Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001167 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001167
Unique NameTCONS_00001167
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3026

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001167 ID=TCONS_00001167|Name=TCONS_00001167|organism=Clytia hemisphaerica|type=transcript|length=3026bp
CGACTTTCAAACATCTTTTTGTCAGGAAAGAAGAGATCGAAAGATTAGCA
TGCATTTATTACACGTACTTTAAAGTATATACAAAGACAACATGATGGGC
GTTGAGGGCGTCACAAACGAATCGTTCCACCATCAGGGTGAGGACCATCA
ACATCAACACGGAACATCTAAACACGCTGACCTCAAACACCTTCAAGAAC
ATTACGATGAAATCACAGATACAAAACTCCCTGAAAATCTACACCGTGGT
GACATCACAACTGTCAACCGTTTCCTTGGTTACCATGATGCCATGATGGC
TACCTGCGGTACCTTTCTCGTCTTACCATTACGTAATATCAACAACATGG
TCAAAGCAAGTGATTATGACGAGTTAAAAAAGAATCACAAACTGCCCCAT
GACCCTATCGTTGTTGATGATTTAGCTGGTTATCTGGACGCAATGAAAAC
CGAATTCATTATGTTCTTCCTTGGTTTTCTTATTATATGCACGATTTGGG
AGACCAACATCATTCGAACAAACGTCATCAAAAGATACGATGATTTCATG
GTGATANTTGGTTTTCTCATTATTTGCACGATTTGGGAGACCAACATCAT
TCGAACAAACGTCATCAAAAGATACGATGATTTTATGGTCATGCTTGGAC
TCTTCCAGATGGCAGCCATTGTGGTTCTCCCATTCTCCATCGCTTTGAAT
GGTGCATACCCAAGAGAGGATGTGACTGTGCTCCTCACCATAACCATTTT
GATcattatcaacattttcgaacTGATCATGATTTTGTACGGATTCTACT
GTCCAAGGTTGCTCAATATGGCTATGAAAGACTGGAGCAATAAGGAGGTC
CGACGGTTCATGCTGAGAATGTGCATTAAGCCAGTAATGGAGATTCTGCT
GGTTGGAGTGGCAGGGGCTTTCACACTTCTGAATTACCAGATTGCGTGGG
CCATGTTAGCCTTGCTGGTCATTTCTCCGTTGATGCGGAAGTTAGGTTAT
TATTACGAACGCCATCATGTGGGTTACGAGAAGAGAGAAAAATGCCgttt
cttttatttctacaCAAAGGGACAGATCAGTAAAGAGAGAGTGGAAGCTA
TGTCGGATGCAGCGATCGCAATTATAGcctgtgttttgattttggacATC
ACAGTGGAAGACTTCCCTACAAAACATGCTGTCCATGAAGAAGGTCTGAT
CAATGTTTTAAGAGAAATGAAATTCGATTTTGGAGCATTCTTCGGAGCAT
ACTGTGGTGTTTCCATTTTGTGGTACATCAACCACACTGTGCTCAACCTT
TTCCACACTATCGACATTGGTACCTTGTATCTTCAAAAGATCTTCCTagc
tttcctttgttttcttccCATTGTCAATAACATGATGGTAAGATACGGTT
TCGGACAGGAAGGTACGCAAGCGGACCGTCGATTGGCTATTCAATGGTCT
GGTGGAATATCTTTTGCAGCAGGTATCACTCAAACCATGATGGTCGTTTG
GGGATATTTCCGTAAAGAGAAGCTCCTTCACCGTTGGGCCACGTGCAACA
AAAGTGAAATGAATCGCAAGCAACTTTTGTATGTCCGAAGCAAAATTTGC
GCTGTTCCCATTTGGGCGCTTCTTTGTATTTTCTCATCCTTGGCACCAGG
GTCGACGTCAGTCTATCTGCTCCTGGCGTGTGCCGTGGGTAACCTTCTTA
CCATGTTGATCCTGAAGTTCATGTTTATGAACCACATCAATGAGCCAGGT
ATCTCCATCTTCGATCATTCCAATCACGGATCCATACTTTCCAACGGTAG
TGGTTGCGAAATGCGTAAACAGATGAAGCAAGAGATCGCTGATGGTTTCT
