Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001396-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001396-protein
Unique NameTCONS_00001396-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length264

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001396-protein ID=TCONS_00001396-protein|Name=TCONS_00001396-protein|organism=Clytia hemisphaerica|type=polypeptide|length=264bp
FFQNDDFMLSASRDKSVRLWNIHQKKNLVAYKGHAYTVWDVSVNTDGTYF
VSASLDKTLRLWNTEYACPLRILAGHGDSVDCVAFHPNGNYIASGSSDKT
CRLWDLQSGQFVRVFVGHKGPIYSLAFSPDGKYLTSAGDDSEIKIWDLAN
GQLLNEFKAHSKTIYNLSFSNDGSMFASGGLDKTVKVWESENIFRKKTTS
LFKMADECIGSYPVDNISSILDLKFSDGNLLYTSVLSNSVRFFKKYSTLT
WKSSLHNWCTNYCS
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000739XLOC_000739Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001396TCONS_00001396Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 134..148
score: 36.29
coord: 92..106
score: 45.26
coord: 8..22
score: 35.53
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 24..63
e-value: 8.9E-8
score: 41.8
coord: 150..189
e-value: 7.1E-10
score: 48.8
coord: 108..147
e-value: 5.8E-12
score: 55.8
coord: 205..244
e-value: 13.0
score: 10.0
coord: 66..105
e-value: 7.4E-12
score: 55.4
IPR001680WD40 repeatPFAMPF00400WD40coord: 69..105
e-value: 1.4E-11
score: 44.6
coord: 109..147
e-value: 1.1E-10
score: 41.8
coord: 151..188
e-value: 6.9E-8
score: 32.9
coord: 27..63
e-value: 1.4E-6
score: 28.8
coord: 1..21
e-value: 0.052
score: 14.3
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 115..156
score: 18.362
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 73..114
score: 18.596
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 157..189
score: 15.02
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 31..65
score: 13.483
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 1..30
score: 11.11
NoneNo IPR availableGENE3D2.80.10.50coord: 148..257
e-value: 4.5E-18
score: 64.8
NoneNo IPR availableGENE3D2.80.10.50coord: 82..108
e-value: 1.5E-19
score: 70.0
NoneNo IPR availableGENE3D2.40.50.140coord: 109..147
e-value: 1.5E-23
score: 81.7
NoneNo IPR availableCDDcd00200WD40coord: 1..243
e-value: 5.5171E-63
score: 200.639
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 1..81
e-value: 3.2E-25
score: 88.5
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 92..106
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 8..22
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 134..148
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 1..198
score: 58.477
IPR017986WD40-repeat-containing domainSUPERFAMILY50978WD40 repeat-likecoord: 2..244

Blast
BLAST of TCONS_00001396-protein vs. Swiss-Prot (Human)
Match: TAF5L (TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.312e-68
Identity = 106/234 (45.30%), Postives = 147/234 (62.82%), Query Frame = 0
Query:    1 FFQNDDFMLSASRDKSVRLWNIHQKKNLVAYKGHAYTVWDVSVNTDGTYFVSASLDKTLRLWNTEYACPLRILAGHGDSVDCVAFHPNGNYIASGSSDKTCRLWDLQSGQFVRVFVGHKGPIYSLAFSPDGKYLTSAGDDSEIKIWDLANGQLLNEFKAHSKTIYNLSFSNDGSMFASGGLDKTVKVWESENIFRKKTTSLFKMADECIGSYPVDNISSILDLKFSDGNLLYTS 234
            F  +   +LS S D S+R W++    N V Y+GHAY VWD+ ++    YF S S D+T RLW+ +   PLRI AGH   VDCV FHPN NY+A+GS+DKT RLW  Q G  VR+F GH+GP+ SLAFSP+GKYL SAG+D  +K+WDLA+G L  E + H+  I +L+FS D  + AS  +D +V+VW+  N +          + E +G Y    +S++L ++F   NLL  +
Sbjct:  350 FLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNTYCSAPAD--GSSSELVGVY-TGQMSNVLSVQFMACNLLLVT 580          
The following BLAST results are available for this feature:
BLAST of TCONS_00001396-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TAF5L1.312e-6845.30TAF5-like RNA polymerase II p300/CBP-associated fa... [more]
back to top