Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001180 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001180
Unique NameTCONS_00001180
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1191

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001180 ID=TCONS_00001180|Name=TCONS_00001180|organism=Clytia hemisphaerica|type=transcript|length=1191bp
CGCTTTGATTCATGCAAGGACAAAGGTAGTTGCCAAGTTTGCATGAAGGA
AGCACAAGTACAGAGAAGACGTGGTGAAAAATAACATTTATATAACCAAG
TGAAAGTAGAGAAGGAAAATTTTTGATCAACATGTACGATCATAAGAAGT
TGAGCAATCAACTAGAAACTTTATCCAATAATAATATGAACGCAAAGAAA
CCCATTCGAATTGTGGTTCTTGGACAGTGTGGTGTTGGGAAAACAGCATT
GGTTTCGAGATGTTTACAAAATACGTTTCCACAAGACTCTTCATCGGGTA
AAGACATTTCACATCGATACAACATGacaatcaataaaaagaaaaccgTT
TGTCTCGATATTGTCGATTTCAACGATAAAAACGACGCACTTATCAGTTG
TGCAGATGCTTTTATTATTTGTTACGCGATAAACGATCGAAAAAGTTTCG
AAGCTATCGATGCTTATTTGGACAAAATTGTCGAGGCTAATATAAAAAGT
CCTAAAATTGGAATTGTTGGAAATAAAATTGACTTGTATAATGATAGAGA
GGTAGCGTCAACAGAAGGACTCGAACTAGCGAAAGAAATTAACAGTCTAT
TTTATGAAACGTCAGCTAAAGTTCCCGTTATAGATGTGCGTCAAGTGTTT
TATGATTTATATCAATCTTTAAAGAACGCTAAACGATCCAAGAAAGGTAA
AAGAGGAAGTATTGAACTTGAATCTTCAGACGTTTTCAGTCTACTGAACT
ATTCCATTATTAATAATTCGGGCGTCATTGGGCGGTCATCAAACAGCAGT
TGTTTCTCAGCTTTACTTAGCGCCCGAAGGAAAAAGTCGCCGCCACCATT
ATTTGGACGAAGCTGGTCGTCAGAAAGTGTTTAATTGTTAATTGGttgat
tttctgatttaaaCGGTCATGTTTTGGCAATTGCTTAGCAGACTGACTGT
CTATCAAAATAATTACACATACATAACCTTCTAaccttgattttgttttg
atttgttccAATTTGAGGATGGTTACctaatatatctttttttgtttttg
ttgatttttaaatttaaaaaagaaatatagaaTTTTATTAACGGTTTATA
AAAGACATTTAATTTTTTGTGTAAATAACAGAGTTAATATTTATTTATCg
gtattttatatatatatattcacGAAGAAATAAAAAGACAT
Run BLAST on NCBI

protein sequence of TCONS_00001180-protein

>TCONS_00001180-protein ID=TCONS_00001180-protein|Name=TCONS_00001180-protein|organism=Clytia hemisphaerica|type=polypeptide|length=250bp
MYDHKKLSNQLETLSNNNMNAKKPIRIVVLGQCGVGKTALVSRCLQNTFP
QDSSSGKDISHRYNMTINKKKTVCLDIVDFNDKNDALISCADAFIICYAI
NDRKSFEAIDAYLDKIVEANIKSPKIGIVGNKIDLYNDREVASTEGLELA
KEINSLFYETSAKVPVIDVRQVFYDLYQSLKNAKRSKKGKRGSIELESSD
VFSLLNYSIINNSGVIGRSSNSSCFSALLSARRKKSPPPLFGRSWSSESV
Run BLAST on NCBI

transcript from alignment at sc0000007:716277..721749-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001180 ID=TCONS_00001180|Name=TCONS_00001180|organism=Clytia hemisphaerica|type=transcript|length=5473bp|location=Sequence derived from alignment at sc0000007:716277..721749- (Clytia hemisphaerica)
