Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001396 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001396
Unique NameTCONS_00001396
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1724

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001396 ID=TCONS_00001396|Name=TCONS_00001396|organism=Clytia hemisphaerica|type=transcript|length=1724bp
TTTCTTCCAAAATGATGATTTTATGCTTTCTGCTTCTCGTGATAAATCAG
TTAGACTATGGaacatacatcaaaagaagaatCTAGTGGCTTACAAAGGA
CATGCGTACACTGTATGGGATGTTTCTGTCAATACGGATGGAACGTACTT
TGTGTCTGCGTCATTGGATAAAACATTGAGATTGTGGAATACTGAATATG
CATGTCCGTTGAGGATACTGGCAGGTCATGGTGACAGTGTCGATTGTGTA
GCTTTTCATCCGAATGGCAATTACATAGCATCAGGTTCATCAGACAAAAC
ATGTCGTTTATGGGATCTCCAAAGTGGACAGTTTGTGCGTGTCTTTGTTG
GTCATAAGGGACCAATTTATTCATTAGCATTCAGCCCAGATGGAAAATAT
TTAACTTCAGCAGGTGACGACTCTGAAATCAAAATATGGGACCTTGCCAA
CGGACAACTGTTAAACGAGTTCAAAGCACATTCAAAAACAATATACAATT
TAAGCTTCAGTAACGATGGTTCTATGTTCGCTTCTGGAGGTTTAGACAAG
ACTGTCAAAGTATGggaaagtgaaaatatttttcgtaaaaaaaCAACTTC
ATTGTTCAAAATGGCAGACGAATGTATTGGTAGTTACCCTGTTGATAATA
TCAGTAGCATAttggacttgaaattttcggacgGTAACCTGTTATATACG
AGTGTTCTATCCAACAGTGTCAGattttttaagaaGTATTCAACACTAAC
GTGGAAATCTTCATTACATAATTGGTGTACTAATTATTGCTCTTAATTAT
GGAACTGCCGGTACATTCATACTTTACGTCATCACAGAGGGCCCGACAGT
CCATGACGCTTTCCAGAAATGCAGGCAAAATAGTGGGATGTTGACTTATA
AGACTTTACCTGATGAGGAAAGAACACTATACGCTGGTTTAATGCAAAAc
AATGGATTGTCTCAAGCTGTTGGTTTCAGCGCAAACAAAATATGCTACAT
TTACAAAATTGGTCAAGAGGGTTATACAATGGAGAGATGCTCAGAAGAAA
TTTCCAAGCATTATCTATGTAGATACTTTTTTACAATACCACCCGTCCCT
GCttcatccttattttttggTCCCAATAACGAATACGAGCAAATAACTCA
ACAAAGTGATGGGGGAGTGTACCCTGATACATTTCTATCCGCAAAGAAAT
CTTGTGAAGCGAAAGGCAAAGAAGTTTTATCGATTGAAAATCTGGCAAAG
TTCGAAAGTTTCTTCGATCTTTTTGCTGAAGCAGGCGCattCCTTCCTAC
TTTGTGGTTAGGAATGACATACGATCCATTTGACAAGAAGTTTCGATACT
GTAACAAAGAAATCCAATCAACTTTTCGACCATGGTGTTCCAacacaaat
gattttgatgacgaAGGAAGACTATGTGTAGTTCTTGACTTCATAAGCGG
TTGCTTTCGACAAGTTTATTGTGGCTTGAGCACACCCAGTATTATTTGTC
AGCATCAATTTTCGCCTTTATCAACTTATGTTCGAGTTGCACAGAATTTG
ATCAATGAAATTAAGAGCGATTGTAAATCATgcaagaaaaattgatgaaa
ttgaCCCTGGTTATTCTTATAAGtgctatgcttataaatatcgtttaaaa
aagtgctataaGTATTTCTCCGTAATGGCTGGTCTctactttcgcgcgaa
atgagcgacagtttttttcttaac
Run BLAST on NCBI

protein sequence of TCONS_00001396-protein

>TCONS_00001396-protein ID=TCONS_00001396-protein|Name=TCONS_00001396-protein|organism=Clytia hemisphaerica|type=polypeptide|length=264bp
FFQNDDFMLSASRDKSVRLWNIHQKKNLVAYKGHAYTVWDVSVNTDGTYF
VSASLDKTLRLWNTEYACPLRILAGHGDSVDCVAFHPNGNYIASGSSDKT
CRLWDLQSGQFVRVFVGHKGPIYSLAFSPDGKYLTSAGDDSEIKIWDLAN
GQLLNEFKAHSKTIYNLSFSNDGSMFASGGLDKTVKVWESENIFRKKTTS
LFKMADECIGSYPVDNISSILDLKFSDGNLLYTSVLSNSVRFFKKYSTLT
WKSSLHNWCTNYCS
Run BLAST on NCBI