ACGATTCAAGAGACCATTCTGCGGGCGAATGTGACCTTCGAAAGGGTATG
GCGGAAGAGATAGCGGATGGGAAAGTTTACCAGGATGAAAATGAGATGGA
GAGAGAAGTTCTGGAAGAGGcggaaaagaaagaaatttaagACGAACAAA
AGGAAGAACGGCAGGAAAATGACATGGCTCAAAACCACCTTCAAGGTGAC
AAGCAAGACACTATCTGTTGACGATTGATCATTGACTGATTCGAGTTTAT
TTGATAATTGATTTTAGGTTATTTCAACAGTAAATATATAACTAAGTAGT
ATTGCATATATTTTTAAGGTTACATTGTTAAGTTATCTTTTCGTAAGTTT
AATTCTTGGATTTTTTACACTCACTATGTCTAACTGAAATTGTACTACTT
TCGTCTCAATTTACACCTCGTCAAATATTTTGGTTTACTTTTCACTTCAA
TCGGAGTCAGTACTTTGTTTACTCACTCCTTTTTCATTTGGATTAGAATT
ACCAAATATTTAAACATTTGTAAAATAAAGATACTGTATAACATATGATT
ATATAATAATAGCATGGCTAAGAATTGGTTTTATTAGAAAGAAACAAATT
TTGCTACGATTCTGTACTTAAAGGGCTCGCCACCTACTTGCCTACTTAAT
TGTAAGTTCAAATAAAAGTGGTATTTACATTTCAGAGGGCGTGCCAAAAA
ATAATGATCGGtgcaaattcaaaatgaagtgAACTGTGCCTAAccttcga
gcatcttcctatttattttactTGAGAAGCATCTTGGGGGAGGGGGGGGC
TTAAAATCTAAAGATTGAAAAGTAttatgaccttgaaatttctaCCAGTG
GTAGGTATGGATGATTGGAGATAATTAGCGTTTGGCCACCTGCCTGATTA
GTACTTCACAGATCAGAATAtaaatttggctaaaatcaCATATTCGCCGA
TTGACTCGTTCGATTTGATTAAAATTTGCTGCTGAAAGCTGGTTTGTCAA
ATAATGCAATCCCTGGATAAAGTAACCAACCCAGTCCTATTGtcggcatt
ttcaaaaaatagcgATGTCATCAGGTAGCGATGAAGGTATCAATAATGCC
AAAAATGTAACCAAGGATGCCAATTCATATAtagaatttcaagtcaattg
gggaatattttcaaagttctcaaatt
Run BLAST on NCBI

protein sequence of TCONS_00001167-protein

>TCONS_00001167-protein ID=TCONS_00001167-protein|Name=TCONS_00001167-protein|organism=Clytia hemisphaerica|type=polypeptide|length=632bp
MMGVEGVTNESFHHQGEDHQHQHGTSKHADLKHLQEHYDEITDTKLPENL
HRGDITTVNRFLGYHDAMMATCGTFLVLPLRNINNMVKASDYDELKKNHK
LPHDPIVVDDLAGYLDAMKTEFIMFFLGFLIICTIWETNIIRTNVIKRYD
DFMVIXGFLIICTIWETNIIRTNVIKRYDDFMVMLGLFQMAAIVVLPFSI
ALNGAYPREDVTVLLTITILIIINIFELIMILYGFYCPRLLNMAMKDWSN
KEVRRFMLRMCIKPVMEILLVGVAGAFTLLNYQIAWAMLALLVISPLMRK
LGYYYERHHVGYEKREKCRFFYFYTKGQISKERVEAMSDAAIAIIACVLI
LDITVEDFPTKHAVHEEGLINVLREMKFDFGAFFGAYCGVSILWYINHTV
LNLFHTIDIGTLYLQKIFLAFLCFLPIVNNMMVRYGFGQEGTQADRRLAI
QWSGGISFAAGITQTMMVVWGYFRKEKLLHRWATCNKSEMNRKQLLYVRS
KICAVPIWALLCIFSSLAPGSTSVYLLLACAVGNLLTMLILKFMFMNHIN
EPGISIFDHSNHGSILSNGSGCEMRKQMKQEIADGFYDSRDHSAGECDLR
KGMAEEIADGKVYQDENEMEREVLEEAEKKEI
Run BLAST on NCBI

transcript from alignment at sc0000007:650377..653654-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001167 ID=TCONS_00001167|Name=TCONS_00001167|organism=Clytia hemisphaerica|type=transcript|length=3278bp|location=Sequence derived from alignment at sc0000007:650377..653654- (Clytia hemisphaerica)