CGCTTTGATTCATGCAAGGACAAAGGTAGTTGCCAAGTTTGCATGAAGGT AAGTTTATTTTATATTCTCATTAAGGCTTTCCCCTCACGAACTGACATAT TAAAGTTTTTTTCTGGAAAGTTCCATGTAGATAATTATGTAGAAGGATAT AACATGTGTAATTTTCATACTCTGACTCATCAATATATCAGTAGTAGTGT CTCCAATATTCTTTATCGGTTCTTTGAAGGTCTTACTTTGCCTTACGTTC TACGTTTAATGCATTTAAACAGATTGTAAAAGATTTTGTTCTTGCAAAAA CCCTAAATCCAAAAACCCCTCGTTGAGATTACTGTAAACAAAGTTTGGCC AGAATTTCATCATAAATTGCTTTGTGAATAAACATTGTTTTTGAATGAAT GGAATTTTAAAGAAAATTCTAGGGCCGTTGAAATTTATTTTAAATTTCGA TCGAACAACTTCTTTAAGCTGTAACACAAACAAGAGTTTAAAGCCTACGC ACGGAAACACGAAACAAAAACCTAACCAAACCAAACCTTGACGCCCCCAC CCCATTTCCTTATGATGGTTTTATTACAATCTTTAACCATAATTAGCTGA TTGTAATTTTCTTTTAACGTTGGGTCTTTAAATTACTATATCACTTTAAT TTTGCAAAATGTACTTAATTAGCAGTTGCTAATTGTTTTGGTTGTTCTTA CTATAAAAGACGAAGACAAACATTATACTTATTCAGATTTGAAGGATTAG AGTGAAATTAATTAAGTTTGAAGCATTTTAGACGCCTTAAAATCTGTCTG AAACTCTTTTCGTGCAAGATCAAGATTTCCGTTACGACAGACAGACATAT GTCAGATTACTCAATATAGCGTTTCCGACATCTTTACTTTTTGTCAATGA CAAATTCTGTTTTTGAATGATAAGGACTTGTCATGGCTATTGTGAAGCCT TTGTTAAAATGTATGGAGTCATGTAGTGTTCTTTTTAGGTAAATTTAGAA TAGCTTGTAGGAGTCTAGCCGCTTTCTCTGAAAATAAACTGGACTGGCTC GTGTAGCCCACTCAACTAACAGAGTCGCTTTCAGGCTACATAGCAACTGA ATAACCCTATCATTTCTTTTTGAAGACTCAATTCGAAGTTTCATAAAATT GACAATGGCCAAGATCCGAAACTGAAATACTTACTGGGATGAAATTTATA AGCCGTGCTCTCTCTCGAAAAAGTTGCATGGAACTGTATAGTAAGCTGAT ATCAAATGTTTTAGATTTGACAGGCCTGCCCGACTTATTTTAGCTGTGTG AATATTTATGAAATTCGAGAGGAGGTTTGAAAAGTGAGACGGGAAAACTT GGTGGTCGATATCATACCACTATTTTAGATTTTACCATATTTGTCAAAAT AAAAGAAACTGCTTACTTTTGTTGTTTGTAGTAGTATAGAATTTACAACA TGAGACTTTCATCTGTTTATCATGCTCAGCTACACCTCCTTCATGTGGAG TTGAACCTTTATATAGTTTTCTAATGGGGAGTGTATCAATCGAATTTCAT TCCCTGCTATCTTTTGTCTAAACAACTCTGTTGGTAAGCTTTGTGCTGTG CTGGAGTGTAGGATGGAAGAACGCGAAGGTTGTCCTTTCACCATTATCCT TTCTCAAACCCCAAAAACAAAATATTTCATTTTATTTATCATCCTTTTTC TTGGCAATACTTTGAAAGTTTATCAAACTCCGGAAAAGCCACTTTAAGCC CTATCATCAAGAGCACCCATTGTATTTTATTGAGCAAGAATTTTTCTTTT CAAGTATTCTTGTCTAAAGTTATGATGGTTTTTCCTAGATGACGTTTTTA CAACTTCTCAAGCAACGTAATAGACGACGTAATACAACATTTTTGATTTC TTTCCCATCATAATACAAGATCGTCGTGAATTCGATTATGTATTTAGTCC ACATTCTTTCCCTAGCAAGAGCGAATAATTAAGATNTTCTTTTCCATCAT AATACAAGATGGTCGTAAATTCGATTATGTATTTAGTCCACTTTCTTTCC CTAGCAAGAGCGAATAATGAAGAATAATGATTATTTAGCAGTAATTTCTC CTCAATTATTTTATGGATTATTATGTAATGTCGCAATATTAACTCTCACT ACAATTCTCACAAAACCTTGACTTCCTGTCACAACAACCTTGTGTCTCCA AATGTTTTATTTTTACAGCTTTTCCGAGATAAGGATTTAGCTGCTTTCCT TTGAACCTGTATTGAACTCAGTTATTTGTTGTATTCAAGTATTCTTATCC GAATTCGCTACAAATCCAGTGAGAAAATCACTGCTAAATATACTTTTTCT CAAACAACTTAAAAGGTTGACCTTGCCTTGTTACTTTGACAGGTCTTTGC ATGTTTTAGCCACCAGTTTTGAATGTTGTCAATAAAAGAAATGTCTTTGT AGTTACCACAAACGACTTGTGATCGCCAACATCAATTTGAAAAACATGCT CTATAGACGTTTGCGAATAATTAAATTGTTGGAAATGATTGATTGTTTAT AAGTTTGAAGATTCTTTGTCGAACCGCAAAAGCCATTTTAATTAAAAACT TCTGCTCCCGATGCCAAGAATTTTTCTGATGTTTAGAAAAGTCCAGAAAT TTCATTGGTAGCATTATTCATTTAGTGATATGATATTCTTTGCAAATTCA TCGCTGTTAGAAAAGTAGACGTAAAAAAGATTAGAGCATCGAAAGTGTCA