Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001334 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001334
Unique NameTCONS_00001334
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3667

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001334 ID=TCONS_00001334|Name=TCONS_00001334|organism=Clytia hemisphaerica|type=transcript|length=3667bp
ataagtggcttcatttcccatccaagataTTCGGATCTaggggctttgaa
atcaatgctTCTACATACAAAAATTACCACCTTATCTCCTTTTTGTGTTA
AAGGGGGGCCTCATCGGACCCTCAATTCGCGCAATCTgcacacaaaaaaa
attcataaattcacGCATTCGTGCAATTTTTGTTTACGCAAAGATTTCCA
CTTgatgcattcacgcaatttttttttcacgcattcacgcaaaccgctga
gGGCCCGTTAAAGATTATGCCATTTTATCATTACTATAAGAATAAAAGTA
TTAACtgtcattgttcttataaaacccACGGCTATCTTTTTATCGAGATT
GGTAATTGAAGGCTCTCCAGCGAGTGGAAACCAATCTGTTTTATAATTGT
GATATCAAAACGATTAACATGCTGTTTGTAGATAAGTGAATCAATGCTTC
tcttttttaatggattgatGAGCGTGACAGAAAATATAATTTCCTTGAAA
ATGTTCAAGTGGCTGACGGTGTAGTTGaatttttgcttttaaatattttt
ggctGGCTTCAAGTGATATACATGTAGACGTTCATAAAAAGGCTGAGGGA
AAGTTTTTGTATGAAATAAATATGGTATAGAAATTTCCATGATACAGTAA
AAGCTTAAATTTGTGTAAAAATTAAAGTTAGATTTGCTACCCTAAGCTGC
AAAACAAAACATGCCTACTGCAGGAGGAGCCAATAATAGCGGTGTTCGTG
GCTTCTTTACAAATTTCGCCAATTACACTGGTGAAAAAGTATCCGAAGTG
AAAGAACTTTTATTTGGAGTCAACATTGATGATAGTGTTGAACTAGCATC
TCTAACAAGTCGACAAAGTAATTCATTTCGTAGCCGAAATGGTGGTAATC
ATGATATATTAAAACGAAAAACATTAATTCCTGATGAACTACAACACGAG
GATATTTACGAACAGTATGCAGAATACGATTGTTCTCGTAATCTTGTCGT
AAGTTCGACGACGCTTTTTCGTAAAGGCCCGATTCCGATCGAACATTTAT
CACATCAAGAACAGAATCGTCTTTCAAAACGTGGTTGCTTGTTAGAGTGG
AACGATGCACAACGTCAGACGTCTGACAATCATCTACCTTACATTGACCC
TAGTAGTAAGAGTTTGCTGACTTACTTTGCAAGGATGGGTTCTGGTGAAG
ATGATACAGATGTGGTCAACCTTGCGTTCGTTGAATCTCTATTAAACGCT
GGTGCTAGTATGAACTACCCTGATGTTTATGGTCAAAGTATTTTCTTTGC
TGTAGTACGTGACTGGCACATTGACGTCGCAAGGTTTGCCATTGAAAAAG
GAGCCGATGTGAACCATCGGGACCAGTACGGGAGAACACCGTTACATCTT
GCAGCTGCAGTCAATTATGAAGAAATGGTGGCATTTATTATTGCTAATGG
AGCGGATATCACAGCCAAAACAGAGGGTGAAGAGCAGACACCTCTTCATT
ATGCAGCACGATACGATTCAGTAGAAGCAATGAAAGTTTTGATACAAGCT
GGTGCTATGATCGATGGTGTAGATTTCTTAAATCGAACACCCTTACACGT
GGCAGCTGAAACAGGTAGTCACGAAGTTGTcaaatttttaatgaaacttG
GTGCACCAACAGGTGTTTATGATTCGTTCGGTAATTCTGTCATGTTCATG
ATGATTGAAAAAATGCCACATCTGGCGTATGAAGGGTTGAACCAATTCTT
TGTTGAAGACAATGCTATGAGACGACGGTATTATTATCTGGACCATCTTG
AGTTTGATGTTAAATCAAATGTGTCATCGAAGAATGCTAGAAATGTTTTA
GAGGCCATAGTGATGTACAAAGAAGTAGACCTCATGATGCACCCGTCAAT
CAAAAAGCTGTTGTCAATCAAATGGAAATTGTACGGTAAACGACGTGCAA
TCATTAGTAACCTTGGAAACGTTTTTCACACTTTGTTAGCAACTATCCTT
ATCTTTGCAATACCGTACCGGCCATATGATCAACAGTTTACACCGGTCAA
AGATAATATCATATTTATCACCCTGGCTATGCTGTTCGTCGTACTTACCT
TTTTCTTTTGGATAAAACAAATCCTAACAATACGACTGCTGAACGCGAAA
GACCAAGCTTATAAAGAACACCGCTTTAATTACATCAAAAAACAATTACC
TCATTGTCATCCACGGTGGACAGAAGAAAAAGAgtttcttgaaaaagaaa
ttgaaagaatCAAAAGTTACAAATCAACATTCTGGCAAGATTACTGGAAT
ATATTTGAATGGGTTTCTCTACTTTTCGTTGTTATTATGTTCGCTCTACA
TATTACTAATATTGTATCACCGAATATGAAAGTTTACAGAGCAGCCAATT
TTGTTTCCGCCATCACGCTTCTTTTGGTTTGGTTCCGCTTGTACAAGACG
TTGAGGATTGCTCGATTCTTCTCTGAAATCAATGTATTGCTAACTAATGT
TGCTTTGGAGACATGCAGATTCGTGATTCTTTACATGGATTTATACATTC
CCTACATTTTCGTGTTTTTCATGTTATTTGGTGGCTCAACTAAATTgttt
ggaaatacaaagaaaaatatcGATGAAAATCATTTCGAATTGGAACAGTT
TAGTGATGTGttatATTATGGCTGGTTGGTAATGCTTGGTAAACATTTCC
CAGAGGAAGGAGGTACAGCTGTCAATCATGTTGCACTCGAACTTTTTCTT
GGTTCCTACATTGTCATATCAACGCTTCTTGGCTTCATTTATATTGGACG
TTTGTCCGAATTGTTTTCACGTGTTTACAAGAAAGTCAACGCCAAATCAN
GCTTCATTTATATTGGACGCTTGTCCGAATTGTTTTCACGTGTTTATAAG
AAAGTCAACGCCAAATCAAATTTGTTAGTGGCTGGTGTTTTGGTGacaga
agaaaaatatttatctcaaaatcaattACGCGCCAATAAGAAACACATGA
GAAGGCTTTGTGGACCAATGGTTGTTCCGTTTGAGAGTAACAAAGGTGTA
GAAGATGATGATCAAAACATTGGAATAGGAATCGAACATGTTACATCCAA
AATTGAAGATGTCACTAACTATCTAAgaaaagcAAATTTCCCACGTGAAG
AAAGGCAATCGATCAATGTAGACCAATTGACTGTTCTTGAAACTGAactt
gaaagaatatttcaaagtaTGTCTGAAAGCGAAAGACTGTTGacggaaaa
caaagaaaatgttaagacTGCGCAAACGAAAACCATTGATCTGATCAAAG
AGACGATTGAAACACGAAAGACCAATGCGAACAGAAAGTAATACAAGAAG
GATAACTTTTACTTATCCTGCGATAcagtaaaaatttataaatatcttat
tttaaagttttaaattacTAATTTTTCTGTACCTTTTTGTTTTATGgact
tttttgttgattttcttcgtttaaaaatttttccctAATTTTAAGCTTTA
GGGACCTATGGCTATGGGCTTATCCCTTAAAAATATCGCATAcataagat
aaaaaaattttttatggagGGACTATGGTTTTACATAGACTTCATACTAA
Cctcatagtttctaccccccctacatttaggggggtcttaggttttgatg
aaccaaaagcaaggggg
Run BLAST on NCBI

protein sequence of TCONS_00001334-protein

>TCONS_00001334-protein ID=TCONS_00001334-protein|Name=TCONS_00001334-protein|organism=Clytia hemisphaerica|type=polypeptide|length=876bp
MPTAGGANNSGVRGFFTNFANYTGEKVSEVKELLFGVNIDDSVELASLTS
RQSNSFRSRNGGNHDILKRKTLIPDELQHEDIYEQYAEYDCSRNLVVSST
TLFRKGPIPIEHLSHQEQNRLSKRGCLLEWNDAQRQTSDNHLPYIDPSSK
SLLTYFARMGSGEDDTDVVNLAFVESLLNAGASMNYPDVYGQSIFFAVVR
DWHIDVARFAIEKGADVNHRDQYGRTPLHLAAAVNYEEMVAFIIANGADI
TAKTEGEEQTPLHYAARYDSVEAMKVLIQAGAMIDGVDFLNRTPLHVAAE
TGSHEVVKFLMKLGAPTGVYDSFGNSVMFMMIEKMPHLAYEGLNQFFVED
NAMRRRYYYLDHLEFDVKSNVSSKNARNVLEAIVMYKEVDLMMHPSIKKL
LSIKWKLYGKRRAIISNLGNVFHTLLATILIFAIPYRPYDQQFTPVKDNI
IFITLAMLFVVLTFFFWIKQILTIRLLNAKDQAYKEHRFNYIKKQLPHCH
PRWTEEKEFLEKEIERIKSYKSTFWQDYWNIFEWVSLLFVVIMFALHITN
IVSPNMKVYRAANFVSAITLLLVWFRLYKTLRIARFFSEINVLLTNVALE
TCRFVILYMDLYIPYIFVFFMLFGGSTKLFGNTKKNIDENHFELEQFSDV
LYYGWLVMLGKHFPEEGGTAVNHVALELFLGSYIVISTLLGFIYIGRLSE
LFSRVYKKVNAKSXFIYIGRLSELFSRVYKKVNAKSNLLVAGVLVTEEKY
LSQNQLRANKKHMRRLCGPMVVPFESNKGVEDDDQNIGIGIEHVTSKIED
VTNYLRKANFPREERQSINVDQLTVLETELERIFQSMSESERLLTENKEN
VKTAQTKTIDLIKETIETRKTNANRK
Run BLAST on NCBI

transcript from alignment at sc0000010:172492..198180+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001334 ID=TCONS_00001334|Name=TCONS_00001334|organism=Clytia hemisphaerica|type=transcript|length=25689bp|location=Sequence derived from alignment at sc0000010:172492..198180+ (Clytia hemisphaerica)
ataagtggcttcatttcccatccaagataTTCGGATCTaggggctttgaa atcaatgctTCTACATACAAAAATTACCACCTTATCTCCTTTTTGTGTTA AAGGGGGGCCTCATCGGACCCTCAATTCGCGCAATCTgcacacaaaaaaa attcataaattcacGCATTCGTGCAATTTTTGTTTACGCAAAGATTTCCA CTTgatgcattcacgcaatttttttttcacgcattcacgcaaaccgctga gGGCCCGTTAAAGATTATGCCATTTTATCATTACTATAAGAATAAAAGTA TTAACtgtcattgttcttataaaacccACGGCTATCTTTTTATCGAGATT GGTAATTGAAGGCTCTCCAGCGAGTGGAAACCAATCTGTTTTATAATTGT GATATCAAAACGATTAACATGCTGTTTGTAGATAAGTGAATCAATGCTTC tcttttttaatggattgatGAGCGTGACAGAAAATATAATTTCCTTGAAA ATGTTCAAGTGGCTGACGGTGTAGTTGaatttttgcttttaaatattttt ggctGGCTTCAAGTGATATACATGTAGACGTTCATAAAAAGGCTGAGGGA AAGTTTTTGTATGAAATAAATATGGTATAGAAATTTCCATGATACAGTAA AAGCTTAAATTTGTGTAAAAATTAAAGTTAGATTTGCTACCCTAAGCTGC AAAACAAAACATGCCTACTGCAGGAGGAGCCAATAATAGCGGTGTTCGTG GCTTCTTTACAAATTTCGCCAATTACACTGGTGAAAAAGTATCCGAAGTG AAAGAACTTTTATTTGGAGTCAACATTGATGATAGTGTTGAACTAGCATC TCTAACAAGTCGACAAAGTAATTCATTTCGTAGCCGAAATGGTGGTAATC ATGATATATTAAAACGAAAAACATTAATTCCTGATGAACTACAACACGAG GATATTTACGAACAGTATGCAGAATACGATTGTTCTCGTAATCTTGTCGT AAGTTCGACGACGCTTTTTCGTAAAGGCCCGATTCCGATCGAACATTTAT CACATCAAGAACAGAATCGTCTTTCAAAACGTGGTTGCTTGTTAGAGTGG AACGATGCACAACGTCAGACGTCTGACAATCATCTACCTTACATTGACCC TAGTAGTAAGAGTTTGCTGACTTACTTTGCAAGGTAataaattacacgtt tttttatcataagaacataaggcttcgatggccaaaattctaagaacaag ttaagaacattttaaggctttgcggactggaaaacacccgattttttagg aaaatgggtaaaaatggtcacaaaatggagaaaataagaacatgttaaga acatttttagacttaaaacccaaaaagttaagaacatctgaagccTTCAA AAATTTAGCATGTTCTGCCTTTAGGGgaggaaaatatagaaaaatatgga aaatacAGAAAAATATATCATATATTGTACGAGCAGTGATAATTGGTTTA tggtcaacttgaaaaataattaaCAAATTTTTCCCTCTAGTTGTGTCCAT AGACGTAGCGAGATGCCCTGCAAAacttatggatgagagcggtttttatg acactgtaattactgtctttgttttagttttatcaaaagataatgaatat gtcataaacgtctgcactccctcataaattttccAGGGTATCTCGCTTTG CCTATGTttctatgttttgtttttttctctctactttattttgatgaaat caacATACAAAATAGGATCActcgcttaccagaccccttATGCTGTACGA ggtcttgtatttgtacggttcaatatgaaatacagcatttttgtacgcat ttttagccaatcagattgctcatatttttcacgTTGATGATAAAAGACAT TATCTGAAGGGACTAGTTTGAGgttagaggttcgagttatggggcTCCAC CGTAAAAGACTTTTGGATAAAGACAATGTCATAGGAAGAAAATATGGATC AGGTCCGGTTAGCGTGGTACACGGGTACAAACTATACTTGTGAAAGCTAC AACTATACTTTGTACCCGAAactattttactgaccagatcGAATTCTcta gtatactttgtacccattACAAGtatactttacacccgcgatcaagtata ctttgtaccctgaTCAAGTATACTTTATACCCGCGATCAACTATACTTTG TACCCTGATCAAGTATACTTTACACCCgtgatcaaatatactttacaccc gcgatCAAGTATACTTTTCACCCGCGagcaagtatactttgtaccctgat caagtatactttacacccgtgatcaaatatactttacacccgcgatcaag tatactttgcaCCCGCGagcaagtatactttgtacccatcaCTAATATAC TTTGTATCCGGCactagtatactttgtacccatgaTCAActatacagtaa aacctctaattaacggacactctaaaaggcggaaacctctgattagcgga caatttcattttccccggccgtttcctagtcaaatcctcataaaaaagtt tctaaaaggcggacactcaattagcggaccctctgattagcggacaaatt ttttcgcacaaaatggccaaaacccctattttatttagctctcaaattag