transcript from alignment at sc0000010:1031572..1040591+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001396 ID=TCONS_00001396|Name=TCONS_00001396|organism=Clytia hemisphaerica|type=transcript|length=9020bp|location=Sequence derived from alignment at sc0000010:1031572..1040591+ (Clytia hemisphaerica)
TTTCTTCCAAAATGATGATTTTATGCTTTCTGCTTCTCGTGATAAATCAG GTAATATCAAATAAGGTGAAAGTTGTTTGTTTACAGTGACAATGTGCTCT ACCAGGAGGAGTCTTAACAAGATTGAATgttgtttttgaatttcataACT CGGGTTATATGGTGTTTGAATGTGATGAAGTTTTGCAATATTTTGTGTGG ATGCTTCCATAAAAGAAGACATCCATACTTTAAGCAGAGGGGTGTAGCAA AAATTAGATACAGACAGACGTTCATTTCTTTAGATATGTTAactgggcca ttccattttatattaATACGTAATGGGGGTAATCCAAGAAGAATTTCTTG GGGGTCCGAAGGAGTATTTTTCAATCTttcaagggggtaaaaagttattc aaaaatcTCCAGAGGGTAAAAGACTGGTTTTCGTTCATCCACTCACTTGT AGGTATAAAAAGGGTTTCTCCGAGGGTTTCTTTGCCAATGTTACCATTTT CAAGGGGGTATTTACACATTTCCAAGAATCTTATTTTGGTTCGCCCACTA TACAGTAtggatttttaatggaacagcccatgaCATATAAGACTTTTCGG TtccatattttattttaattacttcttCTTTACAGATAATCTTACTTTCC AATGTGCAATGAATTCAAGGAttgaaaatgttatcaaaatgTAAATTCTA TTATGCATATTTTTTCATACAGTTAGACTATGGaacatacatcaaaagaa gaatCTAGTGGCTTACAAAGGACATGCGTACACTGTATGGGATGTTTCTG TCAATACGGATGGAACGTACTTTGTGTCTGCGTCATTGGATAAAACATTG AGATTGTGGAATACTGAATATGCATGTCCGTTGAGGATACTGGCAGGTCA TGGTGACAGTGTCGATGTAAGTCTAAAAGCAAGtacttttttgctttaga atATTCCCCTTCTTCAAATCGTCGCATGAAAGTAAGAAAGccgtaaaaat ttgaattaaagaaCTGTAGTTCAATTTTGTGACTTTCTGCTTTTNTTCCC CTTCTTCAAATCGTCGCATGAAAGTAAGAAAGccgtaaaaatttgaatta aagaaCTGTAGTTCAATTTTGTGACTTTCTGCTTTTTGGACTTACCCGAA TTAACGGCCAGCTATCCAgccagccagccagccagccaagcactttttct tgattttctgttCGTAAATGAatgtgtttaaaaaaattaaatattccgAT ATTAATTGTTTTTCTTGTTCTAGTGTGTAGCTTTTCATCCGAATGGCAAT TACATAGCATCAGGTTCATCAGACAAAACATGTCGTTTATGGGATCTCCA AAGTGGACAGTTTGTGCGTGTCTTTGTTGGTCATAAGGTAAATGTTCATC TTTGTGTTTGTGTTTGTGTTTGAATAACCAGAAgcttcatgtttttgatg ttgttaaaaagaaatattcgaCGCTCACTACAAGAGGTCATCTTCAGAgt aaaaaatctaataaaaaacgaaatcttttaaaaacaaattttcaaaaata gtaaaaatagtgctaaaaatacaattaaaaACAATGCGGTAAATGATAGA GAAGATACCTTAGggactaaaataattgaaacGTGCAAAGAAAGTATTGA ATGTGTTTTTATTGTTAATCATCGTTGTTGCTTTCGACAAACtatagttt ttctgatttttgatgGGTGATCATTTCTATCTGAATGGTTCGAGTCTGAC TTCATAAAGCTTGATAGGCCGCCCCGACTTTAATACTTTTGGCCAGTAAT AGTAGAATACGTTTTTTATCAAGAAAAAGATGGATGGGCTTTTCTAGAGA ATTTCAGTAATTTCcgtaccccctgttgaggatatccgTTTAAAGGAAAT CACCCCTGGATGTCCAAGAAGATAGAGTAGATAGAAGGGGAGAGGATATC catcccctggatatccaggcattTTGTCTTGCCCATCACGGATATCTGTG ACGGGCAAGACAAAATGCctagatatccagggggtacatGACACCCCCTG TATATTCAGATATCATTGAACCCCACTGTTCGATATTACTGTATTATATA TTATTCTGGGAAAGCCAAATACGGTTCTTCTTCACTTTTAATCTACTGAA TCGTATTTTCGTCCTATTTTGCAGGGACCAATTTATTCATTAGCATTCAG CCCAGATGGAAAATATTTAACTTCAGCAGGTGACGACTCTGAAATCAAAA TATGGGACCTTGCCAACGGACAACTGTTAAACGAGTTCAAAGCACATTCA AAAACAATATACAATTTAAGCTTCAGTAACGATGGTTCTATGTTCGCTTC