ATCTCAGCGATTTTGTTTTCTTTCCGGTCCTTGAATTATCACTATCTGCA TTTTCTGTGATTTTGCTTTGTTTGCGCGAATTATTCTGCTTTAAGCCATA GATTTTGCTTTGTTAAGTCACAGAATTGATTTAAGATTCTAGCAAGATTT TTAAAACATTGATCCTAAGAATCCAAACTTGTTTTTTGTCTCTGTGATGT CACTTTCCAAAGACGCGGTATATAAAGGAAGGAATATTTGATTCTAAGAA ACGGATTTGATGATCCTTATTCTATGGAAAATTTCCAGAACAACAACTTG AAATCTTTTTCTCTTGAGTTTTGTTTATGCATACAAAGCTTTACATAATA ACAGAGTTGCATTTTTAGCTTGCAATGCCAACTCAGCATTAGATTCAACA ATGTAGTAGGGTCGTTCTAAAATTGGCTGAGTTTTGCATTAGATAAAGTG AACCCGCATTTTCTGATAATCTATCGCAGATAATCTTGATCAAAAGACTT TTTTTCGATCAACTTAATTTTGTAAGCCTCTTTGTTGTATGGAAAGACAA ATGAGTAAATGACGAATGTAATTTTCCGTCACTGTTACATCACAATCGTT CGACCGCTAGACCAATATGGCGGTCAGAGCAGCGATTGTCGTAACTTGTA GTACGTGAAAGGGTTGAGGAGAATGGAGTTTTTATTGACGTCTTTTCAAA TGAAAAAGTAATGATATCAAAATGTTATGTTGTGAAAGTTTTATTAAGAA AAAAAGTTTAGTCAAAAATAGCGCTTGGAACTGTGATTTGCGTAAATTTA TCTTGAACTTTGTTAAGATTAAAGTTATATGTTTTGTGTCAAAAGTCATG ACGCTTTTAAGCAGGGGACAAATTTGAAAATTATCGCTTTAAAGTTTCTG TTGATGTTCACATTAACTTGATGCTTAAATCAACATAGCGAACAAGGTTA TTTGCCGAATAGCAAAAAGCACGATCGGCTGTAGCTTTTTCACAGGACCC TCACAAGAAACCAATAACAATAAAAATGTATTTGGCTTCATGGCGAAGCA AGACAAAAAACATGTAATGTTGATCCATTGTCTTCGGAAAAAAAAGTAAT TAAAACCCCCTTAATTTATCCTTCATCATTTCATAAGAGAATTTCCCCCG TGTTTCGTTTCGATCGTCTTTTTTGATTGACAGCTCGCGATGTCAATTAA GAATGATGTCATTTTGATGTGATGAGGGAATAAAGAGATTGTACGTATAT AAAAACTGTGTTACAACAAGCTCCTCATTTTATTTACAAGGAAGCACAAG TACAGAGAAGACGTGGTGAAAAATAACATTTATATAACCAAGTGAAAGTA GAGAAGGAAAATTTTTGATCAACATGTACGATCATAAGAAGTTGAGCAAT CAACTAGAAACTTTATCCAATAATAATATGAACGCAAAGAAACCCATTCG AATTGTGGTTCTTGGACAGTGTGGTGTTGGGAAAACAGGTACGTTCAATT CCTTACTTTTCTTCACATACTTGATTCTTTGTTTTTAAGTTCTCTATTAA TGATTTACTTTTCATTCAGCTTCTTCGAGTTTTGTCAGATGATCTTATTT TTATTTTTATTTTGTTCCTGCTTTGAAAATTGCTTGATTCAAGTACTGTA TTATCTTTTGACTAGACCTTTCATGAGTGGAATTTCAATGGCAAGTCTTT GGCCTTAGCTTTCATAAATTGGAGTACCCAGGTTTACAGACCTTTTTTGA AATTGAATTTATTTTTCGTTCATTTTAGCATTGGTTTCGAGATGTTTACA AAATACGTTTCCACAAGACTCTTCATCGGGTAAAGACATTTCACATCGAT ACAACATGACAATCAATAAAAAGAAAACCGTTTGTCTCGATATTGTCGAT TTCAACGATAAAAACGACGCACTTATCAGTTGTGCAGATGCTTTTATTAT TTGTTACGCGATAAACGATCGAAAAAGTTTCGAAGCTATCGATGCTTATT TGGACAAAATTGTCGAGGCTAATATAAAAAGTCCTAAAATTGGAATTGTT GGAAATAAAATTGACTTGTATAATGATAGAGAGGTAGCGTCAACAGAAGG ACTCGAACTAGCGAAAGAAATTAACAGTCTATTTTATGAAACGTCAGCTA AAGTTCCCGTTATAGATGTGCGTCAAGTGTTTTATGATTTATATCAATCT TTAAAGAACGCTAAACGATCCAAGAAAGGTAAAAGAGGAAGTATTGAACT TGAATCTTCAGACGTTTTCAGTCTACTGAACTATTCCATTATTAATAATT CGGGCGTCATTGGGCGGTCATCAAACAGCAGTTGTTTCTCAGCTTTACTT AGCGCCCGAAGGAAAAAGTCGCCGCCACCATTATTTGGACGAAGCTGGTC GTCAGAAAGTGTTTAATTGTTAATTGGTTGATTTTCTGATTTAAACGGTC ATGTTTTGGCAATTGCTTAGCAGACTGACTGTCTATCAAAATAATTACAC ATACATAACCTTCTAACCTTGATTTTGTTTTGATTTGTTCCAATTTGAGG ATGGTTACCTAATATATCTTTTTTTGTTTTTGTTGATTTTTAAATTTAAA AAAGAAATATAGAATTTTATTAACGGTTTATAAAAGACATTTAATTTTTT GTGTAAATAACAGAGTTAATATTTATTTATCGGTATTTTATATATATATA TTCACGAAGAAATAAAAAGACAT

