATCACTGATACCCCTGGAGTCGAAGGCTCTGAAACAGCGCTCTTGGTA
CATCAAATTGGAAATGGCACCTTCCTCAACATTTACGCGCCGCCCATTGA
ATCAACGCCCCTTTACATTGTGACTTTGACAAATATCACTGGTGAAGATA
TCATAGATGTGAAATATGATTATGGTAAAAGACAAGTTGTCGTACTATTG
GTTACAAATACAGTACACGCATTCTCGTTATCTGGAACACTGCAATGTGC
GCCGATAATTTTGAAGGATACACATATTAAAAACCAATCAAGACTTCTCG
TAAAGTGCAACCTTCTGTTGATCGTCACAAATGAAATAGTTGTTTGGACA
TCAACAAATGGTGGATGCAATTGGAAACGACCTATACAATGGAACAACAT
CCTCCATGCAGACTTTGAGTTCCATTCTGCCGATACATTGAAATTTACAT
CTAACATAACATCAAGTTACGGAACTCCGCTAGAAAGCTATCGGGATTAT
GATATTTTATGGACCAAAATTGGTTTCTTACGTCCACAAGCAGCATTGAA
TAACTCTAATTACATGTTGCTCCTCAATGACAAGATTCCGGAAAGCAATA
ACCCTTATCTTGATTTAGACATTTTTGCCGTAACAGAAACCGCAGAAGGA
TTCCAGTTAGAGTTTACGCCAAATGAGACGAAGTTTCCTGAAATTTGGAT
TGGTTCCTTGGTAAAGCTTGGTGACTACTCATGTCGCGTCACGGCTGTTT
TCAACGCTACTGTCGAGATTTATTGCTACAATAGTAGTTTAACATTCACA
AACATTATCGACTTTATCCAGCAACGACGCTGGTTTAGTGTCGATTTCTT
TTATGCAAGAAAAGTAGAATGTCACCTTAGTTTTAATGTGAATACCACAA
CCattgtttttcaaaagaaaccagACACGGAAATTGATCACGTGTTTTTT
TCAACGCCCCCTCTTCATGCTGGGACAAAGGAAACAAACAGTAGCGTTGC
TTGGACTTTCAAAGATCCGCTAACTTCAATACCAAGTTCGTCAAACCAAG
TTTGTCTTTACCAGAAATATAAAACCTTCCAAGAATATATTTATCAGAAT
CCAACTGATTGTCCAATAACGTTCACAGTAACTGGAATCAACGAATCTTA
CATACATCTAGATATTGATGAACATTTGGAAATCTCCGTCAATCTGACCA
TTGATATGATTGTACCGTTACATGAAGATATAAGCGATCTTGATTGGCTC
AAAACACAAGTTTCAAATCATGAAATTGTATGCTTAAGAACACATCGTGA
AAAATCGAGGAGAGCTGAGAAAATCCGTCTTCAATTCCATCAATCTTTGG
CAATATCAGGCATCAATGTTGTCACTATCAAATCAACTATTTATAATTCG
AAATGTGGTGGACAAAGTCTAAAATTTCAGATTCTCAATGTTTGTCCTCC
AGACAAGAAAGTGATCTTCGAATATCCAAAATCCGTTCAACCAAACGATT
TTGCTGACGATGATCAAAAACAAGACTCAGAAGGGATTATTCGGGTCTTT
CATTTACCAACCAACTATCAACCACCTTCTTCTAAAGGTATTGGTATACC
ACAAACGCCGCATGTATATAATGCAGACCCGGCCAAACCAATGTTTCATA
AGAAATATCTGGCAAATCAAATCGATCCAGTcttcaaaaaatgtaaagat
AAACGAAACAGgaCGATGTGTGGGTGTACAAAAGCTATGGAAATTTCTAC
GAagattagccaatcagattgcatcAAGAAAGTATATCGTCTTCTGTATC
CAGAAAAGTTCATCCCTCGattacttttgcaaaaaaaagctaaaaacaaT
ACTGCTTTCGATAAGCTGATGCGTTTATCTGAACTCAATGCCAGAACTGA
TTATACCCTAACCAATTCAGTTCGAGTCTCAAACGGAGCCGAAGCGGTTA
GTATGAAATCAAATACCACCATTGAACTTAAAGGATCGGGATTATATCAT
TTTCAAGTGGACGTATTTGATAAAAACGTGTCGTATTGTAATTTTGAAAC
GGAATTTCTAGTCTATGTTGACGGGACACCGCTTCCAAAAGCCGTTGAAT
CGCTTGTCGAGGCTTTTACCGCTTTtgtttttggttttattttgttgGGC
TTGTTCTTGTACCAATattacaaaaagtaaATGGAGTTTTTTAATTACCA
ATCTGTTTATATGGTTTTCTTGGTTTCTTTTTGGCAAGCTCATTTAACAT
TACAACTTGATTTTGAATGTACTTACAATGGGACAACACTTGCTGACAAC
GTCAAAATCTTTCTCGACTTAGAGGAAAATGGAACATCAAATCTAGTGTG
TATGAAAATGCAAAACCAAGGCTTCGTTGAAGAGCTTAAAATGAGTGTTT
CCAGCAGTGACACTGATTTGGTGACTCTAATCTTTAATTCCACATGGACT
TCAGAAAAAGTCCTAAACATTTCTGACCATGATATATTTAAAACTAATAA