TGGAGGTTTAGACAAGACTGTCAAAGTATGggaaagtgaaaatatttttc gtaaaaaaaCAACTTCATTGTTCAAAATGGCAGACGAATGTATTGGTAGT TACCCTGTTGATAATATCAGTAGCATAttggacttgaaattttcggacgG TAACCTGTTATATACGAGTGTTCTATCCAACAGTGTCAGGTAACATCCGG TTTATttctaagaacaattttatttatGTATACAGTATATATGTATGTAA GGATTTTTAACAAATTGAATATCTGTTGGTATTACAAACTAGATGGACTA ATTCTTGTTATGTATCCAATACATATCATTAGTTTTATTACCGTATTTTG CTATAATTGATTTAAAACTTAATGAAATGTTTTCGTTCTCATTGTTTttc atttcgttttttttttctcgtttttcggtttgtgtatttgttttcaaatt attttcgaattctGCTATAAGTTTCGAATGTATATTTGAATGCATCTGTA GTTgcaaaaaatatatcaaatccAAGGTATTAAAATAGAGACCAGTTCTT TTGTTTCTAATGTCCAGATTAATATTACGATTGATAAACTGAAATAGACT TTATTATTGtgtatttgtaaagatttttttttgttaaatccAAGCTAAAC TCTTGGtcaattttttataatatttaaaaaaagattatttgtATATTTTG ACATGCACATATTATTAGAGGAAACACattcaaatattattttattccca atattattattattattatttcgaCTCAAATCTATTTACTTGTTTACTTt tctaatatttcaaaaagtcttGAACTTTGGAAACGTGCAAATTTCTGTTC TTCGCTGCTTTTTCTTATTGTATTTTTAAGATTCTTAAAATatcaacaaa tcaaaaattcatcaGAAAATACTTCCTATTTTTGGTTTGAGGAAACACAA ATAACTGAAAGAATTGCCGAACGATATGTATCTTTgttgtttcgtttttt ttcataCATATTCAATACAAATGTattatgattatttttataatcagAAG TGCATGCACGTTTTTTTacgagaacaaactatataagaacataaggcttc gagggccaaattgttaaaaacattttaaggctttgtagaccctagaacac ccaatttcttagaaaaatggacaaaaaactcaaaaactgctgaaaataag aacatattaagaacattattTAGGTTTGTAACCCGAAAagtaagaacatc tgaaggcttcaaaaatttggatgttcttataaaaagaataacGTGTACAG TAGCCCGTTCTTTTATTGTATGTTTCACGCTCAACCCTCAATATCCTTTA AATTAATcctttgatgttgttttttttctctttagattttttaagaaGTA TTCAACACTAACGTGGAAATCTTCATTACATAATTGGTGTACTAATTATT GCTCTTAATTATGGAACTGGTAAGCttttattgtttgtttgttttcgaTT CCCCGTCGTTTTAACGTttaatttctgcattttaaaaagatttaatgtgt aatatatttttttaatcataatttcttttcctctagataaatttttgtga aattttcaggagagatacataaaactgtggtggatttgtgtgttaaaagt ttttcatttgagttgattttgttttgagagtttgttgttgcgtgcttgat aaattgttttctcgctacgcaagtttctgcgtagctagccggggtatcta taaggctggaacactagattcttccagtcgttcatacaaactaaatcccg taacaattatcgtattatcatataacgccgaTACTATTGTATTACACGAA TTAttaacgactccagtctataccAAGCGGTGATGTTTATCCCACTTGTC TCTAGTGAAGCCGCTAGTCTATTTTTATATGATATTTCCTCTTGCTTGCG AAAAATAGATGAAGAAGAATGATGCACAATGATTCCCCGAAAATCCATAC CGGATGCAGAGTGGTACGTAAACAATGATTCCCCTTCGTAATTGTGTACA ATTGTAATGATTATTACGTAAATCAATGAATGCAAGATTAAAAGGTGGTA TTTATAACGATGCTTTTTGCCAAATCCTAATTAGCATTTAAGATACTGTA CTCAACATAAAGTTGAAGCAAATAACGATGAAGGATTTCGTTGGTATACT TTTCTTCTTGAGTTTTACTACAGGAATCAATTCACAGGCTGTACCATGTT CAGCAAATTTGGCCGCTTTTGTTGCAGATCAAGAGATACGAGATGAAGAT CATTTCTGCGTACAAAATCTGTGTAGGCTTCAAATTCAACCTAAATTTAA CATGTCGTAAAAActgctctcatccataaattttgcagggtatctcgcta cgcctttGCATGTGATGCATAATGAAGCATAAAAtagtatttttgtgaaa gttttgagCCTTTCCCATGGGATAAATTATAATCAACggttaaaaatgct ctaaaaactACATTTTTGGGTTCTAATGCCGATTCCATGCAGGTGATATT TTTAGCAAATTTAATcatagatattcttataaagtatattcttataaaaa accgtgtaGAAATGAATTGCCAAGTATCCTTACATCTATTCAAATTCGAC