Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001399-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001399-protein
Unique NameTCONS_00001399-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length989

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001399-protein ID=TCONS_00001399-protein|Name=TCONS_00001399-protein|organism=Clytia hemisphaerica|type=polypeptide|length=989bp
MEFFNYQSVYMVFLVSFWQAHLTLQLDFECTYNGTTLADNVKIFLDLEEN
GTSNLVCMKMQNQGFVEELKMSVSSSDTDLVTLIFNSTWTSEKVLNISDH
DIFKTNNPPSFNMKILVCEIYYVDALHENVTIIKFLAVTAHRSFSQYQRT
FGLDDSKHVVAESPCSSIVSYWIPKMLSETKNSLHLKISKETLLMIPILM
SESQKISENSTVTRFVVMNNHIILVVDNQWLWKGTLELSGDVRITKASSN
RVQVHLLTTTIHCPITDTPGVEGSETALLVHQIGNGTFLNIYAPPIESTP
LYIVTLTNITGEDIIDVKYDYGKRQVVVLLVTNTVHAFSLSGTLQCAPII
LKDTHIKNQSRLLVKCNLLLIVTNEIVVWTSTNGGCNWKRPIQWNNILHA
DFEFHSADTLKFTSNITSSYGTPLESYRDYDILWTKIGFLRPQAALNNSN
YMLLLNDKIPESNNPYLDLDIFAVTETAEGFQLEFTPNETKFPEIWIGSL
VKLGDYSCRVTAVFNATVEIYCYNSSLTFTNIIDFIQQRRWFSVDFFYAR
KVECHLSFNVNTTTIVFQKKPDTEIDHVFFSTPPLHAGTKETNSSVAWTF
KDPLTSIPSSSNQVCLYQKYKTFQEYIYQNPTDCPITFTVTGINESYIHL
DIDEHLEISVNLTIDMIVPLHEDISDLDWLKTQVSNHEIVCLRTHREKSR
RAEKIRLQFHQSLAISGINVVTIKSTIYNSKCGGQSLKFQILNVCPPDKK
VIFEYPKSVQPNDFADDDQKQDSEGIIRVFHLPTNYQPPSSKGIGIPQTP
HVYNADPAKPMFHKKYLANQIDPVFKKCKDKRNRTMCGCTKAMEISTKIS
QSDCIKKVYRLLYPEKFIPRLLLQKKAKNNTAFDKLMRLSELNARTDYTL
TNSVRVSNGAEAVSMKSNTTIELKGSGLYHFQVDVFDKNVSYCNFETEFL
VYVDGTPLPKAVESLVEAFTAFVFGFILLGLFLYQYYKK
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000741XLOC_000741Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001399TCONS_00001399Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR028748CATSPERB
Vocabulary: Cellular Component
TermDefinition
GO:0036128CatSper complex
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0036128 CatSper complex
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR028748Cation channel sperm-associated protein subunit betaPFAMPF15149CATSPERBcoord: 648..987
e-value: 9.3E-57
score: 192.6

Blast
BLAST of TCONS_00001399-protein vs. Swiss-Prot (Human)
Match: CTSRB (Cation channel sperm-associated protein subunit beta OS=Homo sapiens GN=CATSPERB PE=2 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 1.213e-28
Identity = 76/227 (33.48%), Postives = 120/227 (52.86%), Query Frame = 0
Query:  771 QDSEGIIRVFHLPTNYQPPSSKGIGIPQTPHVYNADPAKPMFHKKYLANQIDPVFKKCKDKRNRTMCGCTKAMEISTKISQSDCIKKVYRLLYPEKFIPRLL--LQKKAKNNTAFDKLMRLSELNARTDYTLTNSV-----RVSNGAE-----AVSMKSNTTIELKGSGLYHFQVDVFDKNVSYCNFETEFLVYVDGTPLPKAVESLVEAFTAFVFGFILLGLFLYQ 985
            +DS+G   +  LP NY+PPS+ GI IP T + Y+ADP+KP+    +  ++    FK+C +   R  C CTK  + S  ++ SDC +KV R  +P    P  L  + +  +       L+ ++E+N R ++ L ++V     R+    E     AV   S   + +KGS L+HF+V V    V++CN   EF +YVD  PLP    +L+   TA V G ++   F++Q
Sbjct:  854 KDSQGFNLIKTLPINYRPPSNMGIAIPLTDNFYHADPSKPIPRNMFHMSKKTGKFKQCANVSTREECNCTKDQKFSHAVAFSDCREKVPRFKFPITQYPVSLEIINEDGRVPLQSPYLVTVTEVNMRHNWKLKHTVPENIKRMKQLVEPILGAAVYNPSGLNLSIKGSELFHFRVTVIS-GVTFCNLIEEFQIYVDEAPLPFPGHTLIAVATAVVLGGLIFIAFMFQ 1079          
The following BLAST results are available for this feature:
BLAST of TCONS_00001399-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CTSRB1.213e-2833.48Cation channel sperm-associated protein subunit be... [more]
back to top