CCCACCGAGTTTCAACATGAAGATTTTGGTTTGTGAAATATATTACGTCG
ATGCTTTACATGAAAATGTTaccataataaaatttttggctGTTACAGCA
CATAGATCATTCAGTCAATATCAGAGGACTTTTGGTTTGGATGATTCAAA
GCATGTTGTAGCTGAAAGTCCATGTTCTAGCATTGTTTCTTACTGGATAC
CAAAGATGTTATCGGAAACGAAAAACTCACTTCACTTGAAGATCAGCAAA
GAAACACTTCTAATGATACCCATTCTTATGAGTGAAAGCCAAAAGATTTC
AGAGAATTCAACGGTAACCCGTTTCGTTGTTATGAATAATCACATCATTC
TGGTAGTTGATAACCAGTGGCTATGGAAAGGAACATTAGAACTATCTGGG
GATGTGAGAATTACCAAAGCATCATCAAATCGAGTCCAAGTTCATTTGCT
AACAACAACGATTCACTGTCCAATCACTGATACCCCTGGAGTCGAAGGCT
CTGAAACAGCGCTCTTGGTACATCAAATTGGAAATGGCACCTTCCTCAAC
ATTTACGCGCCGCCCATTGAATCAACGCCCCTTTACATTGTGACTTTGAC
AAATATCACTGGTGAAGATATCATAGATGTGAAATATGATTATGGTAAAA
GACAAGTTGTCGTACTATTGGTTACAAATACAGTACACGCATTCTCGTTA
TCTGGAACACTGCAATGTGCGCCGATAATTTTGAAGGATACACATATTAA
AAACCAATCAAGACTTCTCGTAAAGTGCAACCTTCTGTTGATCGTCACAA
ATGAAATAGTTGTTTGGACATCAACAAATGGTGGATGCAATTGGAAACGA
CCTATACAATGGAACAACATCCTCCATGCAGACTTTGAGTTCCATTCTGC
CGATACATTGAAATTTACATCTAACATAACATCAAGTTACGGAACTCCGC
TAGAAAGCTATCGGGATTATGATATTTTATGGACCAAAATTGGTTTCTTA
CGTCCACAAGCAGCATTGAATAACTCTAATTACATGTTGCTCCTCAATGA
CAAGATTCCGGAAAGCAATAACCCTTATCTTGATTTAGACATTTTTGCCG
TAACAGAAACCGCAGAAGGATTCCAGTTAGAGTTTACGCCAAATGAGACG
AAGTTTCCTGAAATTTGGATTGGTTCCTTGGTAAAGCTTGGTGACTACTC
ATGTCGCGTCACGGCTGTTTTCAACGCTACTGTCGAGATTTATTGCTACA
ATAGTAGTTTAACATTCACAAACATTATCGACTTTATCCAGCAACGACGC
TGGTTTAGTGTCGATTTCTTTTATGCAAGAAAAGTAGAATGTCACCTTAG
TTTTAATGTGAATACCACAACCattgtttttcaaaagaaaccagACACGG
AAATTGATCACGTGTTTTTTTCAACGCCCCCTCTTCATGCTGGGACAAAG
GAAACAAACAGTAGCGTTGCTTGGACTTTCAAAGATCCGCTAACTTCAAT
ACCAAGTTCGTCAAACCAAGTTTGTCTTTACCAGAAATATAAAACCTTCC
AAGAATATATTTATCAGAATCCAACTGATTGTCCAATAACGTTCACAGTA
ACTGGAATCAACGAATCTTACATACATCTAGATATTGATGAACATTTGGA
AATCTCCGTCAATCTGACCATTGATATGATTGTACCGTTACATGAAGATA
TAAGCGATCTTGATTGGCTCAAAACACAAGTTTCAAATCATGAAATTGTA
TGCTTAAGAACACATCGTGAAAAATCGAGGAGAGCTGAGAAAATCCGTCT
TCAATTCCATCAATCTTTGGCAATATCAGGCATCAATGTTGTCACTATCA
AATCAACTATTTATAATTCGAAATGTGGTGGACAAAGTCTAAAATTTCAG
ATTCTCAATGTTTGTCCTCCAGACAAGAAAGTGATCTTCGAATATCCAAA
ATCCGTTCAACCAAACGATTTTGCTGACGATGATCAAAAACAAGACTCAG
AAGGGATTATTCGGGTCTTTCATTTACCAACCAACTATCAACCACCTTCT
TCTAAAGGTATTGGTATACCACAAACGCCGCATGTATATAATGCAGACCC
GGCCAAACCAATGTTTCATAAGAAATATCTGGCAAATCAAATCGATCCAG
TcttcaaaaaatgtaaagatAAACGAAACAGgaCGATGTGTGGGTGTACA
AAAGCTATGGAAATTTCTACGAagattagccaatcagattgcatcAAGAA
AGTATATCGTCTTCTGTATCCAGAAAAGTTCATCCCTCGattacttttgc
aaaaaaaagctaaaaacaaTACTGCTTTCGATAAGCTGATGCGTTTATCT
GAACTCAATGCCAGAACTGATTATACCCTAACCAATTCAGTTCGAGTCTC
AAACGGAGCCGAAGCGGTTAGTATGAAATCAAATACCACCATTGAACTTA
AAGGATCGGGATTATATCATTTTCAAGTGGACGTATTTGATAAAAACGTG