ATATGGgaagtattttattttctctttcaGCCGGTACATTCATACTTTAC GTCATCACAGAGGGCCCGACAGTCCATGACGCTTTCCAGAAATGCAGGCA AAATAGTGGGATGTTGACTTATAAGACTTTACCTGATGAGGAAAGAACAC TATACGCTGGTTTAATGCAAAAGTAAGGAAACTTCTTATCTGTTATTTTG ATGGCAGAtaggcggccgcccacgctaaagctatAAAGatgccaatttcc catcggagaggaatgataggcggcctttgatgtgccgcatccccagtcgg gttcaactacccttgcacgtaaacctaaaaaatatttcggttgaaCCCGC CAATCcacgaaaacgagggctgggttaccagacctcccgctgcaataTCT TTGACGTGGTCTTGCAAatttccgtaatctaaaccttccagatgttgaaa gttttcCCGACTTTCCGAGCTTTAGCTTGTCGGatgccccgggggggggg ggtacttaggcaaatggagggtaagggtaccttttttggacttccaaagt cccgctaagggttggaaaaatcagaaaatcaaatttcagcccactaaggg tcggaaaaataggattatttcaactttttaccccctgaaagatcgaaatt tggtcaaaattggtcaaaattgtcCCGCTAACGctcgagtgacttagggc aagtctcaaaaacctaacagtttaccctaagttttcgctaccaatagcag ccagattcagagagccacttagggctctaaagtacctctataccttaagg tttcaggacccggtgttacgtaattaaatattaacccaaaaattaattat taaagaaattgtaatggtgacgtcataatttgatcgaatttggtgacgtc atgaatcgtataattgctataatattaaaaatatatgtccaatctttccc aaattttaaccaaagatgtatctaactgaaatgtaattttttgaaaaaaa aattttggaaaaatttgatgatgtcagcaaaaaattgcgtttttcgattt tttgcattttttgctgacgtcatcaaaatcttttgaaaatttttcattga aaagtttgGCACCAttaagatgcatctttggtccaaatttgacaacgatt tgacatgtacttatatagttagagctaatttacgatttatgacgtcataa tttgatgacgtcataattcacaatttctttaataattaatttttaggtta atatttaattacgtaacaaacGGTTCATGGCACCTTAAggtataggtcat ctaaaaatcTATAAGTGAATAcctgagaatgggtgctattggtcgcggat tcggGATTTGTGATATTTAAAAATCTAGACATACCCTAACTCACCCGAGC GGTCGTAAAactcccaaaattttcctttgcagATAAGGAAAGTTCTCTCC AATAAACGAGTAATGTTTTGTCTTGTGTTGGTCCATTTCGTGAGGCATTA AGTCCCTTTTTGGGCGTCTTTGATATGATTCGGCTGAGGATCGAATCTAC AatcttgcgcaccgtagctggatgctctaccgtTATAGTATAGCCGCTTG AACGGTATTAGGCTATTAAATTTATAATTGTCAtcataaaagaaatattt tttcttttttttccagcAATGGATTGTCTCAAGCTGTTGGTTTCAGCGCA AACAAAATATGCTACATTTACAAAATTGGTCAAGAGGGTTATACAATGGA GAGATGCTCAGAAGAAATTTCCAAGCATTATCTATGTAGATACTTTTTTA CAATACCACCCGTCCCTGCttcatccttattttttggTCCCAATAACGAA TACGAGCAAATAACTCAACAAAGTGATGGGGGAGTGTACCCTGATACATT TCTATCCGCAAAGAAATCTTGTGAAGCGAAAGGCAAAGAAGTTTTATCGA TTGAAAATCTGGCAAAGTTCGAAAGTTTCTTCGATCTTTTTGCTGAAGCA GGCGCattgtaagacattttttatttagattttgtTATGGTATCACTATC GATAGTACCTCTCAATACAAtattatgtcaaaaatatttgTATCATCGCC TTATCATTACCTAGCCTTTTAGCCTTAAATATTATTCTAAAATGGCCAAT TCCTTCACCAGTTAATAAAATCAACCACCTTACTGGAAGTTATTTCTCAC CTCTCGAATATTGTTAGAATTTTGAGGTATAAGGAGGCACTTCGTAGAAA AAGTTTTAGTAGAAGCTGAGCGCTTTTTGATGTCTGCATTATAGTACCAG GATTTCTCCCAATTCACCGTGTCTGACCGCagtcagtagacaagaattca cttGCAGCTCTACCCAGTCGCAATTGAGTCATCGGGTTCcacatggaccc gtagctcaatggtagagcaaatgccTACGATTGACATGGTTGCGAGTTCG AGTCTCGCTGGATCTGTtagttttccaacggttctggtggctggtcagaa aacaatatgagagcgactgtattcacttcattgtatTACAGTACCAGCAA TTCTTGACCTTTCTTTGTTTAGCCTTCCTACTTTGTGGCTAGGAATGACA