cggacattgaatatcaaacgggtcacagacgtccaaaattgaaaaaacaa ttttatagatatttttatttcaagcacttattagtcttattattcaaatt atttctacaaatttccagttttctttTGACCCATTCAACTaatttaggtg ggccaaagaaatcataaatcactggtacTTCAAGTCCGTACCCATCACCT TCATTTAACCTCTTGCCAGTCACTCGAgctcttctatggcctagtgtctg cagataagtcTTTAGACtgcaattttgtattttcgacaccatgggatggc ctaatttcaaaattggagctccgagatcaaaagtttctaaaaggcggaca cttctaattagcggacacttaactcctttccccgatggtgtccgctaatt agaggttccactgtactTTGTACCCATCACTAATATACTTTGTACCCGGC ACTaatatactttgtacccatgatcaactatactttgtacccatcaCTTA AATTGATAGAGCGAAATGATGTTACAAGGTATGTGGGTTGAACCGCATAT GCTATTAGCCAGACTTAAGGACGAAACATTGTTTAAGATTTCATTTCATG TCTCTGGTCTTTAATTATGAATTTNTTAGCCAGACTTAAGGACGAAACAT TGTTTAAGATTTCATTTCATGTCTCTAGTCTttaattatgaatttttaaa ctttcattaaaatgtttatgaaaaaataaaattcgaagAGATAAGTTTTT AACCAATTTTGCTTGTAATTTTTGGTGTACTATTAGGCGACCGCTATGCT TTTGAATATCCTATCGACCCTTTTTGCGCACGCTCTTGTCTTTTGGTGCA TTAAGGATTGGCTTAAAAAAGGTAAAACTTAACGTCATTTTTTTGGTTCC TGAACACACGTCCATTAAGTATACCCTACAAGTCCACTTGGTGCCCCCTA CAAGTTCACATGGTACTCCCTACAAGTCTGCTTGACACCCAAACACAAAT AACTCGGTACCTGAACACCTTGGTACCTGAAGACAAGTCCACTTGTACAT GGGTATAACTCGGACAATACAAGCGACTGTCCCCCCGCTTCgtgcaaaaa tcaattttacgcACCGAAATACGGTGTTTCTAATCCGCGGATACAGCCAT AATCACCCATAATCATCCATAATCACCCATAGTCACCCATAACCACCCAT AATCACCCATAACCACCCATAACCACCCATAACCACCCATAATCAGCAAT CAGCTACctcattggctgtttttttCATATATAAAGGAATGCACTCGCTT GTAAAATCATTCTATAATACACGTTGCCCGGGGTGTTGTGTGGGATTTTA CGTTTGAGTGTTTCCCTTAGATATGACTAAGATAGAACTAGAAATAGAAT TACATGAAAACGAGGCCCGGCTGTATGGAGGGCTGTAGAAGCCTCAATTT GTCCCACTGGGGAACTTTGCCTGACTCGCTGACTGCTTCGTCGGGCCTTg ggcaaggtataaatagccagaaaaagcactccaggcatgtTCCCCGTCCA GGGTTCGGGTCAAAGTCCcaatttttaatgatattttatgattttttggg tgtagattccaaagaaagtggtccgaagtcctgaaaagttcatGGGAAGG CTCTAAAGGAGGGTTAGAACTCGTACCAGACCAGTTTGGAGTCCCCGGTG GGATGGAAAGCAGTGAGACCTTTCTACAACTCGTGAAGCACTTGGTGCTG ACGTACACCTTCGGCCAAGTCTAAAATATACTCTGAGGGTCCCTATTGAG CTCTGGGCCAAGCCAAGGTAGCGAAGGTACGATATCCATGAGAAACTTCT CCATAGAACGGCCAGAAGTTGGCCCAGTGGTATAAGGCGTTGGGTTCACG CACTAGGGATCCCAGGATCGAATTGGGTCAAGGTCACCTTTAAAAccttt ttccaggttttaacatttcatgttttttttgggtgtagattccgaaaaaa taggctcgaagtcctgaaaagttggcGGAAGGGCGCTACGGGACCGTAAA GGACCTGTACGGGACCGTAAATGACCCCCTCCCCTAGCAGGGTGGCCAGC GATACtggaaatacttgaaaatacttgaatatactggaaaaaaatattgg tacttgattatactagagtttttgaaaaaatgcccatttttccagtatat acttgaaaatgataaattggaatacttgaatatacttgaatttctttttt caatcaaatcttcTATTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNTCTAACGAAGCACCATACGTAAAGTTCAAAATATACTTGAATGTA CTTGAATTTTGCACCTTCATATACTTGAAAATAGCAAAGATAtacttgaa aataatcaaaaatgctccaaaaagtacttgaatatacttgattttcaatg actaaaatcgctggccaccctgcctagcgccggactgggtacGTCTCACG ACTTGAAACCTTCTAGAGACGTGAAACATATCAAAGGcggaaagcatgcc aaatttcatcactccaccgtcaccggtcaCTGAGCTATAGGCCGCGCAAA GTACGCTGCAGGACGTCCCAGtacggacgattgccgggccgtatgGTGTT TTTAGCTGGTCAAATTTTCCGTGAGGTATAATTAATCTAGTTCTATCTTA GTTATATCTAAGGAAATAATCTATATCTAAGGGAAacactcaaacataaa atcccaaacaacaccccaggaaaggtgtattagaatGATTTTACAAGGGA GTGCATTCCTTTATATACGAAAAAACAGTCAATGAGGTAGCCGATTGCTG ATTATGGGTGGTTATGGGTGGTtatgggtggttgtgggtgatTATGGGTG GTTATGGGTGATTATGGATGATTATGGGTGATTATGGCTGTATCCGCGGA TTAGAAACACCGACCAAAATACGTTTCTAAATTAACAAAcaccaaaaaat aaagaaaattataaagcaaaacaatgaaTTACTTGGCATGTTTTCTGTGT TCTGTGAAAAAGatgttcaaaaaattcaaaaagaatcctttagatataaa aaaatacaaagattTACAACGTTGTCTCAACTCTATCATCATTGGGGATA GTCAATATTTATGCGATTGATGATGTGGTCAAATGGAGTATCCAATCCAT ACCGATCTCTTAAAACTACAAGAATATGtttaaaattagtttgaacAATT TTCTTGACAACTACTGAAGCGCCAACTCTCTTTACCCCAAGGGTAGAATC TAACAAGATTGctgttaaaatttttgaaattattcgaAACATTTTGACTT TATTTGATGAAAGCTTAACAAAACTGCTTCATAATTTAATGACTTTATGG TGAAACATGGCATAAAACCCAGCAAAAACCCGTTCAAGTTTTGCATAGAG AAGGTCCAtggcgtcctccagctttttggtcccccctaatatgagctaaa atcccccatctggcctttcccctcacctgtctttaaaattcgtgctcccc caattgggaaatccccctagccgtattgtataagggttgcgaagtgataa tccagactcgcctcaattcgcaagctactatatcaaaaaaagactctcaa aatccctagaaagacaggctcataagcctgaatgcccaaacacaccagga aggtctNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNggggggggggggggggggtgatcCCATAGAAGGATGTAACAAAAAC GCATAAAATCTCGATTGCTAACCGCTAACAACTGTTtaattgccccgcag gggcttttgttgcttcacgtagcgcacttgctcgccagaaaaatattcat gtccagattcatgttgtttctttcgatttttttcaagatattttttctaa ctttcgtgcattttacacagagcatttgtgaaagcgagaaatcgaaagtc ccgTCTGCACTGCCAGTCCACACAGCTAAGCTAAGCTTTCACAAACAAAA ACAGCAcacaagatttttgcttggttaatatctttttaacatagttgctc aactggatttacttgagggacattgtttgctactaaatgaataactatca aactactgatattgaatcaaaccttatacgattgtcagaatggacgacat cttcaatgacagtGCGCTAcaccagggatatgttatagcgtagctggata atgcacatttgaaaaagccttgttctatctctgtccctgacattgaaatt ttatatgaaattaaacttttttaattacaaattcgtgaaatttggatttc tttttagccaatatgattctgctgctgcatttattgttcacgattaaaaa cttttaattatcaagagggtctgtaaaacattggtgaatgacaatttaaa aaaatgaaaaacattgttttcattagtaaagttataagaaattccttctg taagattataaatagctcttattcatttgaaataccgcgctacaccgcgg gatgcctcactttctaactgatattttcagatagcaagtcggtatgtctg attataaaaaaaatttcaagtcgattgaaacaatatttgtcaaaatattt acatccgaaatttttaaagagaaatcacgaaagcttctcaaattcataac acacgctgataaaaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNaaagaagcttttggggtatcttttgcaaatattattttgatgaaaa gcgggaacatcatagcaaaatatatgcaaacgtactgcatgaatactttg tctgcttcacttttcttaaaaaaacagaacacttaaggggacagagatgg atttctattatgaacagtttacaatagaaaagacaaaggagcaatccgct aaggaattctcgtcctccatccagctacgctataacatatccctggctAC ACACACAGTTCAGTGTTTTATGCGCTGCTCTACCGAAACCCTACTGATAT TAAAAAGGcatagacaaaagggaaattgaccATTAATTCATATTATTTAC CTATATAGTGACTTCATCttgaaggaaattaaattgaaattttggtagAA AGACAAAACCCAGAGTACCCTATATGGTTATTGCATGCGccaaaagtaat ttttcaaagagtaagccttgcgccaaaacgtgctaaaaactggtaccaac attgagtttcttaCAAAGTTCTTCTTTCTTAAAGGCCGAGGTAAACGTCG GCCTTAAAGGTTTAGTGAGTGACATATGCCAATGAGAATCGGTGAAGAGC TCGAAATAtgtcggtttatcggtgaagGGGAAATATTACGGTGTCGGTGA TTGAGCTGTTTTTGTTCGGTTTTTCGGTGAAAGAATCAAAAGCGAGCGGT TTTTCGGTGATTATCAAGTACGTCGGTTTCTGAGAATTGATcaccttatc agggaaaacttcgtcggggaaaattttcgtcggggaaaaattcgtcactt gctggtagttggtaaacgcattaaggccggggaaaattttcgtcacttgt ccaaaatttcgtcacttctccccgacgaagttttcccagATAAGGTAttc ttttgcaaaaataatcaaaaatcaaggagtaaaattttcttcgctCGCTT CGATTGCAGAAAACAACAGGACTGACCTAGTCAAAATAACACATGTTCAG CAATAACCCATTAGTGAAAGCTCTGAtggaaaaactgtttatttaaatac agtagcgtggtggcagggggacAACTGCCCCTTCCCAGTGGAGgcttttt gaaggggcgccaaaagaagGAATTTCTCTTTCGTATTTGCTCTTTAGAAT GTTGTCTTAAACTAGCGCCGCTTTCCttttttactaaatttttggtcaaa tttaagctcttttttggaaaaattgttcgctcgcttcgctcgcgtcaAAC AGAGTCAACTTTTTGCATTGaatatttagaaaaagtatACCAGAACCAAT AACAGTTCCTCAAGGAACGTATGTGGAATTTTCATAAGATTGGTCATATA TTATATGcctgattttaaagtttttataattttataaagTTATTAAAATA ACTTAACGTGGTTGAATTTTGTTCCTTTTCTAGTCGATAATTTTGTGCTC ACTTCGCTCGCATTTCAATATCATATACTCTATTTAATTGGCTTTACACA ATCCATCTCAATAAACAATGTCGCaaatttttcttgctcgcttcgctcgc atttccTAAATGGTTCTAAAATGAACACAAATTCAAGTTAAACAAATTTC GCTATACTGATGCGACCAAAAGGGGTCAGAATTAGCCTACAAGGGAGAGC CTTAAtctaaaattctacttttttcTCCCCATCCTTGACCTACCCACCGC TCTACTGGCTCTACTGTGTATATATGATCAGCAGAAAATAAAATAGCCCA GCTCAGTAATACTTTTAGGGCCTCAAAAGATGCTTTTTCCAGAAACACAA TTTATAAGATTTATAAGAGATTATAATTCTTGAGTTTAAAATCGTGGACT TGTACAAGTTTCTCGCTCACTTCACTCGCATGGAGCGTtgagaaaataca aaagttttctCCATCGAGGCCAACCAAATGCAGAAACCCGTATTGAATAG TATTGCCTCACTAAGCCAGCTTATTTTCGGAAAAGTAGTGTCTAAAATAG GGAGTTTTGAGCCTAAACGAAAGCtagaaaactgaaaaattttcgtcggc acaaaccatggttgcgcctcccgCTACCTCCTCAACAACAATTTGAATTC CTGCCAGCATGCATTGGGGATTATAGGTTATTTTTGCTACAAAAATTTCG GGGATATATGCAGTCTACTTTATTTTACAGACCTTGAAGCAAAAGTAAAA AGTCGGTGTCGGTGAAGAGGATGAATTttgtcggtttatcggtgaTAGAG CTATTCTTTCGCGGTTTATCGGTTTTTGGAAGTCCCGTACGCCCCCACAA TAAACAGCTATGAAATCTCTCAAAAAGTGCACTCATTATGACTGAAACCT TTTTTGCCGTAAGGCTAGACTACGGCAAATCTTAGAAATTTTACAATATA TAGAAAAGActaaataaaaaacgtgcacaCATAAAATAAATCActttttt ttcgttattttggTTCTTTTGTTTGACTTGAAATGCCAAAAGGGAATTCC TTGACtcaaaatgacatttcaaatgGGAGCTAATGCCAGCACGATGGCAT CATGGGTGCAATGTATACTTGATCGCAGGTGTAAAGTATACTTGATAGGG GTACAAAATATACTAGtgatgggtacaaagtatatttgatcgcgggtaca aagtatacttgatcggGGTACAGCGTATACTACTGccgggtacaaagtat acttgatcagggtacaaagtatattagtgatgggtacaaagtatacttga tcagggtacaaagtatactagtgatgggtacaaagtatactagtgatggg tacaaagtatagttgatcatgggtacaaagtatagttgatcatgggtaca aagtatagttgatcatgggtacaaagtatacttgattggggtacaaagta tatttgatcagggtacaaagtatacttgatcggggtgcaaagtatacttg atcgcgggtgtaaagtatatttgatcgcgggtgtaaagtatatttgatcg cgggtgtaaagtatatttgatcagggtacaaagtatacttgctcgcgggt gtaaagtatacttgatcagggtacaaagtatacttgctCGCGGCtgcaaa gtatacttgatcgcggatgtaaagtatatttgatcagggtacaaagtata cttgctCGCGGGtgcaaagtatacttgatcgcgggtgtaaagtatatttg atcagggtacaaagtatacttgctCGCGGGtgcaaagtatacttgatcgc ggatgtaaagtatatttgatcagggtacaaagtatacttgctCGCGGGtg