Coding sequence (CDS) from alignment at sc0000007:716277..721749-

>TCONS_00001180 ID=TCONS_00001180|Name=TCONS_00001180|organism=Clytia hemisphaerica|type=CDS|length=1506bp|location=Sequence derived from alignment at sc0000007:716277..721749- (Clytia hemisphaerica)
CATTGGTTTCGAGATGTTTACAAAATACGTTTCCACAAGACTCTTCATCG
GGTAAAGACATTTCACATCGATACAACATGACAATCAATAAAAAGAAAAC
CGTTTGTCTCGATATTGTCGATTTCAACGATAAAAACGACGCACTTATCA
GTTGTGCAGATGCTTTTATTATTTGTTACGCGATAAACGATCGAAAAAGT
TTCGAAGCTATCGATGCTTATTTGGACAAAATTGTCGAGGCTAATATAAA
AAGTCCTAAAATTGGAATTGTTGGAAATAAAATTGACTTGTATAATGATA
GAGAGGTAGCGTCAACAGAAGGACTCGAACTAGCGAAAGAAATTAACAGT
CTATTTTATGAAACGTCAGCTAAAGTTCCCGTTATAGATGTGCGTCAAGT
GTTTTATGATTTATATCAATCTTTAAAGAACGCTAAACGATCCAAGAAAG
GTAAAAGAGGAAGTATTGAACTTGAATCTTCAGACGTTTTCAGTCTACTG
AACTATTCCATTATTAATAATTCGGGCGTCATTGGGCGGTCATCAAACAG
CAGTTGTTTCTCAGCTTTACTTAGCGCCCGAAGGAAAAAGTCGCCGCCAC
CATTATTTGGACGAAGCTGGTCGTCAGAAAGTGTTTAAATGTACGATCAT
AAGAAGTTGAGCAATCAACTAGAAACTTTATCCAATAATAATATGAACGC
AAAGAAACCCATTCGAATTGTGGTTCTTGGACAGTGTGGTGTTGGGAAAA
CAGCATTGGTTTCGAGATGTTTACAAAATACGTTTCCACAAGACTCTTCA
TCGGGTAAAGACATTTCACATCGATACAACATGACAATCAATAAAAAGAA
AACCGTTTGTCTCGATATTGTCGATTTCAACGATAAAAACGACGCACTTA
TCAGTTGTGCAGATGCTTTTATTATTTGTTACGCGATAAACGATCGAAAA
AGTTTCGAAGCTATCGATGCTTATTTGGACAAAATTGTCGAGGCTAATAT
AAAAAGTCCTAAAATTGGAATTGTTGGAAATAAAATTGACTTGTATAATG
ATAGAGAGGTAGCGTCAACAGAAGGACTCGAACTAGCGAAAGAAATTAAC
AGTCTATTTTATGAAACGTCAGCTAAAGTTCCCGTTATAGATGTGCGTCA
AGTGTTTTATGATTTATATCAATCTTTAAAGAACGCTAAACGATCCAAGA
AAGGTAAAAGAGGAAGTATTGAACTTGAATCTTCAGACGTTTTCAGTCTA
CTGAACTATTCCATTATTAATAATTCGGGCGTCATTGGGCGGTCATCAAA
CAGCAGTTGTTTCTCAGCTTTACTTAGCGCCCGAAGGAAAAAGTCGCCGC
CACCATTATTTGGACGAAGCTGGTCGTCAGAAAGTGTTTAAATGTACGAT
CATAAGAAGTTGAGCAATCAACTAGAAACTTTATCCAATAATAATATGAA
CGCAAAGAAACCCATTCGAATTGTGGTTCTTGGACAGTGTGGTGTTGGGA
AAACAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000641XLOC_000641Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001180-proteinTCONS_00001180-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001180-exon-sc0000007-1575043694:721702..721749TCONS_00001180-exon-sc0000007-1575043694:721702..721749Clytia hemisphaericaexon
TCONS_00001180-exon-sc0000007-1575043694:717512..717709TCONS_00001180-exon-sc0000007-1575043694:717512..717709Clytia hemisphaericaexon
TCONS_00001180-exon-sc0000007-1575043694:716277..717221TCONS_00001180-exon-sc0000007-1575043694:716277..717221Clytia hemisphaericaexon