TACGATCCATTTGACAAGAAGTTTCGATACTGTAACAAAGAAATCCAATC AACTTTTCGACCATGGTGTTCCAacacaaatgattttgatgacgaAGGAA GACTATGTGTAGTTCTTGACTTCATAAGCGGTTGCTTTCGACAAGTTTAT TGTGGCTTGAGCACACCCAGCATTATTTGTCAGCATCAATTTTCGCCTTT ATCAACTTATGTTCGAATTGCACAGAATTTAATCAATGAAATTAAGAGCG ATTGTAAATCATgcaagaaaaattgatgaaattgaCCCTGGTTATTCTTA TAAGtgctatgcttataaatatcgTTTAAAAAAAGTGCTATAAGTATTTC TCCGTAATGGCCGGTCTctactttcgcgcgaaatgagcgacagttttttt cttaaccttttttgcccgaagaaaagattacgtcataaaaaagNTTTTGT TATGGTATCACTATCGATAGTATCTCTCAATACAAtattatgtcaaaaat atttgTATCATCGCCTTATCATTACCTAGCCTTTTAGCCTTAAATATTAT TCTAAAATGGCCAATTCCTTCACCAGTTAATAAAATCAACCACCTTACTG GAAGTTATTTCTCACCTCTCGAATATTGTTAGAATTTTGAGGTATAAGGA GGCACTTCGTAGAAAAAGTTTTAGTAGAAGCCGAGCGCTTTTTGATGTCT GCATTACAGTACCAGGATTTCTCCCAATTCACCGTGTCTGACCGCagtca gtagacaagaattcacttGCAGCTCTACTCAGTGGCAATTGAGTCATCGG GTTCcacatggacccgtagctcaatggtagagcaaatgcccgcGATTGAC ATGGTTGCGAGTTCGAGTCTCGCTGGATctgttggttttccaacggttct ggtggctggtcagaaaacaatatgagagcgactgtattcacttcattgta tTACAGTACCAGCAATTCTTGACCTTTCTTTGTTTAGCCTTCCTACTTTG TGGTTAGGAATGACATACGATCCATTTGACAAGAAGTTTCGATACTGTAA CAAAGAAATCCAATCAACTTTTCGACCATGGTGTTCCAacacaaatgatt ttgatgacgaAGGAAGACTATGTGTAGTTCTTGACTTCATAAGCGGTTGC TTTCGACAAGTTTATTGTGGCTTGAGCACACCCAGTATTATTTGTCAGCA TCAATTTTCGCCTTTATCAACTTATGTTCGAGTTGCACAGAATTTGATCA ATGAAATTAAGAGCGATTGTAAATCATgcaagaaaaattgatgaaattga CCCTGGTTATTCTTATAAGtgctatgcttataaatatcgtttaaaaaagt gctataaGTATTTCTCCGTAATGGCTGGTCTctactttcgcgcgaaatga gcgacagtttttttcttaac

Coding sequence (CDS) from alignment at sc0000010:1031572..1040591+

>TCONS_00001396 ID=TCONS_00001396|Name=TCONS_00001396|organism=Clytia hemisphaerica|type=CDS|length=3975bp|location=Sequence derived from alignment at sc0000010:1031572..1040591+ (Clytia hemisphaerica)
TTCTTCCAAAATGATGATTTTATGCTTTCTGCTTCTCGTGATAAATCAGT
TAGACTATGGaacatacatcaaaagaagaatCTAGTGGCTTACAAAGGAC
ATGCGTACACTGTATGGGATGTTTCTGTCAATACGGATGGAACGTACTTT
GTGTCTGCGTCATTGGATAAAACATTGAGATTGTGGAATACTGAATATGC
ATGTCCGTTGAGGATACTGGCAGGTCATGGTGACAGTGTCGATTGTGTAG
CTTTTCATCCGAATGGCAATTACATAGCATCAGGTTCATCAGACAAAACA
TGTCGTTTATGGGATCTCCAAAGTGGACAGTTTGTGCGTGTCTTTGTTGG
TCATAAGGGACCAATTTATTCATTAGCATTCAGCCCAGATGGAAAATATT
TAACTTCAGCAGGTGACGACTCTGAAATCAAAATATGGGACCTTGCCAAC
GGACAACTGTTAAACGAGTTCAAAGCACATTCAAAAACAATATACAATTT
AAGCTTCAGTAACGATGGTTCTATGTTCGCTTCTGGAGGTTTAGACAAGA
CTGTCAAAGTATGggaaagtgaaaatatttttcgtaaaaaaaCAACTTCA
TTGTTCAAAATGGCAGACGAATGTATTGGTAGTTACCCTGTTGATAATAT
CAGTAGCATAttggacttgaaattttcggacgGTAACCTGTTATATACGA
GTGTTCTATCCAACAGTGTCAGattttttaagaaGTATTCAACACTAACG
TGGAAATCTTCATTACATAATTGGTGTACTAATTATTGCTCTTAATTCTT
CCAAAATGATGATTTTATGCTTTCTGCTTCTCGTGATAAATCAGTTAGAC
TATGGaacatacatcaaaagaagaatCTAGTGGCTTACAAAGGACATGCG
TACACTGTATGGGATGTTTCTGTCAATACGGATGGAACGTACTTTGTGTC