caaagtatacttgatcgcgggtgtaaagtatatttgatcagggtacaaag tatacttgctcgcgggtacaaagtatacttgatcggggtgcaaagtatac ttgatcgcgggtgtaaagtatatttgatcacgggtgtaaagtatatttga tcacgggtgtaaagtatacttgatcacgggtgtaaagtatacttgatcag ggtataaagtatatttgatcgagggtgtaaagtatatttgatcgCGGGTG CAAAGTATAGTTGATCGCAGGTATAAAGTATACTTGatcgcgggtgtaaa gtataCTTGCTCgcgggtacaaagtatacttgatcggggtgcaaagtata cttgatcgcgggtgtaaagtatatttgatcacgggtacaaagtatacttg atcggggtgcaaagtatacttgatcgcgggtgtaaagtatatttgatcac gggtgtaaagtatacttgatcagggtataaagtatatttgatcgcgggtg taaagtatatttgatcacgggtgtaaagtatacttgatcagggtataaag tatatttgatcgcgggtgtaaagtatatttgatcacgggtgtaaagtata cttgatcagggtataaagtatatttgatcgcgggtgtaaagtatatttga tcgAGGGTGTAAAGTATACTCTATCAGGGTACAAAGTATAATTGatcgcg ggtgtaaagtataCTTGTAATAggtacaaagtatactagtGAATTCgatc tggtcagtaaaatagtttcgggtacaaagtatacttgatcgcgggtgtaa agtataCTTGTAATAggtacaaagtatactagtGAATTCgatctggtcag taaaatagtTTCGGGTACAAAGTATAGTTGTAGCTTTCACATGTATAGTT TGTACCCGTGTACCACGCTAACCGGACCTGATCCGAAAATATTTAGTCta cactttttctaattttccggAGCCTGTTTTGATGCtagagtaatttgtta ttcaacaTGGCGTTGTATTTAATAAAGAATTCTAGCAAAAACACGTCAgt caaaaatattgacacaaGCCTTGCGCATTTCTTGCatccctgtctcgcag cccctgtggaacttttttctcagtggggataaaaattcctattgaaatcc cttTGGGACAGAAATTCCTATGTTCcaatgttaaaaaattaattggCAAT GGTTTtgaaaggggggggggcgtacggtatttcggaattgcagAAATTGA CCCTTTTTTCCAcggaatttcggtattataaaatttttaccccccccccc tttttccttttttttttttgaaaatttttaaaaaaatttattttttccct aatAAATTcggaaaaggggggggggggtacggtatttcggaattgccgAA ATTGACCCTTTTTTCCAcggaatttcggtattataaaatttttccccccc ccccctttttcggaattcatacgtgaaaaataaaatttgatgaaaaatta gtcaaaatgaggaaaaatacccacaaaaatcggtatcggaattgcgcaaa tatttttttatggaatctcggaaatttagcaaaattattcggtatttcgg aaatcgcaaacccccaTACTCCTCCCCCtctgaagtgcaatttttaaaca ttgaatttcgaatgaggatgaaaaaaacttaatttccaATTGGGGCTGAA ATTGTGGGGCTGggctcccagcgggtctgtgacacaggggtatatGATAT GATCAATCATACAACCAACCAAATCCAAAGAGTGTATAAAgcagaaggat gtcgaaattcaGTAACGAAAAAATGGGTTTGGGTTTATCTCTGGAAATTC ACCTATCTTAGAAAAAGTGTTATGATTTTGTAAAGTCTCAAATCGCTTCC CTAGCTATTGGTATTGCGAATTTTAGTTATTTcagttttcataatttttt caacaCTTCTGGACAAAATAtcttccaccccccccccttttaataAACGG GTTTTTATTGGAATAACCTATCATTATTGCGCTATTTATCTTTTATTGTC CTCACATAGGATGGGTTCTGGTGAAGATGATACAGATGTGGTCAACCTTG CGTTCGTTGAATCTCTATTAAACGCTGGTGCTAGTATGAACTACCCTGAT GTTTATGGTCAAAGTATTTTCTTTGCTGTAGTACGTGACTGGCACATTGA CGTCGCAAGGTTTGCCATTGAAAAAGGAGCCGATGTGAACCATCGGGACC AGTACGGGAGAACACCGTTACATCTTGCAGCTGCAGTCAATTATGAAGAA ATGGTGGCATTTATTATTGCTAATGGAGGTACGTGGAATTGATTGTCAAT CTAGGGGGTTTAGTTTCGGCAAAAATCCGCCAAAAATGTTATCTTGGTGA GGAACGATTTCAACTCTTATTATGAACAAAGAAAATCTTGGTAAATGTTT TCAAGTCGTTCGTGTTgggttttttttcgaaactccACCATTGTATCAGA TAATCCATCACTAACATGAGAAACCACAAAATCAgcgaatgagtagctta gatttggtaatctgatctaggtgGTAAGTTACTGGGGGCTGAGAGTAGGT GCGTGACGCTCCATCTCGGCATTCGAAATTCCAAGTCTAGCGTAAATAGA AAAAGACATAGACTCCCAGCTGgcgcacaacgttgtttcaacgtttatct aacgtccacaacgtcacgtccatataacgttagataaacgttgaaagaaT GTTATGTGCCAGTTGGGCTCCCTCACTCCCAGCTTTagcgacagccacca gatgaatacagtggaacctccaattagcggacaccatcggagAGTAAGCA AAGTGTCCGTTAATTGGAGGTGTCCGCTTTTTGGAGACTGTTTTAGTGGC GTTTGTTAAAAAAGGGGGAATTGGTTGTGTCCGCTATTTAGACAGTGTCC GCTTTTGGAGTGTACGTTGATTAGAGGTTTCACTGTATAATTTCTTCACT TTTAGCGGATATCACAGCCAAAACAGAGGGTGAAGAGCAGACACCTCTTC ATTATGCAGCACGATACGATTCAGTAGAAGCAATGAAAGTTTTGATACAA GCTGGTGCTATGATCGATGGTGTAGATTTCTTAAATCGAACACCCTTACA CGTGGCAGCTGAAACAGGTATTAATCAATTGTTGTACTCAGTTCCCTAGT TCGGTTTGTTATGATTCCTATAGCGCTTACAAATGGTAACTTTGGTGTCA ATTAATCGTGCTTGGACAAAGAATGATAGAGACTCGGATAGAGATGTTTC TTGGATTTTAGGCTAGTCTACTTGGATTTAGTTTGAAGTTGATTGctaaa aacaaacaattattCGTTTTCCTACAGGTCTAACAGTAGCTGCCAGGGGT TTTTGAGTTTACTGACTAGACAGGCATGTTCTGGGGAAATTGCAACAACT TTCAAACCTTAGGTTTTCGATAGGTGCTTTCCATTGATATATTTCTATGA GAGTTTTCACCTACTgatttaaaatctaaaattcaaaGAGGGCGTCCTAG AATCCGTAATTCTGGTATTTGACGGAAAAAAATGCACGAAATTtcagtat tgaaaagaaaacatctGTTAAAACTTCGACATTAAGAAATTCTTTGGAAG TATTTTGTACCTTCGGAAGCAGTTAAGATTTCCATGGACTTGAGATGAAT GAAGGTTAAGACTCGATAAATTTGACTTTCAGTTGATAATAAACTTCATT TTAAAGGAAATCATTCAACGTATCTCCTACcattgcttacacagcatttc ttaaacaaaaaaaaactttttttcccctTTCGACGCCACGCGAgcacaaa ttttcttttgtttgttctGCTTTGTTAGCATAGAACTGCAcctttttact ttaaatttcatcgaataagggagcctattgAAAAGTAGAACGTCGactta gagagcgtcaactgtatcatAAAAGAActtcactttcaatttcttcAACA TCTCAAACTCTTACTTTTCAGGTAGTCACGAAGTTGTcaaatttttaatg aaacttGGTGCACCAACAGGTGTTTATGATTCGTTCGGTAATTCTGTCAT GTTCATGATGATTGAAAAAATGCCACATCTGGCGTATGAAGGGTTGAACC AATTCTTTGTTGAAGACAATGCTATGAGACGACGGTATTATTATCTGGAC CATCTTGAGTTTGATGTTAAATCAAATGTGTCATCGAAGAATGCTAGAAA TGTTTTAGAGGTAGATCATTATTTAACCCAACTGGCACCCAACGTTGtct taacgttcatctaacgttatatagacgttgCGAACGTTGCGAACGTTAGA TAAACTTcaaaacaacgtcgtgtgcctgCTGGGAATTCATTTTTACCTTT ACTTTGGTTTACCTTGTTCTTATTCAGCGATTCATATGCTCTCTAAACCC CAAGGGTCTGGTATTTGACCATTTCGATCATTGAACTCTGATCAGCCATC CTGTAAGGAAGATAAGCAGAGAGCAGTGGCTGGTCCAAAACACCTTGGAA AAATTGTTCAAGTTTCATTCTATTGACTTTTAATAATTAtcatattttga ttaaaaaactcGCTCTACCATTTATCAAGCACCATACTCTTGTACAAGCT TGTCTACAACATAGCCAGGCATTAAAAACCGCATGTTGGTCTAGTATCTG TAAATTCTCATAACTCCTTCGCTTCGTTAATAATAAATCGTGTGTTTTTC CTTTCTGACGATTGTCTTTTCTTTTTGCAAAActacttttaaaaaaaact gtatatcGTAACAATATCTTGACGATCTAAAAAACAAATATACAATAAAA ACCAACAAATTTCATTTTCTAGGCCATAGTGATGTACAAAGAAGTAGACC TCATGATGCACCCGTCAATCAAAAAGCTGTTGTCAATCAAATGGAAATTG TACGGTAAACGACGTGCAATCATTAGTAACCTTGGAAACGTTTTTCACAC TTTGTTAGCAACTATCCTTATCTTTGCAATACCGTACCGGCCATATGATC AACAGTTTACACCGGTCAAAGATAATATCATATTTATCACCCTGGCTATG CTGTTCGTCGTACTTACCTTTTTCTTTTGGATAAAAGTAAGTTTTTCCTT AAgtaaagaaattttcgcggagtTTGATTTCgcggttcacagctcaaaat gcGGAAGTTTCGAGAAATTTAATTTCGTAGTTGAGAGAAATTTTCCTTTA CAAAATGgcctatttttgttttgttaaatcCATAGAATATTCGTGTTACG CGGAATTTCATTTCGTGGATGTGTAAAGGAAAAATAGGAAattagaaaga aaatttctacccttaagGTATAATGTaattacaattaaaaaacaacaaTC AAACTCTACTTGAGTATGAGGTTTAAAAGACAAATGAATCAAAAGTGAAT GGTAATAAATTCTGAAACAACCCAACAAAATCAGCACCCCCAGTCTGACC GCTACGCCTATCAAGATTTAAAGAGACTAAAGGCCGGTTTACcaacttgc gcgcgctgcgattgccccttttggcttcaatccttcttgcttggaaaaaa gattacgtcataaaaatgtagcgcgcgctcgaaaaaaaaaatgaacaaat ttcaaattttttcaaccgttacgtcagatcgcgccaatgaaGTTGCTCCA tctttcttttgaccaatagcgtggaagctttgctcaaaaaagtgcgatcg aagcgcgcgcaagtggagaccggccttaagttcGAGTTTACCAGGTAGAA ACGTGAAAAGATTGTAGTCGTTGCATTGATAGACACAGAATTCTGACGTC ATTTCTTCTTGGTAATCTTTTTGGCAGTAGTGTGGTTTGTAGATGTATTA TTGGGCttctccagaaaaaatttgaatatggaggtggaggatataacgtT TTTTAGAAATTAGCCCCCGGACATATTGAATTATGACCCCCCTCCCGGAC AACAGATCTTAACCCACGGACAAGCATCAGTACCTGATGTacccatgtac aaaaattttccggaaaAGCACACTATCGTGGCTTGATAACGCTGGAGAGG CAATACAggagaaatgacaattttttccCCTCTAAGTAAATtccctgaaa attaaaaaaaacataatactgggggaaagtgacgaaaattttgagagggt gacgaaattttcccccgacgaattttttccccgatattttatcacccgac caaaacttttacccaatttttcaAACCCTAACCAAAAATAAAGTCTAaat tttttacaactttattaaccaagattagtgctttaaacgccgaattacaa gatattttttcgagctagtgaaggaaaccatttaatttggacaatttagt tgggtgaaagtgactaaattgtaaatttcgtcgggaaaaatgacgaattt gaaattttggtcgggggaaagtgacgaaaatgcctctaggtgaagaaatt tttccccgacgaaaaaaaaaacccgactaaataaaactccgacatttttt tccccgataaggtagtaggggaaatttgtaaaaccGTGcgaattttttag tcaaagcacttgttaatcatttttggaaagctaagggaaAGGGTgctttt ttttcggacactttagtgtgtttttcggacaaatatgaacAAATATGACg gtttcaggcaaaaatcatagagtcaaaatttaattaaaattttagcttga gaaaatagacaaattgtatatttttggaaagatctttaaaagttaagatt tgagatatattgcgagtatagatGATTTCTCtatctaactcgagatattg agcttcaaaaagtacaaaaagtggacaaaatttctggctgaaaaacaata tcttgagttaggtacaAAAATAGAATCTTAAGATAGAAAGGTAAAGATAA GCTTTAGAATTGATTTTAGACATCAGATGAAAGTCCCATGAAAGTCAAGG AACCCTGTTTCATTAAAAAGTTCACTCTAATGAAATCTCCatccaaaatt gaatttattatttttcctAAATTATTTACTTGTTTCATTACAGCAAATCC TAACAATACGACTGCTGAACGCGAAAGACCAAGCTTATAAAGAACACCGC TTTAATTACATCAAAAAACAATTACCTCATTGTCATCCACGGTGGACAGA AGAAAAAGAgtttcttgaaaaagaaattgaaagaatCAAAAGTTACAAAT CAACATTCTGGCAAGATTACTGGAATATATTTGAATGGGTTTCTCTACTT TTCGTTGTTATTATGTTCGCTCTACATATTACTAATATTGTATCACCGAA TATGAAAGTTTACAGAGCAGCCAATTTTGTTTCCGCCATCACGCTTCTTT TGGTTTGGTTCCGCTTGTACAAGACGTTGAGGATTGCTCGATTCTTCTCT GAAATCAATGTATTGCTAAGTAAGTATTATTGTTGACTATGGCTAGTTCG AACTCGAATCTAATTAGTTTGAATGACAGAGAGATTTCAATTATCGAAAG CATTTTATGAGAAATTCGAGAAATTCGAATGATAGAAGTTCGAATCAACG AGAATTATTGTCTTTAGCACAGGTATTCATTTAATAAGTCTACATTTACA ATCAACATTTACAATTGAAAGGCTTTCTAAAAATTGCACATCACAAGGAT TGCGCATTGGGccgttccattttatatccatacagggattagacaaacat ttccagggggtaataggagaagaatttccagagGGTATAAAGgagttgtt tttaatttttccagggtgtaaaaaatattctaaaatttccagagggtaaa aGTTCGTCCACCTTCACTTTCAaggtataaaaataatttttgtaagggct attttgcaaattttgccattttccaggatTTATCCACACATTCCTAAGAA TCCTTTTTGCCTTGGAAATGTTCTTTCACCCACTTGTAtagaaatttaat ggaacagcccattgtTCGGCAAcgagaaatgaaaatttctttgaattatg