TCGTATTGTAATTTTGAAACGGAATTTCTAGTCTATGTTGACGGGACACC
GCTTCCAAAAGCCGTTGAATCGCTTGTCGAGGCTTTTACCGCTTTtgttt
ttggttttattttgttgGGCTTGTTCTTGTACCAATattacaaaaagtaa
ATGGAGTTTTTTAATTACCAATCTGTTTATATGGTTTTCTTGGTTTCTTT
TTGGCAAGCTCATTTAACATTACAACTTGATTTTGAATGTACTTACAATG
GGACAACACTTGCTGACAACGTCAAAATCTTTCTCGACTTAGAGGAAAAT
GGAACATCAAATCTAGTGTGTATGAAAATGCAAAACCAAGGCTTCGTTGA
AGAGCTTAAAATGAGTGTTTCCAGCAGTGACACTGATTTGGTGACTCTAA
TCTTTAATTCCACATGGACTTCAGAAAAAGTCCTAAACATTTCTGACCAT
GATATATTTAAAACTAATAACCCACCGAGTTTCAACATGAAGATTTTGGT
TTGTGAAATATATTACGTCGATGCTTTACATGAAAATGTTaccataataa
aatttttggctGTTACAGCACATAGATCATTCAGTCAATATCAGAGGACT
TTTGGTTTGGATGATTCAAAGCATGTTGTAGCTGAAAGTCCATGTTCTAG
CATTGTTTCTTACTGGATACCAAAGATGTTATCGGAAACGAAAAACTCAC
TTCACTTGAAGATCAGCAAAGAAACACTTCTAATGATACCCATTCTTATG
AGTGAAAGCCAAAAGATTTCAGAGAATTCAACGGTAACCCGTTTCGTTGT
TATGAATAATCACATCATTCTGGTAGTTGATAACCAGTGGCTATGGAAAG
GAACATTAGAACTATCTGGGGATGTGAGAATTACCAAAGCATCATCAAAT
CGAGTCCAAGTTCATTTGCTAACAACAACGATTCACTGTCCAATCACTGA
TACCCCTGGAGTCGAAGGCTCTGAAACAGCGCTCTTGGTACATCAAATTG
GAAATGGCACCTTCCTCAACATTTACGCGCCGCCCATTGAATCAACGCCC
CTTTACATTGTGACTTTGACAAATATCACTGGTGAAGATATCATAGATGT
GAAATATGATTATGGTAAAAGACAAGTTGTCGTACTATTGGTTACAAATA
CAGTACACGCATTCTCGTTATCTGGAACACTGCAATGTGCGCCGATAATT
TTGAAGGATACACATATTAAAAACCAATCAAGACTTCTCGTAAAGTGCAA
CCTTCTGTTGATCGTCACAAATGAAATAGTTGTTTGGACATCAACAAATG
GTGGATGCAATTGGAAACGACCTATACAATGGAACAACATCCTCCATGCA
GACTTTGAGTTCCATTCTGCCGATACATTGAAATTTACATCTAACATAAC
ATCAAGTTACGGAACTCCGCTAGAAAGCTATCGGGATTATGATATTTTAT
GGACCAAAATTGGTTTCTTACGTCCACAAGCAGCATTGAATAACTCTAAT
TACATGTTGCTCCTCAATGACAAGATTCCGGAAAGCAATAACCCTTATCT
TGATTTAGACATTTTTGCCGTAACAGAAACCGCAGAAGGATTCCAGTTAG
AGTTTACGCCAAATGAGACGAAGTTTCCTGAAATTTGGATTGGTTCCTTG
GTAAAGCTTGGTGACTACTCATGTCGCGTCACGGCTGTTTTCAACGCTAC
TGTCGAGATTTATTGCTACAATAGTAGTTTAACATTCACAAACATTATCG
ACTTTATCCAGCAACGACGCTGGTTTAGTGTCGATTTCTTTTATGCAAGA
AAAGTAGAATGTCACCTTAGTTTTAATGTGAATACCACAACCattgtttt
tcaaaagaaaccagACACGGAAATTGATCACGTGTTTTTTTCAACGCCCC
CTCTTCATGCTGGGACAAAGGAAACAAACAGTAGCGTTGCTTGGACTTTC
AAAGATCCGCTAACTTCAATACCAAGTTCGTCAAACCAAGTTTGTCTTTA
CCAGAAATATAAAACCTTCCAAGAATATATTTATCAGAATCCAACTGATT
GTCCAATAACGTTCACAGTAACTGGAATCAACGAATCTTACATACATCTA
GATATTGATGAACATTTGGAAATCTCCGTCAATCTGACCATTGATATGAT
TGTACCGTTACATGAAGATATAAGCGATCTTGATTGGCTCAAAACACAAG
TTTCAAATCATGAAATTGTATGCTTAAGAACACATCGTGAAAAATCGAGG
AGAGCTGAGAAAATCCGTCTTCAATTCCATCAATCTTTGGCAATATCAGG
CATCAATGTTGTCACTATCAAATCAACTATTTATAATTCGAAATGTGGTG
GACAAAGTCTAAAATTTCAGATTCTCAATGTTTGTCCTCCAGACAAGAAA
GTGATCTTCGAATATCCAAAATCCGTTCAACCAAACGATTTTGCTGACGA