TGCGTCATTGGATAAAACATTGAGATTGTGGAATACTGAATATGCATGTC
CGTTGAGGATACTGGCAGGTCATGGTGACAGTGTCGATTGTGTAGCTTTT
CATCCGAATGGCAATTACATAGCATCAGGTTCATCAGACAAAACATGTCG
TTTATGGGATCTCCAAAGTGGACAGTTTGTGCGTGTCTTTGTTGGTCATA
AGGGACCAATTTATTCATTAGCATTCAGCCCAGATGGAAAATATTTAACT
TCAGCAGGTGACGACTCTGAAATCAAAATATGGGACCTTGCCAACGGACA
ACTGTTAAACGAGTTCAAAGCACATTCAAAAACAATATACAATTTAAGCT
TCAGTAACGATGGTTCTATGTTCGCTTCTGGAGGTTTAGACAAGACTGTC
AAAGTATGggaaagtgaaaatatttttcgtaaaaaaaCAACTTCATTGTT
CAAAATGGCAGACGAATGTATTGGTAGTTACCCTGTTGATAATATCAGTA
GCATAttggacttgaaattttcggacgGTAACCTGTTATATACGAGTGTT
CTATCCAACAGTGTCAGattttttaagaaGTATTCAACACTAACGTGGAA
ATCTTCATTACATAATTGGTGTACTAATTATTGCTCTTAATTCTTCCAAA
ATGATGATTTTATGCTTTCTGCTTCTCGTGATAAATCAGTTAGACTATGG
aacatacatcaaaagaagaatCTAGTGGCTTACAAAGGACATGCGTACAC
TGTATGGGATGTTTCTGTCAATACGGATGGAACGTACTTTGTGTCTGCGT
CATTGGATAAAACATTGAGATTGTGGAATACTGAATATGCATGTCCGTTG
AGGATACTGGCAGGTCATGGTGACAGTGTCGATTGTGTAGCTTTTCATCC
GAATGGCAATTACATAGCATCAGGTTCATCAGACAAAACATGTCGTTTAT
GGGATCTCCAAAGTGGACAGTTTGTGCGTGTCTTTGTTGGTCATAAGGGA
CCAATTTATTCATTAGCATTCAGCCCAGATGGAAAATATTTAACTTCAGC
AGGTGACGACTCTGAAATCAAAATATGGGACCTTGCCAACGGACAACTGT
TAAACGAGTTCAAAGCACATTCAAAAACAATATACAATTTAAGCTTCAGT
AACGATGGTTCTATGTTCGCTTCTGGAGGTTTAGACAAGACTGTCAAAGT
ATGggaaagtgaaaatatttttcgtaaaaaaaCAACTTCATTGTTCAAAA
TGGCAGACGAATGTATTGGTAGTTACCCTGTTGATAATATCAGTAGCATA
ttggacttgaaattttcggacgGTAACCTGTTATATACGAGTGTTCTATC
CAACAGTGTCAGattttttaagaaGTATTCAACACTAACGTGGAAATCTT
CATTACATAATTGGTGTACTAATTATTGCTCTTAATTCTTCCAAAATGAT
GATTTTATGCTTTCTGCTTCTCGTGATAAATCAGTTAGACTATGGaacat
acatcaaaagaagaatCTAGTGGCTTACAAAGGACATGCGTACACTGTAT
GGGATGTTTCTGTCAATACGGATGGAACGTACTTTGTGTCTGCGTCATTG
GATAAAACATTGAGATTGTGGAATACTGAATATGCATGTCCGTTGAGGAT
ACTGGCAGGTCATGGTGACAGTGTCGATTGTGTAGCTTTTCATCCGAATG
GCAATTACATAGCATCAGGTTCATCAGACAAAACATGTCGTTTATGGGAT
CTCCAAAGTGGACAGTTTGTGCGTGTCTTTGTTGGTCATAAGGGACCAAT
TTATTCATTAGCATTCAGCCCAGATGGAAAATATTTAACTTCAGCAGGTG
ACGACTCTGAAATCAAAATATGGGACCTTGCCAACGGACAACTGTTAAAC
GAGTTCAAAGCACATTCAAAAACAATATACAATTTAAGCTTCAGTAACGA
TGGTTCTATGTTCGCTTCTGGAGGTTTAGACAAGACTGTCAAAGTATGgg
aaagtgaaaatatttttcgtaaaaaaaCAACTTCATTGTTCAAAATGGCA
GACGAATGTATTGGTAGTTACCCTGTTGATAATATCAGTAGCATAttgga
cttgaaattttcggacgGTAACCTGTTATATACGAGTGTTCTATCCAACA
GTGTCAGattttttaagaaGTATTCAACACTAACGTGGAAATCTTCATTA
CATAATTGGTGTACTAATTATTGCTCTTAATTCTTCCAAAATGATGATTT
TATGCTTTCTGCTTCTCGTGATAAATCAGTTAGACTATGGaacatacatc
aaaagaagaatCTAGTGGCTTACAAAGGACATGCGTACACTGTATGGGAT
GTTTCTGTCAATACGGATGGAACGTACTTTGTGTCTGCGTCATTGGATAA
AACATTGAGATTGTGGAATACTGAATATGCATGTCCGTTGAGGATACTGG
CAGGTCATGGTGACAGTGTCGATTGTGTAGCTTTTCATCCGAATGGCAAT
TACATAGCATCAGGTTCATCAGACAAAACATGTCGTTTATGGGATCTCCA
AAGTGGACAGTTTGTGCGTGTCTTTGTTGGTCATAAGGGACCAATTTATT