aaaattttgagttaGAATCAAGAGTGTTAAGTAAAGGAAAtaaaaaactt gttcgagttaggaGACATTTCAGTAATTCACACTCCCATTAACCTTTAAA AAtcagggacaagctggagtttttacaagctcttatttgatttggttggt cgttaaccagtaataaaacaattttgttactttttctaaagaacgcgtca tctctatccacttcaaatgaccaattagtgaagtatattgtaaaaactcc agctcaccCCGAAAATCAATTcctaaaattttatctttttgCTCTTTTTA GCTAATGTTGCTTTGGAGACATGCAGATTCGTGATTCTTTACATGGATTT ATACATTCCCTACATTTTCGTGTTTTTCATGTTATTTGGTGGCTCAACTA AATTgtttggaaatacaaagaaaaatatcGATGAAAATCATTTCGAATTG GAACAGTTTAGTGATGTGGTATgacctttttttctttgtttgtacTCCGA ATCTTTTTGCTATGCTGAATTTTCCAATACTTCCGTTGAACGTAAGAAGG TAAGTCTACGACCGCAGTCGGAAGCGAATCGAAggttcctctttcgatag ctatctacccgaaggtgaGTTAGGGCCTCACTATTTCTCCCTGGAATGCT TTTACATTTTATTCTTTTCTTacttgctgagcatcaagcagagagcaACA ATTTTGCACTAATTAAGAAATACTTTGTAAAATGGAAGTTATGAATGTTG TTTTGACGTTCTGTTGCCAACTGGTTCATCATAGGTTATTCTGAATCTTG AACTTCaaggctggtctccacttgcgcgcgctgtgatcgcactttttggc ttcaatcttttttacttggaaaaaagattacgtcataaaagtgTAGCGTG AGCTCAAaagaaaagttgaacacatttcaacatggagttgcttcattttt cttttggccagtagctttgctcgaaaaagtccGATCGAAGCACaggcaag tggagaccggccttcgCATGCGAATCAGCGttaccattttttatttttta gttatATTATGGCTGGTTGGTAATGCTTGGTAAACATTTCCCAGAGGAAG GAGGTACAGCTGTCAATCATGTTGCACTCGAACTTTTTCTTGGTTCCTAC ATTGTCATATCAACGCTTCTTGGCTTCATTTATATTGGACGTTTGTCCGA ATTGTTTTCACGTGTTTACAAGAAAGTCAACGCCAAATCANGCTTCATTT ATATTGGACGCTTGTCCGAATTGTTTTCACGTGTTTATAAGAAAGTCAAC GCCAAATCAAATTTGTTAGTGGCTGGTGTTTTGGTGacagaagaaaaata tttatctcaaaatcaattACGCGCCAATAAGAAACACATGAGAAGGCTTT GTGGACCAATGGTAAGATTTAACGCATTCAACTTTTAGGGGTCCTTCTGT AGAAATTACCGTACAACGGCAGAAACTTCTCATTCCCGGCAAAACATtcc tattgatgattctgatgggcACGTTGACAGGGTGTAATCCTAAACAATTC ATCCAGTTTTAACGGCACTGGCCTCTTTacgtcgcagaatcgtttaacGG CACTGGCTCGTTAGGGTAATCAAGATGGTGATTGAATCTATCGAATTAAT TTTTCCAATTGAAGGTTGTTCCGTTTGAGAGTAACAAAGGTGTAGAAGAT GATGATCAAAACATTGGAATAGGAATCGAACATGTTACATCCAAAATTGA AGATGTCACTAACTATCTAAgtaaatctttcatttttattattctTTCTC TCTCCACTAACCCCATCTGTAAAATTTATTATACTACCATTtatcgtaag ttggtctaacgAATATCCCTAATAAATACCAGCACCTTTCTTTAGGGATC GTGGTAACATGATGGTCACTgtctgaaaaaagattttaaccGCTAAGCAA AGAAACATACTCttaatcagcgattccgaccttttttttatttccaatgc taaagaagggtgtcagggTTCGATCATAGTcagtataaaaaaccctggtt ttaactttttgttagcccTTGCTagtatcaaaagataaaaactgatttgc tcagtttttgatcacgttaccaagtactcctcttgggattggtttaagat ttaatcacatgatcaaaaagtttctaATTTCTTAAGTTAAAGTAGGAAAc aatgaaaagaaacaaaagacaCTTCTAGACCGGGGTTTTTATACGGGCTA TGATTCGATGAGCGATgctgacattagaccaactcaCTGTAAGGCCTTGA CGTGTGAAAATAGTTTCAATCAGATTTGGCTaacctgaaaaaataatttt gccccTTCGAGTCGAGAAAGGTCAAACCTCTTTGATTTATGcctgaaatt tcagaaaactaAACTAGATTTaagtaaattctaaaaaaagaaCCCATATA TATATCTGACCTATTCGGTCATCTTTTCTGGACAGGAAATAAGATCTCAT GAAAAACACGAGGAAATTCTTTTTAGCGTAGCTCTTTGGTGCAACCTTAG GATGATTTACCACATAGATGATCTAAAAACATTTAATCAAATTATATATT AAAGTTtcaataactcgaacctctataactcgaatttctCCTTAACTCGT CCATAGTCTCTGGGGTCCCTTCAGGCAACAAAGCCTTACAAAACATTACT AAAATTTCCATAACTGGATGGAATAAATCTGCattcccgtgcgtgttcga gttatggagactcaactgtataTTGTCTTGTTaatggaaattaaataaaa cGAAATGTGGAAGCTATTTATTCTTTCTAGTCCCGGGTGGAGGGCTCACT TAGGTGTTGCTGGTCAGGGTTGGAAGATATGTGACAGGGCGGATCCTaga tttactaattttcaagatgtgtatctgacagggcCGGCTTTGGTTATTTC GGACAATTTTTTTCaggttgaaaatttgaaaagttttcaattttttgttc taACACGACCCatatttaccaaacattcatatcagGGTCAACTCTTCAAA CTCCAGCGTTACGTGTCCGTCGCCCGTCAAGAccattgcccccccccccc ccccccccccgggtttctaACCTGTTCAtatccattttattttatttttt taggaaaagcAAATTTCCCACGTGAAGAAAGGCAATCGATCAATGTAGAC CAATTGACTGTTCTTGAAACTGAacttgaaagaatatttcaaagtaTGTC TGAAAGCGAAAGACTGTTGacggaaaacaaagaaaatgttaagacTGCGC AAACGAAAACCATTGATCTGATCAAAGAGAGTAAGTAAAgaatacacccc tttctcagacccggtggggtttttcagccagtggggttAAAAATAACAGA CCAAAACTCGATAGTAGTCCAGGggaattttggtcattttttaccgaacc caaaatttgcgtacacatggaattttttgattgaaatgtgttcattGGGT CATTGGGATTGAAAAACCGTCGAGTGCCACCTGGCACACCTTgagcattt tccataatggcggaattttcaaaatggcggattaaaaaaatttcaaaatt ttgatatcttcAAACCTAAGCACATTATATACCGTTTGAAAGGATTTTTt atgctgaacaacttttttgcttacgaaaAAGTCTTAGGTTTgaagatatc aaaattttgaaatttttttaatccgccattttgaaaattccgccattatg gaaaatgctcAAGGTGTGCCAGGTGGCACTCGACGGTTTTTCAATCCCAA TGATCCaatgaacacatttcaatcaaaaaattccaagtgtacgcaaattt tgggtcaaaCCTAAATTCCCCTGGACTATAGGAACTGATACTcatatgtt ttttttgactgggggatttgaatttgattgttttcgagccagaaaattca gtgtggATGGAAAAATAGCTTGAATCTGATTATTCTCAGTATGGACAAAA TTAGAGTGTGAAGAGGTCCCAGgaggtttgtgagaagggggtaaaGAGTA TCAAAAAGGACTTTATGACCAAAAGTCTTTAAAAGGGATAAtaagatggt ttgagatatttggtctatagattttttttcataatactgagaaaaacttt caaatctcTTTATCTATATATTTCTGAACGTTAAGATATTCAACCAACAA GTAGAAAAATATTTGGGAGTTTTGCCCACGACCATTGGAGATTTGTGTAG GCCAAATATCTTGAATCATCTGGTTGTACCTTTAACCAGCAGTAGGTTCG TCTTGCAATTCCTGCATtagtaacacgcatgcgtaattagTCATCTTTAA ACCACTatttaattcccgtgataaacaaagaggtggtacagtcactttag GTCGGGGTTGTGCACggtgaaatatgaaatttgtcgttttttttttgtcg ttctttatgaaatttgtcgttcattttggctatttttagtaatgcaggat ttgttAGATAAACCCCTCCCAGTGTGTATCTGTATTGTATTGATGTTTGT AGCTCTTTTCTCATGGGAGACCATCTTAAACCGACTTTTACATGTAGGGG AACACGGTTCGTGCTTAAACTTTTAATCTTTGTACTTTTCACCGAATCTA CTAAGTTTGGAAAGCACCACAGTTATGTGCGGACCGGTTCAAAACCCTAA ACCATAGAGAGACTAAATTTTAGCCAAAACGTGATCCTTAGAGACATTTG AtatcctatttttgcctaaagCTTCCCCCGGGACCTTTCACCAGTTTATT ATTGCATATTGTATTCTTTTAATAGCGATTGAAACACGAAAGACCAATGC GAACAGAAAGTAATACAAGAAGGATAACTTTTACTTATCCTGCGATAcag taaaaatttataaatatcttattttaaagttttaaattacTAATTTTTCT GTACCTTTTTGTTTTATGgacttttttgttgattttcttcgtttaaaaat ttttccctAATTTTAAGCTTTAGGGACCTATGGCTATGGGCTTATCCCTT AAAAATATCGCATAcataagataaaaaaattttttatggagGGACTATGG TTTTACATAGACTTCATACTAACctcatagtttctaccccccctacattt aggggggtcttaggttttgatgaaccaaaagcaaggggg

Coding sequence (CDS) from alignment at sc0000010:172492..198180+

>TCONS_00001334 ID=TCONS_00001334|Name=TCONS_00001334|organism=Clytia hemisphaerica|type=CDS|length=28941bp|location=Sequence derived from alignment at sc0000010:172492..198180+ (Clytia hemisphaerica)
ATGCCTACTGCAGGAGGAGCCAATAATAGCGGTGTTCGTGGCTTCTTTAC
AAATTTCGCCAATTACACTGGTGAAAAAGTATCCGAAGTGAAAGAACTTT
TATTTGGAGTCAACATTGATGATAGTGTTGAACTAGCATCTCTAACAAGT
CGACAAAGTAATTCATTTCGTAGCCGAAATGGTGGTAATCATGATATATT
AAAACGAAAAACATTAATTCCTGATGAACTACAACACGAGGATATTTACG
AACAGTATGCAGAATACGATTGTTCTCGTAATCTTGTCGTAAGTTCGACG
ACGCTTTTTCGTAAAGGCCCGATTCCGATCGAACATTTATCACATCAAGA
ACAGAATCGTCTTTCAAAACGTGGTTGCTTGTTAGAGTGGAACGATGCAC
AACGTCAGACGTCTGACAATCATCTACCTTACATTGACCCTAGTAGTAAG
AGTTTGCTGACTTACTTTGCAAGGATGGGTTCTGGTGAAGATGATACAGA
TGTGGTCAACCTTGCGTTCGTTGAATCTCTATTAAACGCTGGTGCTAGTA
TGAACTACCCTGATGTTTATGGTCAAAGTATTTTCTTTGCTGTAGTACGT
GACTGGCACATTGACGTCGCAAGGTTTGCCATTGAAAAAGGAGCCGATGT
GAACCATCGGGACCAGTACGGGAGAACACCGTTACATCTTGCAGCTGCAG
TCAATTATGAAGAAATGGTGGCATTTATTATTGCTAATGGAGCGGATATC
ACAGCCAAAACAGAGGGTGAAGAGCAGACACCTCTTCATTATGCAGCACG
ATACGATTCAGTAGAAGCAATGAAAGTTTTGATACAAGCTGGTGCTATGA
TCGATGGTGTAGATTTCTTAAATCGAACACCCTTACACGTGGCAGCTGAA
ACAGGTAGTCACGAAGTTGTcaaatttttaatgaaacttGGTGCACCAAC
AGGTGTTTATGATTCGTTCGGTAATTCTGTCATGTTCATGATGATTGAAA
AAATGCCACATCTGGCGTATGAAGGGTTGAACCAATTCTTTGTTGAAGAC
AATGCTATGAGACGACGGTATTATTATCTGGACCATCTTGAGTTTGATGT
TAAATCAAATGTGTCATCGAAGAATGCTAGAAATGTTTTAGAGGCCATAG
TGATGTACAAAGAAGTAGACCTCATGATGCACCCGTCAATCAAAAAGCTG
TTGTCAATCAAATGGAAATTGTACGGTAAACGACGTGCAATCATTAGTAA
CCTTGGAAACGTTTTTCACACTTTGTTAGCAACTATCCTTATCTTTGCAA
TACCGTACCGGCCATATGATCAACAGTTTACACCGGTCAAAGATAATATC
ATATTTATCACCCTGGCTATGCTGTTCGTCGTACTTACCTTTTTCTTTTG
GATAAAACAAATCCTAACAATACGACTGCTGAACGCGAAAGACCAAGCTT
ATAAAGAACACCGCTTTAATTACATCAAAAAACAATTACCTCATTGTCAT
CCACGGTGGACAGAAGAAAAAGAgtttcttgaaaaagaaattgaaagaat
CAAAAGTTACAAATCAACATTCTGGCAAGATTACTGGAATATATTTGAAT
GGGTTTCTCTACTTTTCGTTGTTATTATGTTCGCTCTACATATTACTAAT
ATTGTATCACCGAATATGAAAGTTTACAGAGCAGCCAATTTTGTTTCCGC
CATCACGCTTCTTTTGGTTTGGTTCCGCTTGTACAAGACGTTGAGGATTG
CTCGATTCTTCTCTGAAATCAATGTATTGCTAACTAATGTTGCTTTGGAG
ACATGCAGATTCGTGATTCTTTACATGGATTTATACATTCCCTACATTTT
CGTGTTTTTCATGTTATTTGGTGGCTCAACTAAATTgtttggaaatacaa
agaaaaatatcGATGAAAATCATTTCGAATTGGAACAGTTTAGTGATGTG
ttatATTATGGCTGGTTGGTAATGCTTGGTAAACATTTCCCAGAGGAAGG
AGGTACAGCTGTCAATCATGTTGCACTCGAACTTTTTCTTGGTTCCTACA
TTGTCATATCAACGCTTCTTGGCTTCATTTATATTGGACGTTTGTCCGAA
TTGTTTTCACGTGTTTACAAGAAAGTCAACGCCAAATCANGCTTCATTTA
TATTGGACGCTTGTCCGAATTGTTTTCACGTGTTTATAAGAAAGTCAACG
CCAAATCAAATTTGTTAGTGGCTGGTGTTTTGGTGacagaagaaaaatat
ttatctcaaaatcaattACGCGCCAATAAGAAACACATGAGAAGGCTTTG
TGGACCAATGGTTGTTCCGTTTGAGAGTAACAAAGGTGTAGAAGATGATG
ATCAAAACATTGGAATAGGAATCGAACATGTTACATCCAAAATTGAAGAT
GTCACTAACTATCTAAgaaaagcAAATTTCCCACGTGAAGAAAGGCAATC
GATCAATGTAGACCAATTGACTGTTCTTGAAACTGAacttgaaagaatat
ttcaaagtaTGTCTGAAAGCGAAAGACTGTTGacggaaaacaaagaaaat
gttaagacTGCGCAAACGAAAACCATTGATCTGATCAAAGAGACGATTGA