TGATCAAAAACAAGACTCAGAAGGGATTATTCGGGTCTTTCATTTACCAA
CCAACTATCAACCACCTTCTTCTAAAGGTATTGGTATACCACAAACGCCG
CATGTATATAATGCAGACCCGGCCAAACCAATGTTTCATAAGAAATATCT
GGCAAATCAAATCGATCCAGTcttcaaaaaatgtaaagatAAACGAAACA
GgaCGATGTGTGGGTGTACAAAAGCTATGGAAATTTCTACGAagattagc
caatcagattgcatcAAGAAAGTATATCGTCTTCTGTATCCAGAAAAGTT
CATCCCTCGattacttttgcaaaaaaaagctaaaaacaaTACTGCTTTCG
ATAAGCTGATGCGTTTATCTGAACTCAATGCCAGAACTGATTATACCCTA
ACCAATTCAGTTCGAGTCTCAAACGGAGCCGAAGCGGTTAGTATGAAATC
AAATACCACCATTGAACTTAAAGGATCGGGATTATATCATTTTCAAGTGG
ACGTATTTGATAAAAACGTGTCGTATTGTAATTTTGAAACGGAATTTCTA
GTCTATGTTGACGGGACACCGCTTCCAAAAGCCGTTGAATCGCTTGTCGA
GGCTTTTACCGCTTTtgtttttggttttattttgttgGGCTTGTTCTTGT
ACCAATattacaaaaagtaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000741XLOC_000741Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001399-proteinTCONS_00001399-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001399-exon-sc0000010-1491911889:1052094..1052753TCONS_00001399-exon-sc0000010-1491911889:1052094..1052753Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1510915933:1052094..1052753TCONS_00001399-exon-sc0000010-1510915933:1052094..1052753Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1575043694:1052094..1052753TCONS_00001399-exon-sc0000010-1575043694:1052094..1052753Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1491911889:1053985..1054157TCONS_00001399-exon-sc0000010-1491911889:1053985..1054157Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1510915933:1053985..1054157TCONS_00001399-exon-sc0000010-1510915933:1053985..1054157Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1575043694:1053985..1054157TCONS_00001399-exon-sc0000010-1575043694:1053985..1054157Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1491911889:1055338..1055607TCONS_00001399-exon-sc0000010-1491911889:1055338..1055607Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1510915933:1055338..1055607TCONS_00001399-exon-sc0000010-1510915933:1055338..1055607Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1575043694:1055338..1055607TCONS_00001399-exon-sc0000010-1575043694:1055338..1055607Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1491911889:1057503..1057634TCONS_00001399-exon-sc0000010-1491911889:1057503..1057634Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1510915933:1057503..1057634TCONS_00001399-exon-sc0000010-1510915933:1057503..1057634Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1575043694:1057503..1057634TCONS_00001399-exon-sc0000010-1575043694:1057503..1057634Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1491