CATTAGCATTCAGCCCAGATGGAAAATATTTAACTTCAGCAGGTGACGAC
TCTGAAATCAAAATATGGGACCTTGCCAACGGACAACTGTTAAACGAGTT
CAAAGCACATTCAAAAACAATATACAATTTAAGCTTCAGTAACGATGGTT
CTATGTTCGCTTCTGGAGGTTTAGACAAGACTGTCAAAGTATGggaaagt
gaaaatatttttcgtaaaaaaaCAACTTCATTGTTCAAAATGGCAGACGA
ATGTATTGGTAGTTACCCTGTTGATAATATCAGTAGCATAttggacttga
aattttcggacgGTAACCTGTTATATACGAGTGTTCTATCCAACAGTGTC
AGattttttaagaaGTATTCAACACTAACGTGGAAATCTTCATTACATAA
TTGGTGTACTAATTATTGCTCTTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000739XLOC_000739Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001396-exon-sc0000010-1491911889:1031572..1031621TCONS_00001396-exon-sc0000010-1491911889:1031572..1031621Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1510915933:1031572..1031621TCONS_00001396-exon-sc0000010-1510915933:1031572..1031621Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1575043694:1031572..1031621TCONS_00001396-exon-sc0000010-1575043694:1031572..1031621Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1491911889:1032294..1032487TCONS_00001396-exon-sc0000010-1491911889:1032294..1032487Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1510915933:1032294..1032487TCONS_00001396-exon-sc0000010-1510915933:1032294..1032487Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1575043694:1032294..1032487TCONS_00001396-exon-sc0000010-1575043694:1032294..1032487Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1491911889:1032845..1032958TCONS_00001396-exon-sc0000010-1491911889:1032845..1032958Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1510915933:1032845..1032958TCONS_00001396-exon-sc0000010-1510915933:1032845..1032958Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1575043694:1032845..1032958TCONS_00001396-exon-sc0000010-1575043694:1032845..1032958Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1491911889:1033746..1034110TCONS_00001396-exon-sc0000010-1491911889:1033746..1034110Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1510915933:1033746..1034110TCONS_00001396-exon-sc0000010-1510915933:1033746..1034110Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1575043694:1033746..1034110TCONS_00001396-exon-sc0000010-1575043694:1033746..1034110Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1491911889:1035307..1035390TCONS_00001396-exon-sc0000010-1491911889:1035307..1035390Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1510915933:1035307..1035390TCONS_00001396-exon-sc0000010-1510915933:1035307..1035390Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1575043694:1035307..1035390TCONS_00001396-exon-sc0000010-1575043694:1035307..1035390Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1491911889:1036602..1036743TCONS_