AACACGAAAGACCAATGCGAACAGAAAGTAAATGCCTACTGCAGGAGGAG
CCAATAATAGCGGTGTTCGTGGCTTCTTTACAAATTTCGCCAATTACACT
GGTGAAAAAGTATCCGAAGTGAAAGAACTTTTATTTGGAGTCAACATTGA
TGATAGTGTTGAACTAGCATCTCTAACAAGTCGACAAAGTAATTCATTTC
GTAGCCGAAATGGTGGTAATCATGATATATTAAAACGAAAAACATTAATT
CCTGATGAACTACAACACGAGGATATTTACGAACAGTATGCAGAATACGA
TTGTTCTCGTAATCTTGTCGTAAGTTCGACGACGCTTTTTCGTAAAGGCC
CGATTCCGATCGAACATTTATCACATCAAGAACAGAATCGTCTTTCAAAA
CGTGGTTGCTTGTTAGAGTGGAACGATGCACAACGTCAGACGTCTGACAA
TCATCTACCTTACATTGACCCTAGTAGTAAGAGTTTGCTGACTTACTTTG
CAAGGATGGGTTCTGGTGAAGATGATACAGATGTGGTCAACCTTGCGTTC
GTTGAATCTCTATTAAACGCTGGTGCTAGTATGAACTACCCTGATGTTTA
TGGTCAAAGTATTTTCTTTGCTGTAGTACGTGACTGGCACATTGACGTCG
CAAGGTTTGCCATTGAAAAAGGAGCCGATGTGAACCATCGGGACCAGTAC
GGGAGAACACCGTTACATCTTGCAGCTGCAGTCAATTATGAAGAAATGGT
GGCATTTATTATTGCTAATGGAGCGGATATCACAGCCAAAACAGAGGGTG
AAGAGCAGACACCTCTTCATTATGCAGCACGATACGATTCAGTAGAAGCA
ATGAAAGTTTTGATACAAGCTGGTGCTATGATCGATGGTGTAGATTTCTT
AAATCGAACACCCTTACACGTGGCAGCTGAAACAGGTAGTCACGAAGTTG
TcaaatttttaatgaaacttGGTGCACCAACAGGTGTTTATGATTCGTTC
GGTAATTCTGTCATGTTCATGATGATTGAAAAAATGCCACATCTGGCGTA
TGAAGGGTTGAACCAATTCTTTGTTGAAGACAATGCTATGAGACGACGGT
ATTATTATCTGGACCATCTTGAGTTTGATGTTAAATCAAATGTGTCATCG
AAGAATGCTAGAAATGTTTTAGAGGCCATAGTGATGTACAAAGAAGTAGA
CCTCATGATGCACCCGTCAATCAAAAAGCTGTTGTCAATCAAATGGAAAT
TGTACGGTAAACGACGTGCAATCATTAGTAACCTTGGAAACGTTTTTCAC
ACTTTGTTAGCAACTATCCTTATCTTTGCAATACCGTACCGGCCATATGA
TCAACAGTTTACACCGGTCAAAGATAATATCATATTTATCACCCTGGCTA
TGCTGTTCGTCGTACTTACCTTTTTCTTTTGGATAAAACAAATCCTAACA
ATACGACTGCTGAACGCGAAAGACCAAGCTTATAAAGAACACCGCTTTAA
TTACATCAAAAAACAATTACCTCATTGTCATCCACGGTGGACAGAAGAAA
AAGAgtttcttgaaaaagaaattgaaagaatCAAAAGTTACAAATCAACA
TTCTGGCAAGATTACTGGAATATATTTGAATGGGTTTCTCTACTTTTCGT
TGTTATTATGTTCGCTCTACATATTACTAATATTGTATCACCGAATATGA
AAGTTTACAGAGCAGCCAATTTTGTTTCCGCCATCACGCTTCTTTTGGTT
TGGTTCCGCTTGTACAAGACGTTGAGGATTGCTCGATTCTTCTCTGAAAT
CAATGTATTGCTAACTAATGTTGCTTTGGAGACATGCAGATTCGTGATTC
TTTACATGGATTTATACATTCCCTACATTTTCGTGTTTTTCATGTTATTT
GGTGGCTCAACTAAATTgtttggaaatacaaagaaaaatatcGATGAAAA
TCATTTCGAATTGGAACAGTTTAGTGATGTGttatATTATGGCTGGTTGG
TAATGCTTGGTAAACATTTCCCAGAGGAAGGAGGTACAGCTGTCAATCAT
GTTGCACTCGAACTTTTTCTTGGTTCCTACATTGTCATATCAACGCTTCT
TGGCTTCATTTATATTGGACGTTTGTCCGAATTGTTTTCACGTGTTTACA
AGAAAGTCAACGCCAAATCANGCTTCATTTATATTGGACGCTTGTCCGAA
TTGTTTTCACGTGTTTATAAGAAAGTCAACGCCAAATCAAATTTGTTAGT
GGCTGGTGTTTTGGTGacagaagaaaaatatttatctcaaaatcaattAC
GCGCCAATAAGAAACACATGAGAAGGCTTTGTGGACCAATGGTTGTTCCG
TTTGAGAGTAACAAAGGTGTAGAAGATGATGATCAAAACATTGGAATAGG
AATCGAACATGTTACATCCAAAATTGAAGATGTCACTAACTATCTAAgaa
aagcAAATTTCCCACGTGAAGAAAGGCAATCGATCAATGTAGACCAATTG
ACTGTTCTTGAAACTGAacttgaaagaatatttcaaagtaTGTCTGAAAG
CGAAAGACTGTTGacggaaaacaaagaaaatgttaagacTGCGCAAACGA
AAACCATTGATCTGATCAAAGAGACGATTGAAACACGAAAGACCAATGCG
AACAGAAAGTAAATGCCTACTGCAGGAGGAGCCAATAATAGCGGTGTTCG
TGGCTTCTTTACAAATTTCGCCAATTACACTGGTGAAAAAGTATCCGAAG
TGAAAGAACTTTTATTTGGAGTCAACATTGATGATAGTGTTGAACTAGCA
TCTCTAACAAGTCGACAAAGTAATTCATTTCGTAGCCGAAATGGTGGTAA
TCATGATATATTAAAACGAAAAACATTAATTCCTGATGAACTACAACACG
AGGATATTTACGAACAGTATGCAGAATACGATTGTTCTCGTAATCTTGTC
GTAAGTTCGACGACGCTTTTTCGTAAAGGCCCGATTCCGATCGAACATTT
ATCACATCAAGAACAGAATCGTCTTTCAAAACGTGGTTGCTTGTTAGAGT
GGAACGATGCACAACGTCAGACGTCTGACAATCATCTACCTTACATTGAC
CCTAGTAGTAAGAGTTTGCTGACTTACTTTGCAAGGATGGGTTCTGGTGA
AGATGATACAGATGTGGTCAACCTTGCGTTCGTTGAATCTCTATTAAACG
CTGGTGCTAGTATGAACTACCCTGATGTTTATGGTCAAAGTATTTTCTTT
GCTGTAGTACGTGACTGGCACATTGACGTCGCAAGGTTTGCCATTGAAAA
AGGAGCCGATGTGAACCATCGGGACCAGTACGGGAGAACACCGTTACATC
TTGCAGCTGCAGTCAATTATGAAGAAATGGTGGCATTTATTATTGCTAAT
GGAGCGGATATCACAGCCAAAACAGAGGGTGAAGAGCAGACACCTCTTCA
TTATGCAGCACGATACGATTCAGTAGAAGCAATGAAAGTTTTGATACAAG
CTGGTGCTATGATCGATGGTGTAGATTTCTTAAATCGAACACCCTTACAC
GTGGCAGCTGAAACAGGTAGTCACGAAGTTGTcaaatttttaatgaaact
tGGTGCACCAACAGGTGTTTATGATTCGTTCGGTAATTCTGTCATGTTCA
TGATGATTGAAAAAATGCCACATCTGGCGTATGAAGGGTTGAACCAATTC
TTTGTTGAAGACAATGCTATGAGACGACGGTATTATTATCTGGACCATCT
TGAGTTTGATGTTAAATCAAATGTGTCATCGAAGAATGCTAGAAATGTTT
TAGAGGCCATAGTGATGTACAAAGAAGTAGACCTCATGATGCACCCGTCA
ATCAAAAAGCTGTTGTCAATCAAATGGAAATTGTACGGTAAACGACGTGC
AATCATTAGTAACCTTGGAAACGTTTTTCACACTTTGTTAGCAACTATCC
TTATCTTTGCAATACCGTACCGGCCATATGATCAACAGTTTACACCGGTC
AAAGATAATATCATATTTATCACCCTGGCTATGCTGTTCGTCGTACTTAC
CTTTTTCTTTTGGATAAAACAAATCCTAACAATACGACTGCTGAACGCGA
AAGACCAAGCTTATAAAGAACACCGCTTTAATTACATCAAAAAACAATTA
CCTCATTGTCATCCACGGTGGACAGAAGAAAAAGAgtttcttgaaaaaga
aattgaaagaatCAAAAGTTACAAATCAACATTCTGGCAAGATTACTGGA
ATATATTTGAATGGGTTTCTCTACTTTTCGTTGTTATTATGTTCGCTCTA
CATATTACTAATATTGTATCACCGAATATGAAAGTTTACAGAGCAGCCAA
TTTTGTTTCCGCCATCACGCTTCTTTTGGTTTGGTTCCGCTTGTACAAGA
CGTTGAGGATTGCTCGATTCTTCTCTGAAATCAATGTATTGCTAACTAAT
GTTGCTTTGGAGACATGCAGATTCGTGATTCTTTACATGGATTTATACAT
TCCCTACATTTTCGTGTTTTTCATGTTATTTGGTGGCTCAACTAAATTgt
ttggaaatacaaagaaaaatatcGATGAAAATCATTTCGAATTGGAACAG
TTTAGTGATGTGttatATTATGGCTGGTTGGTAATGCTTGGTAAACATTT
CCCAGAGGAAGGAGGTACAGCTGTCAATCATGTTGCACTCGAACTTTTTC
TTGGTTCCTACATTGTCATATCAACGCTTCTTGGCTTCATTTATATTGGA
CGTTTGTCCGAATTGTTTTCACGTGTTTACAAGAAAGTCAACGCCAAATC
ANGCTTCATTTATATTGGACGCTTGTCCGAATTGTTTTCACGTGTTTATA
AGAAAGTCAACGCCAAATCAAATTTGTTAGTGGCTGGTGTTTTGGTGaca
gaagaaaaatatttatctcaaaatcaattACGCGCCAATAAGAAACACAT
GAGAAGGCTTTGTGGACCAATGGTTGTTCCGTTTGAGAGTAACAAAGGTG
TAGAAGATGATGATCAAAACATTGGAATAGGAATCGAACATGTTACATCC
AAAATTGAAGATGTCACTAACTATCTAAgaaaagcAAATTTCCCACGTGA
AGAAAGGCAATCGATCAATGTAGACCAATTGACTGTTCTTGAAACTGAac
ttgaaagaatatttcaaagtaTGTCTGAAAGCGAAAGACTGTTGacggaa
aacaaagaaaatgttaagacTGCGCAAACGAAAACCATTGATCTGATCAA
AGAGACGATTGAAACACGAAAGACCAATGCGAACAGAAAGTAAATGCCTA
CTGCAGGAGGAGCCAATAATAGCGGTGTTCGTGGCTTCTTTACAAATTTC
GCCAATTACACTGGTGAAAAAGTATCCGAAGTGAAAGAACTTTTATTTGG
AGTCAACATTGATGATAGTGTTGAACTAGCATCTCTAACAAGTCGACAAA
GTAATTCATTTCGTAGCCGAAATGGTGGTAATCATGATATATTAAAACGA
AAAACATTAATTCCTGATGAACTACAACACGAGGATATTTACGAACAGTA
TGCAGAATACGATTGTTCTCGTAATCTTGTCGTAAGTTCGACGACGCTTT
TTCGTAAAGGCCCGATTCCGATCGAACATTTATCACATCAAGAACAGAAT
CGTCTTTCAAAACGTGGTTGCTTGTTAGAGTGGAACGATGCACAACGTCA
GACGTCTGACAATCATCTACCTTACATTGACCCTAGTAGTAAGAGTTTGC
TGACTTACTTTGCAAGGATGGGTTCTGGTGAAGATGATACAGATGTGGTC
AACCTTGCGTTCGTTGAATCTCTATTAAACGCTGGTGCTAGTATGAACTA
CCCTGATGTTTATGGTCAAAGTATTTTCTTTGCTGTAGTACGTGACTGGC
ACATTGACGTCGCAAGGTTTGCCATTGAAAAAGGAGCCGATGTGAACCAT
CGGGACCAGTACGGGAGAACACCGTTACATCTTGCAGCTGCAGTCAATTA
TGAAGAAATGGTGGCATTTATTATTGCTAATGGAGCGGATATCACAGCCA
AAACAGAGGGTGAAGAGCAGACACCTCTTCATTATGCAGCACGATACGAT
TCAGTAGAAGCAATGAAAGTTTTGATACAAGCTGGTGCTATGATCGATGG
TGTAGATTTCTTAAATCGAACACCCTTACACGTGGCAGCTGAAACAGGTA
GTCACGAAGTTGTcaaatttttaatgaaacttGGTGCACCAACAGGTGTT
TATGATTCGTTCGGTAATTCTGTCATGTTCATGATGATTGAAAAAATGCC
ACATCTGGCGTATGAAGGGTTGAACCAATTCTTTGTTGAAGACAATGCTA
TGAGACGACGGTATTATTATCTGGACCATCTTGAGTTTGATGTTAAATCA
AATGTGTCATCGAAGAATGCTAGAAATGTTTTAGAGGCCATAGTGATGTA
CAAAGAAGTAGACCTCATGATGCACCCGTCAATCAAAAAGCTGTTGTCAA
TCAAATGGAAATTGTACGGTAAACGACGTGCAATCATTAGTAACCTTGGA
AACGTTTTTCACACTTTGTTAGCAACTATCCTTATCTTTGCAATACCGTA
CCGGCCATATGATCAACAGTTTACACCGGTCAAAGATAATATCATATTTA
TCACCCTGGCTATGCTGTTCGTCGTACTTACCTTTTTCTTTTGGATAAAA
CAAATCCTAACAATACGACTGCTGAACGCGAAAGACCAAGCTTATAAAGA
ACACCGCTTTAATTACATCAAAAAACAATTACCTCATTGTCATCCACGGT
GGACAGAAGAAAAAGAgtttcttgaaaaagaaattgaaagaatCAAAAGT
TACAAATCAACATTCTGGCAAGATTACTGGAATATATTTGAATGGGTTTC
TCTACTTTTCGTTGTTATTATGTTCGCTCTACATATTACTAATATTGTAT
CACCGAATATGAAAGTTTACAGAGCAGCCAATTTTGTTTCCGCCATCACG
CTTCTTTTGGTTTGGTTCCGCTTGTACAAGACGTTGAGGATTGCTCGATT
CTTCTCTGAAATCAATGTATTGCTAACTAATGTTGCTTTGGAGACATGCA
GATTCGTGATTCTTTACATGGATTTATACATTCCCTACATTTTCGTGTTT
TTCATGTTATTTGGTGGCTCAACTAAATTgtttggaaatacaaagaaaaa
tatcGATGAAAATCATTTCGAATTGGAACAGTTTAGTGATGTGttatATT
ATGGCTGGTTGGTAATGCTTGGTAAACATTTCCCAGAGGAAGGAGGTACA
GCTGTCAATCATGTTGCACTCGAACTTTTTCTTGGTTCCTACATTGTCAT
ATCAACGCTTCTTGGCTTCATTTATATTGGACGTTTGTCCGAATTGTTTT
CACGTGTTTACAAGAAAGTCAACGCCAAATCANGCTTCATTTATATTGGA
CGCTTGTCCGAATTGTTTTCACGTGTTTATAAGAAAGTCAACGCCAAATC
AAATTTGTTAGTGGCTGGTGTTTTGGTGacagaagaaaaatatttatctc
aaaatcaattACGCGCCAATAAGAAACACATGAGAAGGCTTTGTGGACCA
ATGGTTGTTCCGTTTGAGAGTAACAAAGGTGTAGAAGATGATGATCAAAA
CATTGGAATAGGAATCGAACATGTTACATCCAAAATTGAAGATGTCACTA
ACTATCTAAgaaaagcAAATTTCCCACGTGAAGAAAGGCAATCGATCAAT
GTAGACCAATTGACTGTTCTTGAAACTGAacttgaaagaatatttcaaag
taTGTCTGAAAGCGAAAGACTGTTGacggaaaacaaagaaaatgttaaga
cTGCGCAAACGAAAACCATTGATCTGATCAAAGAGACGATTGAAACACGA
AAGACCAATGCGAACAGAAAGTAAATGCCTACTGCAGGAGGAGCCAATAA
TAGCGGTGTTCGTGGCTTCTTTACAAATTTCGCCAATTACACTGGTGAAA
AAGTATCCGAAGTGAAAGAACTTTTATTTGGAGTCAACATTGATGATAGT