911889:1058415..1059793TCONS_00001399-exon-sc0000010-1491911889:1058415..1059793Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1510915933:1058415..1059793TCONS_00001399-exon-sc0000010-1510915933:1058415..1059793Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1575043694:1058415..1059793TCONS_00001399-exon-sc0000010-1575043694:1058415..1059793Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1491911889:1060668..1061179TCONS_00001399-exon-sc0000010-1491911889:1060668..1061179Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1510915933:1060668..1061179TCONS_00001399-exon-sc0000010-1510915933:1060668..1061179Clytia hemisphaericaexon
TCONS_00001399-exon-sc0000010-1575043694:1060668..1061179TCONS_00001399-exon-sc0000010-1575043694:1060668..1061179Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:1052094..1061179 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0121624 0.0118603 0.0137709 0.040418 0.0164017 0.0129608 0.0156367 0.0439167 0.0204981 0.0507803 0 0.0081001 0 0 0 0.0370571 0.155215 0.196523 0 0 0.141112 0.240903 0.0139452 0.0380346 13.2149 12.9594 0.0333541 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR028748CATSPERB
Vocabulary: Cellular Component
TermDefinition
GO:0036128CatSper complex
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0036128 CatSper complex
Blast
BLAST of TCONS_00001399 vs. Swiss-Prot (Human)
Match: CTSRB (Cation channel sperm-associated protein subunit beta OS=Homo sapiens GN=CATSPERB PE=2 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 3.139e-25
Identity = 72/213 (33.80%), Postives = 112/213 (52.58%), Query Frame = 3
Query: 2424 QDSEGIIRVFHLPTNYQPPSSKGIGIPQTPHVYNADPAKPMFHKKYLANQIDPVFKKCKDKRNRTMCGCTKAMEISTKISQSDCIKKVYRLLYPEKFIPRLL--LQKKAKNNTAFDKLMRLSELNARTDYTLTNSV-----RVSNGAE-----AVSMKSNTTIELKGSGLYHFQVDVFDKNVSYCNFETEFLVYVDGTPLPKAVESLVEAFTA 3026
            +DS+G   +  LP NY+PPS+ GI IP T + Y+ADP+KP+    +  ++    FK+C +   R  C CTK  + S  ++ SDC +KV R  +P    P  L  + +  +       L+ ++E+N R ++ L ++V     R+    E     AV   S   + +KGS L+HF+V V    V++CN   EF +YVD  PLP    +L+   TA
Sbjct:  854 KDSQGFNLIKTLPINYRPPSNMGIAIPLTDNFYHADPSKPIPRNMFHMSKKTGKFKQCANVSTREECNCTKDQKFSHAVAFSDCREKVPRFKFPITQYPVSLEIINEDGRVPLQSPYLVTVTEVNMRHNWKLKHTVPENIKRMKQLVEPILGAAVYNPSGLNLSIKGSELFHFRVTVIS-GVTFCNLIEEFQIYVDEAPLPFPGHTLIAVATA 1065          
The following BLAST results are available for this feature:
BLAST of TCONS_00001399 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CTSRB3.139e-2533.80Cation channel sperm-associated protein subunit be... [more]
back to top