TCONS_00001180-exon-sc0000007-1510915933:721702..721749TCONS_00001180-exon-sc0000007-1510915933:721702..721749Clytia hemisphaericaexon
TCONS_00001180-exon-sc0000007-1510915933:717512..717709TCONS_00001180-exon-sc0000007-1510915933:717512..717709Clytia hemisphaericaexon
TCONS_00001180-exon-sc0000007-1510915933:716277..717221TCONS_00001180-exon-sc0000007-1510915933:716277..717221Clytia hemisphaericaexon
TCONS_00001180-exon-sc0000007-1491911889:721702..721749TCONS_00001180-exon-sc0000007-1491911889:721702..721749Clytia hemisphaericaexon
TCONS_00001180-exon-sc0000007-1491911889:717512..717709TCONS_00001180-exon-sc0000007-1491911889:717512..717709Clytia hemisphaericaexon
TCONS_00001180-exon-sc0000007-1491911889:716277..717221TCONS_00001180-exon-sc0000007-1491911889:716277..717221Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:716277..721749 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
5.84367 4.82026 3.06795 2.19105 3.39995 2.95757 2.82834 2.81556 10.476 10.812 11.5664 17.5896 22.5104 12.9007 10.8266 11.0682 14.1844 16.1756 34.1995 33.5483 9.48483 8.62172 40.277 33.1448 5.42908 10.7068 34.1497 26.0493 44.4872 39.5226
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001806Small_GTPase
IPR020849Small_GTPase_Ras
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0007165signal transduction
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007165 signal transduction
cellular_component GO:0016020 membrane
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
Blast
BLAST of TCONS_00001180 vs. Swiss-Prot (Human)
Match: RERG (Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens GN=RERG PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.885e-20
Identity = 57/180 (31.67%), Postives = 100/180 (55.56%), Query Frame = 3
Query:  186 MNAKKPIRIVVLGQCGVGKTALVSRCLQNTFPQDSSSGKDISHRYNMTINKKKTVCLDIVDFNDKNDAL-----ISCADAFIICYAINDRKSFEAIDAYLDKIVEANIKSPK---IGIVGNKIDLYNDREVASTEGLELAKEINSLFYETSAKVPVIDVRQVFYDLYQSLKNAKRSKKGK 701
            M     +++ + G+ GVGK+ALV R L   F  +     + ++R+  TI+ +  V ++I+D   + D +     +   + F++ Y I DR SFE +   L  I++  IK PK   + +VGNK DL + R+V++ EG +LA E+   FYE SA     ++ ++FY+L + ++  +R  +GK
Sbjct:    1 MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDE-VVSMEILDTAGQEDTIQREGHMRWGEGFVLVYDITDRGSFEEV-LPLKNILD-EIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATELACAFYECSACTGEGNITEIFYELCREVRR-RRMVQGK 176          
The following BLAST results are available for this feature:
BLAST of TCONS_00001180 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RERG4.885e-2031.67Ras-related and estrogen-regulated growth inhibito... [more]
back to top