GTTGAACTAGCATCTCTAACAAGTCGACAAAGTAATTCATTTCGTAGCCG
AAATGGTGGTAATCATGATATATTAAAACGAAAAACATTAATTCCTGATG
AACTACAACACGAGGATATTTACGAACAGTATGCAGAATACGATTGTTCT
CGTAATCTTGTCGTAAGTTCGACGACGCTTTTTCGTAAAGGCCCGATTCC
GATCGAACATTTATCACATCAAGAACAGAATCGTCTTTCAAAACGTGGTT
GCTTGTTAGAGTGGAACGATGCACAACGTCAGACGTCTGACAATCATCTA
CCTTACATTGACCCTAGTAGTAAGAGTTTGCTGACTTACTTTGCAAGGAT
GGGTTCTGGTGAAGATGATACAGATGTGGTCAACCTTGCGTTCGTTGAAT
CTCTATTAAACGCTGGTGCTAGTATGAACTACCCTGATGTTTATGGTCAA
AGTATTTTCTTTGCTGTAGTACGTGACTGGCACATTGACGTCGCAAGGTT
TGCCATTGAAAAAGGAGCCGATGTGAACCATCGGGACCAGTACGGGAGAA
CACCGTTACATCTTGCAGCTGCAGTCAATTATGAAGAAATGGTGGCATTT
ATTATTGCTAATGGAGCGGATATCACAGCCAAAACAGAGGGTGAAGAGCA
GACACCTCTTCATTATGCAGCACGATACGATTCAGTAGAAGCAATGAAAG
TTTTGATACAAGCTGGTGCTATGATCGATGGTGTAGATTTCTTAAATCGA
ACACCCTTACACGTGGCAGCTGAAACAGGTAGTCACGAAGTTGTcaaatt
tttaatgaaacttGGTGCACCAACAGGTGTTTATGATTCGTTCGGTAATT
CTGTCATGTTCATGATGATTGAAAAAATGCCACATCTGGCGTATGAAGGG
TTGAACCAATTCTTTGTTGAAGACAATGCTATGAGACGACGGTATTATTA
TCTGGACCATCTTGAGTTTGATGTTAAATCAAATGTGTCATCGAAGAATG
CTAGAAATGTTTTAGAGGCCATAGTGATGTACAAAGAAGTAGACCTCATG
ATGCACCCGTCAATCAAAAAGCTGTTGTCAATCAAATGGAAATTGTACGG
TAAACGACGTGCAATCATTAGTAACCTTGGAAACGTTTTTCACACTTTGT
TAGCAACTATCCTTATCTTTGCAATACCGTACCGGCCATATGATCAACAG
TTTACACCGGTCAAAGATAATATCATATTTATCACCCTGGCTATGCTGTT
CGTCGTACTTACCTTTTTCTTTTGGATAAAACAAATCCTAACAATACGAC
TGCTGAACGCGAAAGACCAAGCTTATAAAGAACACCGCTTTAATTACATC
AAAAAACAATTACCTCATTGTCATCCACGGTGGACAGAAGAAAAAGAgtt
tcttgaaaaagaaattgaaagaatCAAAAGTTACAAATCAACATTCTGGC
AAGATTACTGGAATATATTTGAATGGGTTTCTCTACTTTTCGTTGTTATT
ATGTTCGCTCTACATATTACTAATATTGTATCACCGAATATGAAAGTTTA
CAGAGCAGCCAATTTTGTTTCCGCCATCACGCTTCTTTTGGTTTGGTTCC
GCTTGTACAAGACGTTGAGGATTGCTCGATTCTTCTCTGAAATCAATGTA
TTGCTAACTAATGTTGCTTTGGAGACATGCAGATTCGTGATTCTTTACAT
GGATTTATACATTCCCTACATTTTCGTGTTTTTCATGTTATTTGGTGGCT
CAACTAAATTgtttggaaatacaaagaaaaatatcGATGAAAATCATTTC
GAATTGGAACAGTTTAGTGATGTGttatATTATGGCTGGTTGGTAATGCT
TGGTAAACATTTCCCAGAGGAAGGAGGTACAGCTGTCAATCATGTTGCAC
TCGAACTTTTTCTTGGTTCCTACATTGTCATATCAACGCTTCTTGGCTTC
ATTTATATTGGACGTTTGTCCGAATTGTTTTCACGTGTTTACAAGAAAGT
CAACGCCAAATCANGCTTCATTTATATTGGACGCTTGTCCGAATTGTTTT
CACGTGTTTATAAGAAAGTCAACGCCAAATCAAATTTGTTAGTGGCTGGT
GTTTTGGTGacagaagaaaaatatttatctcaaaatcaattACGCGCCAA
TAAGAAACACATGAGAAGGCTTTGTGGACCAATGGTTGTTCCGTTTGAGA
GTAACAAAGGTGTAGAAGATGATGATCAAAACATTGGAATAGGAATCGAA
CATGTTACATCCAAAATTGAAGATGTCACTAACTATCTAAgaaaagcAAA
TTTCCCACGTGAAGAAAGGCAATCGATCAATGTAGACCAATTGACTGTTC
TTGAAACTGAacttgaaagaatatttcaaagtaTGTCTGAAAGCGAAAGA
CTGTTGacggaaaacaaagaaaatgttaagacTGCGCAAACGAAAACCAT
TGATCTGATCAAAGAGACGATTGAAACACGAAAGACCAATGCGAACAGAA
AGTAAATGCCTACTGCAGGAGGAGCCAATAATAGCGGTGTTCGTGGCTTC
TTTACAAATTTCGCCAATTACACTGGTGAAAAAGTATCCGAAGTGAAAGA
ACTTTTATTTGGAGTCAACATTGATGATAGTGTTGAACTAGCATCTCTAA
CAAGTCGACAAAGTAATTCATTTCGTAGCCGAAATGGTGGTAATCATGAT
ATATTAAAACGAAAAACATTAATTCCTGATGAACTACAACACGAGGATAT
TTACGAACAGTATGCAGAATACGATTGTTCTCGTAATCTTGTCGTAAGTT
CGACGACGCTTTTTCGTAAAGGCCCGATTCCGATCGAACATTTATCACAT
CAAGAACAGAATCGTCTTTCAAAACGTGGTTGCTTGTTAGAGTGGAACGA
TGCACAACGTCAGACGTCTGACAATCATCTACCTTACATTGACCCTAGTA
GTAAGAGTTTGCTGACTTACTTTGCAAGGATGGGTTCTGGTGAAGATGAT
ACAGATGTGGTCAACCTTGCGTTCGTTGAATCTCTATTAAACGCTGGTGC
TAGTATGAACTACCCTGATGTTTATGGTCAAAGTATTTTCTTTGCTGTAG
TACGTGACTGGCACATTGACGTCGCAAGGTTTGCCATTGAAAAAGGAGCC
GATGTGAACCATCGGGACCAGTACGGGAGAACACCGTTACATCTTGCAGC
TGCAGTCAATTATGAAGAAATGGTGGCATTTATTATTGCTAATGGAGCGG
ATATCACAGCCAAAACAGAGGGTGAAGAGCAGACACCTCTTCATTATGCA
GCACGATACGATTCAGTAGAAGCAATGAAAGTTTTGATACAAGCTGGTGC
TATGATCGATGGTGTAGATTTCTTAAATCGAACACCCTTACACGTGGCAG
CTGAAACAGGTAGTCACGAAGTTGTcaaatttttaatgaaacttGGTGCA
CCAACAGGTGTTTATGATTCGTTCGGTAATTCTGTCATGTTCATGATGAT
TGAAAAAATGCCACATCTGGCGTATGAAGGGTTGAACCAATTCTTTGTTG
AAGACAATGCTATGAGACGACGGTATTATTATCTGGACCATCTTGAGTTT
GATGTTAAATCAAATGTGTCATCGAAGAATGCTAGAAATGTTTTAGAGGC
CATAGTGATGTACAAAGAAGTAGACCTCATGATGCACCCGTCAATCAAAA
AGCTGTTGTCAATCAAATGGAAATTGTACGGTAAACGACGTGCAATCATT
AGTAACCTTGGAAACGTTTTTCACACTTTGTTAGCAACTATCCTTATCTT
TGCAATACCGTACCGGCCATATGATCAACAGTTTACACCGGTCAAAGATA
ATATCATATTTATCACCCTGGCTATGCTGTTCGTCGTACTTACCTTTTTC
TTTTGGATAAAACAAATCCTAACAATACGACTGCTGAACGCGAAAGACCA
AGCTTATAAAGAACACCGCTTTAATTACATCAAAAAACAATTACCTCATT
GTCATCCACGGTGGACAGAAGAAAAAGAgtttcttgaaaaagaaattgaa
agaatCAAAAGTTACAAATCAACATTCTGGCAAGATTACTGGAATATATT
TGAATGGGTTTCTCTACTTTTCGTTGTTATTATGTTCGCTCTACATATTA
CTAATATTGTATCACCGAATATGAAAGTTTACAGAGCAGCCAATTTTGTT
TCCGCCATCACGCTTCTTTTGGTTTGGTTCCGCTTGTACAAGACGTTGAG
GATTGCTCGATTCTTCTCTGAAATCAATGTATTGCTAACTAATGTTGCTT
TGGAGACATGCAGATTCGTGATTCTTTACATGGATTTATACATTCCCTAC
ATTTTCGTGTTTTTCATGTTATTTGGTGGCTCAACTAAATTgtttggaaa
tacaaagaaaaatatcGATGAAAATCATTTCGAATTGGAACAGTTTAGTG
ATGTGttatATTATGGCTGGTTGGTAATGCTTGGTAAACATTTCCCAGAG
GAAGGAGGTACAGCTGTCAATCATGTTGCACTCGAACTTTTTCTTGGTTC
CTACATTGTCATATCAACGCTTCTTGGCTTCATTTATATTGGACGTTTGT
CCGAATTGTTTTCACGTGTTTACAAGAAAGTCAACGCCAAATCANGCTTC
ATTTATATTGGACGCTTGTCCGAATTGTTTTCACGTGTTTATAAGAAAGT
CAACGCCAAATCAAATTTGTTAGTGGCTGGTGTTTTGGTGacagaagaaa
aatatttatctcaaaatcaattACGCGCCAATAAGAAACACATGAGAAGG
CTTTGTGGACCAATGGTTGTTCCGTTTGAGAGTAACAAAGGTGTAGAAGA
TGATGATCAAAACATTGGAATAGGAATCGAACATGTTACATCCAAAATTG
AAGATGTCACTAACTATCTAAgaaaagcAAATTTCCCACGTGAAGAAAGG
CAATCGATCAATGTAGACCAATTGACTGTTCTTGAAACTGAacttgaaag
aatatttcaaagtaTGTCTGAAAGCGAAAGACTGTTGacggaaaacaaag
aaaatgttaagacTGCGCAAACGAAAACCATTGATCTGATCAAAGAGACG
ATTGAAACACGAAAGACCAATGCGAACAGAAAGTAAATGCCTACTGCAGG
AGGAGCCAATAATAGCGGTGTTCGTGGCTTCTTTACAAATTTCGCCAATT
ACACTGGTGAAAAAGTATCCGAAGTGAAAGAACTTTTATTTGGAGTCAAC
ATTGATGATAGTGTTGAACTAGCATCTCTAACAAGTCGACAAAGTAATTC
ATTTCGTAGCCGAAATGGTGGTAATCATGATATATTAAAACGAAAAACAT
TAATTCCTGATGAACTACAACACGAGGATATTTACGAACAGTATGCAGAA
TACGATTGTTCTCGTAATCTTGTCGTAAGTTCGACGACGCTTTTTCGTAA
AGGCCCGATTCCGATCGAACATTTATCACATCAAGAACAGAATCGTCTTT
CAAAACGTGGTTGCTTGTTAGAGTGGAACGATGCACAACGTCAGACGTCT
GACAATCATCTACCTTACATTGACCCTAGTAGTAAGAGTTTGCTGACTTA
CTTTGCAAGGATGGGTTCTGGTGAAGATGATACAGATGTGGTCAACCTTG
CGTTCGTTGAATCTCTATTAAACGCTGGTGCTAGTATGAACTACCCTGAT
GTTTATGGTCAAAGTATTTTCTTTGCTGTAGTACGTGACTGGCACATTGA
CGTCGCAAGGTTTGCCATTGAAAAAGGAGCCGATGTGAACCATCGGGACC
AGTACGGGAGAACACCGTTACATCTTGCAGCTGCAGTCAATTATGAAGAA
ATGGTGGCATTTATTATTGCTAATGGAGCGGATATCACAGCCAAAACAGA
GGGTGAAGAGCAGACACCTCTTCATTATGCAGCACGATACGATTCAGTAG
AAGCAATGAAAGTTTTGATACAAGCTGGTGCTATGATCGATGGTGTAGAT
TTCTTAAATCGAACACCCTTACACGTGGCAGCTGAAACAGGTAGTCACGA
AGTTGTcaaatttttaatgaaacttGGTGCACCAACAGGTGTTTATGATT
CGTTCGGTAATTCTGTCATGTTCATGATGATTGAAAAAATGCCACATCTG
GCGTATGAAGGGTTGAACCAATTCTTTGTTGAAGACAATGCTATGAGACG
ACGGTATTATTATCTGGACCATCTTGAGTTTGATGTTAAATCAAATGTGT
CATCGAAGAATGCTAGAAATGTTTTAGAGGCCATAGTGATGTACAAAGAA
GTAGACCTCATGATGCACCCGTCAATCAAAAAGCTGTTGTCAATCAAATG
GAAATTGTACGGTAAACGACGTGCAATCATTAGTAACCTTGGAAACGTTT
TTCACACTTTGTTAGCAACTATCCTTATCTTTGCAATACCGTACCGGCCA
TATGATCAACAGTTTACACCGGTCAAAGATAATATCATATTTATCACCCT
GGCTATGCTGTTCGTCGTACTTACCTTTTTCTTTTGGATAAAACAAATCC
TAACAATACGACTGCTGAACGCGAAAGACCAAGCTTATAAAGAACACCGC
TTTAATTACATCAAAAAACAATTACCTCATTGTCATCCACGGTGGACAGA
AGAAAAAGAgtttcttgaaaaagaaattgaaagaatCAAAAGTTACAAAT
CAACATTCTGGCAAGATTACTGGAATATATTTGAATGGGTTTCTCTACTT
TTCGTTGTTATTATGTTCGCTCTACATATTACTAATATTGTATCACCGAA
TATGAAAGTTTACAGAGCAGCCAATTTTGTTTCCGCCATCACGCTTCTTT
TGGTTTGGTTCCGCTTGTACAAGACGTTGAGGATTGCTCGATTCTTCTCT
GAAATCAATGTATTGCTAACTAATGTTGCTTTGGAGACATGCAGATTCGT
GATTCTTTACATGGATTTATACATTCCCTACATTTTCGTGTTTTTCATGT
TATTTGGTGGCTCAACTAAATTgtttggaaatacaaagaaaaatatcGAT
GAAAATCATTTCGAATTGGAACAGTTTAGTGATGTGttatATTATGGCTG
GTTGGTAATGCTTGGTAAACATTTCCCAGAGGAAGGAGGTACAGCTGTCA
ATCATGTTGCACTCGAACTTTTTCTTGGTTCCTACATTGTCATATCAACG
CTTCTTGGCTTCATTTATATTGGACGTTTGTCCGAATTGTTTTCACGTGT
TTACAAGAAAGTCAACGCCAAATCANGCTTCATTTATATTGGACGCTTGT
CCGAATTGTTTTCACGTGTTTATAAGAAAGTCAACGCCAAATCAAATTTG
TTAGTGGCTGGTGTTTTGGTGacagaagaaaaatatttatctcaaaatca
attACGCGCCAATAAGAAACACATGAGAAGGCTTTGTGGACCAATGGTTG
TTCCGTTTGAGAGTAACAAAGGTGTAGAAGATGATGATCAAAACATTGGA
ATAGGAATCGAACATGTTACATCCAAAATTGAAGATGTCACTAACTATCT
AAgaaaagcAAATTTCCCACGTGAAGAAAGGCAATCGATCAATGTAGACC
AATTGACTGTTCTTGAAACTGAacttgaaagaatatttcaaagtaTGTCT
GAAAGCGAAAGACTGTTGacggaaaacaaagaaaatgttaagacTGCGCA
AACGAAAACCATTGATCTGATCAAAGAGACGATTGAAACACGAAAGACCA
ATGCGAACAGAAAGTAAATGCCTACTGCAGGAGGAGCCAATAATAGCGGT
GTTCGTGGCTTCTTTACAAATTTCGCCAATTACACTGGTGAAAAAGTATC
CGAAGTGAAAGAACTTTTATTTGGAGTCAACATTGATGATAGTGTTGAAC
TAGCATCTCTAACAAGTCGACAAAGTAATTCATTTCGTAGCCGAAATGGT
GGTAATCATGATATATTAAAACGAAAAACATTAATTCCTGATGAACTACA
ACACGAGGATATTTACGAACAGTATGCAGAATACGATTGTTCTCGTAATC
TTGTCGTAAGTTCGACGACGCTTTTTCGTAAAGGCCCGATTCCGATCGAA