00001396-exon-sc0000010-1491911889:1036602..1036743Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1510915933:1036602..1036743TCONS_00001396-exon-sc0000010-1510915933:1036602..1036743Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1575043694:1036602..1036743TCONS_00001396-exon-sc0000010-1575043694:1036602..1036743Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1491911889:1038238..1038579TCONS_00001396-exon-sc0000010-1491911889:1038238..1038579Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1510915933:1038238..1038579TCONS_00001396-exon-sc0000010-1510915933:1038238..1038579Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1575043694:1038238..1038579TCONS_00001396-exon-sc0000010-1575043694:1038238..1038579Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1491911889:1040159..1040591TCONS_00001396-exon-sc0000010-1491911889:1040159..1040591Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1510915933:1040159..1040591TCONS_00001396-exon-sc0000010-1510915933:1040159..1040591Clytia hemisphaericaexon
TCONS_00001396-exon-sc0000010-1575043694:1040159..1040591TCONS_00001396-exon-sc0000010-1575043694:1040159..1040591Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001396-proteinTCONS_00001396-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:1031572..1040591 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.41926 0.52582 0.415549 0.295306 0.41281 0.55101 0.100145 0.450684 0.296217 0.397836 0 0 0.628216 0.489989 1.58283e-09 0.210243 0 0.311986 0.195345 0.196341 6.40633e-08 0.353068 1.22209 0.445388 0 0 0.385291 0.151533 1.01998 0.75777
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00001396 vs. Swiss-Prot (Human)
Match: TAF5L (TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 6.434e-64
Identity = 106/231 (45.89%), Postives = 146/231 (63.20%), Query Frame = 2
Query:    2 FFQNDDFMLSASRDKSVRLWNIHQKKNLVAYKGHAYTVWDVSVNTDGTYFVSASLDKTLRLWNTEYACPLRILAGHGDSVDCVAFHPNGNYIASGSSDKTCRLWDLQSGQFVRVFVGHKGPIYSLAFSPDGKYLTSAGDDSEIKIWDLANGQLLNEFKAHSKTIYNLSFSNDGSMFASGGLDKTVKVWESENIFRKKTTSLFKMADECIGSYPVDNISSILDLKFSDGNLL 694
            F  +   +LS S D S+R W++    N V Y+GHAY VWD+ ++    YF S S D+T RLW+ +   PLRI AGH   VDCV FHPN NY+A+GS+DKT RLW  Q G  VR+F GH+GP+ SLAFSP+GKYL SAG+D  +K+WDLA+G L  E + H+  I +L+FS D  + AS  +D +V+VW+  N +          + E +G Y    +S++L ++F   NLL
Sbjct:  350 FLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNTYCSAPAD--GSSSELVGVY-TGQMSNVLSVQFMACNLL 577          
The following BLAST results are available for this feature:
BLAST of TCONS_00001396 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TAF5L6.434e-6445.89TAF5-like RNA polymerase II p300/CBP-associated fa... [more]
back to top