CATTTATCACATCAAGAACAGAATCGTCTTTCAAAACGTGGTTGCTTGTT
AGAGTGGAACGATGCACAACGTCAGACGTCTGACAATCATCTACCTTACA
TTGACCCTAGTAGTAAGAGTTTGCTGACTTACTTTGCAAGGATGGGTTCT
GGTGAAGATGATACAGATGTGGTCAACCTTGCGTTCGTTGAATCTCTATT
AAACGCTGGTGCTAGTATGAACTACCCTGATGTTTATGGTCAAAGTATTT
TCTTTGCTGTAGTACGTGACTGGCACATTGACGTCGCAAGGTTTGCCATT
GAAAAAGGAGCCGATGTGAACCATCGGGACCAGTACGGGAGAACACCGTT
ACATCTTGCAGCTGCAGTCAATTATGAAGAAATGGTGGCATTTATTATTG
CTAATGGAGCGGATATCACAGCCAAAACAGAGGGTGAAGAGCAGACACCT
CTTCATTATGCAGCACGATACGATTCAGTAGAAGCAATGAAAGTTTTGAT
ACAAGCTGGTGCTATGATCGATGGTGTAGATTTCTTAAATCGAACACCCT
TACACGTGGCAGCTGAAACAGGTAGTCACGAAGTTGTcaaatttttaatg
aaacttGGTGCACCAACAGGTGTTTATGATTCGTTCGGTAATTCTGTCAT
GTTCATGATGATTGAAAAAATGCCACATCTGGCGTATGAAGGGTTGAACC
AATTCTTTGTTGAAGACAATGCTATGAGACGACGGTATTATTATCTGGAC
CATCTTGAGTTTGATGTTAAATCAAATGTGTCATCGAAGAATGCTAGAAA
TGTTTTAGAGGCCATAGTGATGTACAAAGAAGTAGACCTCATGATGCACC
CGTCAATCAAAAAGCTGTTGTCAATCAAATGGAAATTGTACGGTAAACGA
CGTGCAATCATTAGTAACCTTGGAAACGTTTTTCACACTTTGTTAGCAAC
TATCCTTATCTTTGCAATACCGTACCGGCCATATGATCAACAGTTTACAC
CGGTCAAAGATAATATCATATTTATCACCCTGGCTATGCTGTTCGTCGTA
CTTACCTTTTTCTTTTGGATAAAACAAATCCTAACAATACGACTGCTGAA
CGCGAAAGACCAAGCTTATAAAGAACACCGCTTTAATTACATCAAAAAAC
AATTACCTCATTGTCATCCACGGTGGACAGAAGAAAAAGAgtttcttgaa
aaagaaattgaaagaatCAAAAGTTACAAATCAACATTCTGGCAAGATTA
CTGGAATATATTTGAATGGGTTTCTCTACTTTTCGTTGTTATTATGTTCG
CTCTACATATTACTAATATTGTATCACCGAATATGAAAGTTTACAGAGCA
GCCAATTTTGTTTCCGCCATCACGCTTCTTTTGGTTTGGTTCCGCTTGTA
CAAGACGTTGAGGATTGCTCGATTCTTCTCTGAAATCAATGTATTGCTAA
CTAATGTTGCTTTGGAGACATGCAGATTCGTGATTCTTTACATGGATTTA
TACATTCCCTACATTTTCGTGTTTTTCATGTTATTTGGTGGCTCAACTAA
ATTgtttggaaatacaaagaaaaatatcGATGAAAATCATTTCGAATTGG
AACAGTTTAGTGATGTGttatATTATGGCTGGTTGGTAATGCTTGGTAAA
CATTTCCCAGAGGAAGGAGGTACAGCTGTCAATCATGTTGCACTCGAACT
TTTTCTTGGTTCCTACATTGTCATATCAACGCTTCTTGGCTTCATTTATA
TTGGACGTTTGTCCGAATTGTTTTCACGTGTTTACAAGAAAGTCAACGCC
AAATCANGCTTCATTTATATTGGACGCTTGTCCGAATTGTTTTCACGTGT
TTATAAGAAAGTCAACGCCAAATCAAATTTGTTAGTGGCTGGTGTTTTGG
TGacagaagaaaaatatttatctcaaaatcaattACGCGCCAATAAGAAA
CACATGAGAAGGCTTTGTGGACCAATGGTTGTTCCGTTTGAGAGTAACAA
AGGTGTAGAAGATGATGATCAAAACATTGGAATAGGAATCGAACATGTTA
CATCCAAAATTGAAGATGTCACTAACTATCTAAgaaaagcAAATTTCCCA
CGTGAAGAAAGGCAATCGATCAATGTAGACCAATTGACTGTTCTTGAAAC
TGAacttgaaagaatatttcaaagtaTGTCTGAAAGCGAAAGACTGTTGa
cggaaaacaaagaaaatgttaagacTGCGCAAACGAAAACCATTGATCTG
ATCAAAGAGACGATTGAAACACGAAAGACCAATGCGAACAGAAAGTAAAT
GCCTACTGCAGGAGGAGCCAATAATAGCGGTGTTCGTGGCTTCTTTACAA
ATTTCGCCAATTACACTGGTGAAAAAGTATCCGAAGTGAAAGAACTTTTA
TTTGGAGTCAACATTGATGATAGTGTTGAACTAGCATCTCTAACAAGTCG
ACAAAGTAATTCATTTCGTAGCCGAAATGGTGGTAATCATGATATATTAA
AACGAAAAACATTAATTCCTGATGAACTACAACACGAGGATATTTACGAA
CAGTATGCAGAATACGATTGTTCTCGTAATCTTGTCGTAAGTTCGACGAC
GCTTTTTCGTAAAGGCCCGATTCCGATCGAACATTTATCACATCAAGAAC
AGAATCGTCTTTCAAAACGTGGTTGCTTGTTAGAGTGGAACGATGCACAA
CGTCAGACGTCTGACAATCATCTACCTTACATTGACCCTAGTAGTAAGAG
TTTGCTGACTTACTTTGCAAGGATGGGTTCTGGTGAAGATGATACAGATG
TGGTCAACCTTGCGTTCGTTGAATCTCTATTAAACGCTGGTGCTAGTATG
AACTACCCTGATGTTTATGGTCAAAGTATTTTCTTTGCTGTAGTACGTGA
CTGGCACATTGACGTCGCAAGGTTTGCCATTGAAAAAGGAGCCGATGTGA
ACCATCGGGACCAGTACGGGAGAACACCGTTACATCTTGCAGCTGCAGTC
AATTATGAAGAAATGGTGGCATTTATTATTGCTAATGGAGCGGATATCAC
AGCCAAAACAGAGGGTGAAGAGCAGACACCTCTTCATTATGCAGCACGAT
ACGATTCAGTAGAAGCAATGAAAGTTTTGATACAAGCTGGTGCTATGATC
GATGGTGTAGATTTCTTAAATCGAACACCCTTACACGTGGCAGCTGAAAC
AGGTAGTCACGAAGTTGTcaaatttttaatgaaacttGGTGCACCAACAG
GTGTTTATGATTCGTTCGGTAATTCTGTCATGTTCATGATGATTGAAAAA
ATGCCACATCTGGCGTATGAAGGGTTGAACCAATTCTTTGTTGAAGACAA
TGCTATGAGACGACGGTATTATTATCTGGACCATCTTGAGTTTGATGTTA
AATCAAATGTGTCATCGAAGAATGCTAGAAATGTTTTAGAGGCCATAGTG
ATGTACAAAGAAGTAGACCTCATGATGCACCCGTCAATCAAAAAGCTGTT
GTCAATCAAATGGAAATTGTACGGTAAACGACGTGCAATCATTAGTAACC
TTGGAAACGTTTTTCACACTTTGTTAGCAACTATCCTTATCTTTGCAATA
CCGTACCGGCCATATGATCAACAGTTTACACCGGTCAAAGATAATATCAT
ATTTATCACCCTGGCTATGCTGTTCGTCGTACTTACCTTTTTCTTTTGGA
TAAAACAAATCCTAACAATACGACTGCTGAACGCGAAAGACCAAGCTTAT
AAAGAACACCGCTTTAATTACATCAAAAAACAATTACCTCATTGTCATCC
ACGGTGGACAGAAGAAAAAGAgtttcttgaaaaagaaattgaaagaatCA
AAAGTTACAAATCAACATTCTGGCAAGATTACTGGAATATATTTGAATGG
GTTTCTCTACTTTTCGTTGTTATTATGTTCGCTCTACATATTACTAATAT
TGTATCACCGAATATGAAAGTTTACAGAGCAGCCAATTTTGTTTCCGCCA
TCACGCTTCTTTTGGTTTGGTTCCGCTTGTACAAGACGTTGAGGATTGCT
CGATTCTTCTCTGAAATCAATGTATTGCTAACTAATGTTGCTTTGGAGAC
ATGCAGATTCGTGATTCTTTACATGGATTTATACATTCCCTACATTTTCG
TGTTTTTCATGTTATTTGGTGGCTCAACTAAATTgtttggaaatacaaag
aaaaatatcGATGAAAATCATTTCGAATTGGAACAGTTTAGTGATGTGtt
atATTATGGCTGGTTGGTAATGCTTGGTAAACATTTCCCAGAGGAAGGAG
GTACAGCTGTCAATCATGTTGCACTCGAACTTTTTCTTGGTTCCTACATT
GTCATATCAACGCTTCTTGGCTTCATTTATATTGGACGTTTGTCCGAATT
GTTTTCACGTGTTTACAAGAAAGTCAACGCCAAATCANGCTTCATTTATA
TTGGACGCTTGTCCGAATTGTTTTCACGTGTTTATAAGAAAGTCAACGCC
AAATCAAATTTGTTAGTGGCTGGTGTTTTGGTGacagaagaaaaatattt
atctcaaaatcaattACGCGCCAATAAGAAACACATGAGAAGGCTTTGTG
GACCAATGGTTGTTCCGTTTGAGAGTAACAAAGGTGTAGAAGATGATGAT
CAAAACATTGGAATAGGAATCGAACATGTTACATCCAAAATTGAAGATGT
CACTAACTATCTAAgaaaagcAAATTTCCCACGTGAAGAAAGGCAATCGA
TCAATGTAGACCAATTGACTGTTCTTGAAACTGAacttgaaagaatattt
caaagtaTGTCTGAAAGCGAAAGACTGTTGacggaaaacaaagaaaatgt
taagacTGCGCAAACGAAAACCATTGATCTGATCAAAGAGACGATTGAAA
CACGAAAGACCAATGCGAACAGAAAGTAAATGCCTACTGCAGGAGGAGCC
AATAATAGCGGTGTTCGTGGCTTCTTTACAAATTTCGCCAATTACACTGG
TGAAAAAGTATCCGAAGTGAAAGAACTTTTATTTGGAGTCAACATTGATG
ATAGTGTTGAACTAGCATCTCTAACAAGTCGACAAAGTAATTCATTTCGT
AGCCGAAATGGTGGTAATCATGATATATTAAAACGAAAAACATTAATTCC
TGATGAACTACAACACGAGGATATTTACGAACAGTATGCAGAATACGATT
GTTCTCGTAATCTTGTCGTAAGTTCGACGACGCTTTTTCGTAAAGGCCCG
ATTCCGATCGAACATTTATCACATCAAGAACAGAATCGTCTTTCAAAACG
TGGTTGCTTGTTAGAGTGGAACGATGCACAACGTCAGACGTCTGACAATC
ATCTACCTTACATTGACCCTAGTAGTAAGAGTTTGCTGACTTACTTTGCA
AGGATGGGTTCTGGTGAAGATGATACAGATGTGGTCAACCTTGCGTTCGT
TGAATCTCTATTAAACGCTGGTGCTAGTATGAACTACCCTGATGTTTATG
GTCAAAGTATTTTCTTTGCTGTAGTACGTGACTGGCACATTGACGTCGCA
AGGTTTGCCATTGAAAAAGGAGCCGATGTGAACCATCGGGACCAGTACGG
GAGAACACCGTTACATCTTGCAGCTGCAGTCAATTATGAAGAAATGGTGG
CATTTATTATTGCTAATGGAGCGGATATCACAGCCAAAACAGAGGGTGAA
GAGCAGACACCTCTTCATTATGCAGCACGATACGATTCAGTAGAAGCAAT
GAAAGTTTTGATACAAGCTGGTGCTATGATCGATGGTGTAGATTTCTTAA
ATCGAACACCCTTACACGTGGCAGCTGAAACAGGTAGTCACGAAGTTGTc
aaatttttaatgaaacttGGTGCACCAACAGGTGTTTATGATTCGTTCGG
TAATTCTGTCATGTTCATGATGATTGAAAAAATGCCACATCTGGCGTATG
AAGGGTTGAACCAATTCTTTGTTGAAGACAATGCTATGAGACGACGGTAT
TATTATCTGGACCATCTTGAGTTTGATGTTAAATCAAATGTGTCATCGAA
GAATGCTAGAAATGTTTTAGAGGCCATAGTGATGTACAAAGAAGTAGACC
TCATGATGCACCCGTCAATCAAAAAGCTGTTGTCAATCAAATGGAAATTG
TACGGTAAACGACGTGCAATCATTAGTAACCTTGGAAACGTTTTTCACAC
TTTGTTAGCAACTATCCTTATCTTTGCAATACCGTACCGGCCATATGATC
AACAGTTTACACCGGTCAAAGATAATATCATATTTATCACCCTGGCTATG
CTGTTCGTCGTACTTACCTTTTTCTTTTGGATAAAACAAATCCTAACAAT
ACGACTGCTGAACGCGAAAGACCAAGCTTATAAAGAACACCGCTTTAATT
ACATCAAAAAACAATTACCTCATTGTCATCCACGGTGGACAGAAGAAAAA
GAgtttcttgaaaaagaaattgaaagaatCAAAAGTTACAAATCAACATT
CTGGCAAGATTACTGGAATATATTTGAATGGGTTTCTCTACTTTTCGTTG
TTATTATGTTCGCTCTACATATTACTAATATTGTATCACCGAATATGAAA
GTTTACAGAGCAGCCAATTTTGTTTCCGCCATCACGCTTCTTTTGGTTTG
GTTCCGCTTGTACAAGACGTTGAGGATTGCTCGATTCTTCTCTGAAATCA
ATGTATTGCTAACTAATGTTGCTTTGGAGACATGCAGATTCGTGATTCTT
TACATGGATTTATACATTCCCTACATTTTCGTGTTTTTCATGTTATTTGG
TGGCTCAACTAAATTgtttggaaatacaaagaaaaatatcGATGAAAATC
ATTTCGAATTGGAACAGTTTAGTGATGTGttatATTATGGCTGGTTGGTA
ATGCTTGGTAAACATTTCCCAGAGGAAGGAGGTACAGCTGTCAATCATGT
TGCACTCGAACTTTTTCTTGGTTCCTACATTGTCATATCAACGCTTCTTG
GCTTCATTTATATTGGACGTTTGTCCGAATTGTTTTCACGTGTTTACAAG
AAAGTCAACGCCAAATCANGCTTCATTTATATTGGACGCTTGTCCGAATT
GTTTTCACGTGTTTATAAGAAAGTCAACGCCAAATCAAATTTGTTAGTGG
CTGGTGTTTTGGTGacagaagaaaaatatttatctcaaaatcaattACGC
GCCAATAAGAAACACATGAGAAGGCTTTGTGGACCAATGGTTGTTCCGTT
TGAGAGTAACAAAGGTGTAGAAGATGATGATCAAAACATTGGAATAGGAA
TCGAACATGTTACATCCAAAATTGAAGATGTCACTAACTATCTAAgaaaa
gcAAATTTCCCACGTGAAGAAAGGCAATCGATCAATGTAGACCAATTGAC
TGTTCTTGAAACTGAacttgaaagaatatttcaaagtaTGTCTGAAAGCG
AAAGACTGTTGacggaaaacaaagaaaatgttaagacTGCGCAAACGAAA
ACCATTGATCTGATCAAAGAGACGATTGAAACACGAAAGACCAATGCGAA
CAGAAAGTAAATGCCTACTGCAGGAGGAGCCAATAATAGCGGTGTTCGTG
GCTTCTTTACAAATTTCGCCAATTACACTGGTGAAAAAGTATCCGAAGTG
AAAGAACTTTTATTTGGAGTCAACATTGATGATAGTGTTGAACTAGCATC
TCTAACAAGTCGACAAAGTAATTCATTTCGTAGCCGAAATGGTGGTAATC
ATGATATATTAAAACGAAAAACATTAATTCCTGATGAACTACAACACGAG
GATATTTACGAACAGTATGCAGAATACGATTGTTCTCGTAATCTTGTCGT
AAGTTCGACGACGCTTTTTCGTAAAGGCCCGATTCCGATCGAACATTTAT
CACATCAAGAACAGAATCGTCTTTCAAAACGTGGTTGCTTGTTAGAGTGG
AACGATGCACAACGTCAGACGTCTGACAATCATCTACCTTACATTGACCC
TAGTAGTAAGAGTTTGCTGACTTACTTTGCAAGGATGGGTTCTGGTGAAG
ATGATACAGATGTGGTCAACCTTGCGTTCGTTGAATCTCTATTAAACGCT
GGTGCTAGTATGAACTACCCTGATGTTTATGGTCAAAGTATTTTCTTTGC
TGTAGTACGTGACTGGCACATTGACGTCGCAAGGTTTGCCATTGAAAAAG
GAGCCGATGTGAACCATCGGGACCAGTACGGGAGAACACCGTTACATCTT
GCAGCTGCAGTCAATTATGAAGAAATGGTGGCATTTATTATTGCTAATGG
AGCGGATATCACAGCCAAAACAGAGGGTGAAGAGCAGACACCTCTTCATT
ATGCAGCACGATACGATTCAGTAGAAGCAATGAAAGTTTTGATACAAGCT
GGTGCTATGATCGATGGTGTAGATTTCTTAAATCGAACACCCTTACACGT
GGCAGCTGAAACAGGTAGTCACGAAGTTGTcaaatttttaatgaaacttG
GTGCACCAACAGGTGTTTATGATTCGTTCGGTAATTCTGTCATGTTCATG
ATGATTGAAAAAATGCCACATCTGGCGTATGAAGGGTTGAACCAATTCTT
TGTTGAAGACAATGCTATGAGACGACGGTATTATTATCTGGACCATCTTG
AGTTTGATGTTAAATCAAATGTGTCATCGAAGAATGCTAGAAATGTTTTA
GAGGCCATAGTGATGTACAAAGAAGTAGACCTCATGATGCACCCGTCAAT
CAAAAAGCTGTTGTCAATCAAATGGAAATTGTACGGTAAACGACGTGCAA
TCATTAGTAACCTTGGAAACGTTTTTCACACTTTGTTAGCAACTATCCTT
ATCTTTGCAATACCGTACCGGCCATATGATCAACAGTTTACACCGGTCAA
AGATAATATCATATTTATCACCCTGGCTATGCTGTTCGTCGTACTTACCT
TTTTCTTTTGGATAAAACAAATCCTAACAATACGACTGCTGAACGCGAAA
GACCAAGCTTATAAAGAACACCGCTTTAATTACATCAAAAAACAATTACC
TCATTGTCATCCACGGTGGACAGAAGAAAAAGAgtttcttgaaaaagaaa
ttgaaagaatCAAAAGTTACAAATCAACATTCTGGCAAGATTACTGGAAT
ATATTTGAATGGGTTTCTCTACTTTTCGTTGTTATTATGTTCGCTCTACA
TATTACTAATATTGTATCACCGAATATGAAAGTTTACAGAGCAGCCAATT
TTGTTTCCGCCATCACGCTTCTTTTGGTTTGGTTCCGCTTGTACAAGACG
TTGAGGATTGCTCGATTCTTCTCTGAAATCAATGTATTGCTAACTAATGT
TGCTTTGGAGACATGCAGATTCGTGATTCTTTACATGGATTTATACATTC
CCTACATTTTCGTGTTTTTCATGTTATTTGGTGGCTCAACTAAATTgttt
ggaaatacaaagaaaaatatcGATGAAAATCATTTCGAATTGGAACAGTT
TAGTGATGTGttatATTATGGCTGGTTGGTAATGCTTGGTAAACATTTCC
CAGAGGAAGGAGGTACAGCTGTCAATCATGTTGCACTCGAACTTTTTCTT
GGTTCCTACATTGTCATATCAACGCTTCTTGGCTTCATTTATATTGGACG
TTTGTCCGAATTGTTTTCACGTGTTTACAAGAAAGTCAACGCCAAATCAN
GCTTCATTTATATTGGACGCTTGTCCGAATTGTTTTCACGTGTTTATAAG
AAAGTCAACGCCAAATCAAATTTGTTAGTGGCTGGTGTTTTGGTGacaga
agaaaaatatttatctcaaaatcaattACGCGCCAATAAGAAACACATGA
GAAGGCTTTGTGGACCAATGGTTGTTCCGTTTGAGAGTAACAAAGGTGTA
GAAGATGATGATCAAAACATTGGAATAGGAATCGAACATGTTACATCCAA
AATTGAAGATGTCACTAACTATCTAAgaaaagcAAATTTCCCACGTGAAG
AAAGGCAATCGATCAATGTAGACCAATTGACTGTTCTTGAAACTGAactt
gaaagaatatttcaaagtaTGTCTGAAAGCGAAAGACTGTTGacggaaaa
caaagaaaatgttaagacTGCGCAAACGAAAACCATTGATCTGATCAAAG
AGACGATTGAAACACGAAAGACCAATGCGAACAGAAAGTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000720XLOC_000720Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001334-proteinTCONS_00001334-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001334-exon-sc0000010-1491911889:172492..173674TCONS_00001334-exon-sc0000010-1491911889:172492..173674Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:172492..173674TCONS_00001334-exon-sc0000010-1510915933:172492..173674Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:172492..173674TCONS_00001334-exon-sc0000010-1575043694:172492..173674Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1491911889:187001..187269TCONS_00001334-exon-sc0000010-1491911889:187001..187269Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:187001..187269TCONS_00001334-exon-sc0000010-1510915933:187001..187269Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:187001..187269TCONS_00001334-exon-sc0000010-1575043694:187001..187269Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1491911889:187947..188108TCONS_00001334-exon-sc0000010-1491911889:187947..188108Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:187947..188108TCONS_00001334-exon-sc0000010-1510915933:187947..188108Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:187947..188108TCONS_00001334-exon-sc0000010-1575043694:187947..188108Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1491911889:188963..189201TCONS_00001334-exon-sc0000010-1491911889:188963..189201Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:188963..189201TCONS_00001334-exon-sc0000010-1510915933:188963..189201Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:188963..189201TCONS_00001334-exon-sc0000010-1575043694:188963..189201Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1491911889:189814..190077TCONS_00001334-exon-sc0000010-1491911889:189814..190077Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:189814..190077TCONS_00001334-exon-sc0000010-1510915933:189814..190077Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:189814..190077TCONS_00001334-exon-sc0000010-1575043694:189814..190077Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1491911889:192035..192410TCONS_00001334-exon-sc0000010-1491911889:192035..192410Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:192035..192410TCONS_00001334-exon-sc0000010-1510915933:192035..192410Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:192035..192410TCONS_00001334-exon-sc0000010-1575043694:192035..192410Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1491911889:193293..193459TCONS_00001334-exon-sc0000010-1491911889:193293..193459Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:193293..193459TCONS_00001334-exon-sc0000010-1510915933:193293..193459Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:193293..193459TCONS_00001334-exon-sc0000010-1575043694:193293..193459Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1491911889:194043..194402TCONS_00001334-exon-sc0000010-1491911889:194043..194402Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:194043..194402TCONS_00001334-exon-sc0000010-1510915933:194043..194402Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:194043..194402TCONS_00001334-exon-sc0000010-1575043694:194043..194402Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1491911889:194656..194761TCONS_00001334-exon-sc0000010-1491911889:194656..194761Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:194656..194761TCONS_00001334-exon-sc0000010-1510915933:194656..194761Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:194656..194761TCONS_00001334-exon-sc0000010-1575043694:194656..194761Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1491911889:196145..196321TCONS_00001334-exon-sc0000010-1491911889:196145..196321Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:196145..196321TCONS_00001334-exon-sc0000010-1510915933:196145..196321Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:196145..196321TCONS_00001334-exon-sc0000010-1575043694:196145..196321Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1491911889:197817..198180TCONS_00001334-exon-sc0000010-1491911889:197817..198180Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1510915933:197817..198180TCONS_00001334-exon-sc0000010-1510915933:197817..198180Clytia hemisphaericaexon
TCONS_00001334-exon-sc0000010-1575043694:197817..198180TCONS_00001334-exon-sc0000010-1575043694:197817..198180Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:172492..198180 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
5.49915 5.15244 63.4723 76.0993 77.5074 55.5731 35.8778 37.1324 14.8531 19.9293 11.0388 11.6022 9.71645 8.99228 7.7599 6.53951 10.798 9.76506 8.68133 9.76914 4.53325 4.29652 6.06995 7.65741 5.761 6.34092 6.99178 6.32077 2.47106 2.97009
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR005821Ion_trans_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
GO:0006811ion transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006811 ion transport
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016020 membrane
molecular_function GO:0005216 ion channel activity
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00001334 vs. Swiss-Prot (Human)
Match: ANR28 (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5)

HSP 1 Score: 88.5817 bits (218), Expect = 1.347e-17
Identity = 53/157 (33.76%), Postives = 85/157 (54.14%), Query Frame = 3
Query: 1221 LAFVESLLNAGASMNYPDVYGQSIFFAVVRDWHIDVARFAIEKGADVNHRDQYGRTPLHLAAAVNYEEM-VAFIIANGADITAKTEGEEQTPLHYAARYDSVEAMKVLIQAGAMIDGVDFLNRTPLHVAAETGSHEVVKFLMKLGAPT---GVYDSF 1679
            ++ V+ LL+ G  MN P+ YG +       +    V    I+ GA VN +++ G TPLH AAA  +  + +  ++ NGAD+  K++ + +TPLH  A +      + +IQ+GA+ID  D    TPLH+AA  G   ++  L+  GA T   G++  F
Sbjct:  219 ISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSK-DGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMF 374          
The following BLAST results are available for this feature:
BLAST of TCONS_00001334 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ANR281.347e-1733.76Serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top