CGACTTTCAAACATCTTTTTGTCAGGAAAGAAGAGATCGAAAGATTAGCA TGCATTTATTACACGTACTTTAAAGTATATACAAAGACAACATGGTATAG ATTTCAGTCTTATTCAAATAGTTTAGAATAGTCCCTTATTTCTGACTCCC GACTTCCCTCTCAGTCACATTATATACAACTTATTCAGACATCATTTCTG CTCCAAGAGGACTCAACCCAAATATTCTCTTTTTGTAGATGGGCGTTGAG GGCGTCACAAACGAATCGTTCCACCATCAGGGTGAGGACCATCAACATCA ACACGGAACATCTAAACACGCTGACCTCAAACACCTTCAAGAACATTACG ATGAAATCACAGATACAAAACTCCCTGAAAATCTACACCGTGGTGACATC ACAACTGTCAACCGTTTCCTTGGTTACCATGATGCCATGATGGCTACCTG CGGTACCTTTCTCGTCTTACCATTACGTAATATCAACAACATGGTCAAAG CAAGTGATTATGACGAGTTAAAAAAGAATCACAAACTGCCCCATGACCCT ATCGTTGTTGATGATTTAGCTGGTTATCTGGACGCAATGAAAACCGAATT CATTATGTTCTTCCTTGGTTTTCTTATTATATGCACGATTTGGGAGACCA ACATCATTCGAACAAACGTCATCAAAAGATACGATGATTTCATGGTGATA NTTGGTTTTCTCATTATTTGCACGATTTGGGAGACCAACATCATTCGAAC AAACGTCATCAAAAGATACGATGATTTTATGGTCATGCTTGGACTCTTCC AGATGGCAGCCATTGTGGTTCTCCCATTCTCCATCGCTTTGAATGGTGCA TACCCAAGAGAGGATGTGACTGTGCTCCTCACCATAACCATTTTGATCAT TATCAACATTTTCGAACTGATCATGATTTTGTACGGATTCTACTGTCCAA GGTTGCTCAATATGGCTATGAAAGACTGGAGCAATAAGGAGGTCCGACGG TTCATGCTGAGAATGTGCATTAAGCCAGTAATGGAGATTCTANGATTCTA CTGTCCAAGGTTGCTCAATATGGCCATGAAAGACTGGAGCAATAAGGAGG TCCGACGGTTCATGCTGAGAATGTGCATTAAGCCAGTAATGGAGATTCTG CTGGTTGGAGTGGCAGGGGCTTTCACACTTCTGAATTACCAGATTGCGTG GGCCATGTTAGCCTTGCTGGTCATTTCTCCGTTGATGCGGAAGTTAGGTT ATTATTACGAACGCCATCATGTGGGTTACGAGAAGAGAGAAAAATGCCGT TTCTTTTATTTCTACACAAAGGGACAGATCAGTAAAGAGAGAGTGGAAGC TATGTCGGATGCAGCGATCGCAATTATAGCCTGTGTTTTGATTTTGGACA TCACAGTGGAAGACTTCCCTACAAAACATGCTGTCCATGAAGAAGGTCTG ATCAATGTTTTAAGAGAAATGAAATTCGATTTTGGAGCATTCTTCGGAGC ATACTGTGGTGTTTCCATTTTGTGGTACATCAACCACACTGTGCTCAACC TTTTCCACACTATCGACATTGGTACCTTGTATCTTCAAAAGATCTTCCTA GCTTTCCTTTGTTTTCTTCCCATTGTCAATAACATGATGGTAAGATACGG TTTCGGACAGGAAGGTACGCAAGCGGACCGTCGATTGGCTATTCAATGGT CTGGTGGAATATCTTTTGCAGCAGGTATCACTCAAACCATGATGGTCGTT TGGGGATATTTCCGTAAAGAGAAGCTCCTTCACCGTTGGGCCACGTGCAA CAAAAGTGAAATGAATCGCAAGCAACTTTTGTATGTCCGAAGCAAAATTT GCGCTGTTCCCATTTGGGCGCTTCTTTGTATTTTCTCATCCTTGGCACCA GGGTCGACGTCAGTCTATCTGCTCCTGGCGTGTGCCGTGGGTAACCTTCT TACCATGTTGATCCTGAAGTTCATGTTTATGAACCACATCAATGAGCCAG GTATCTCCATCTTCGATCATTCCAATCACGGATCCATACTTTCCAACGGT AGTGGTTGCGAAATGCGTAAACAGATGAAGCAAGAGATCGCTGATGGTTT CTACGATTCAAGAGACCATTCTGCGGGCGAATGTGACCTTCGAAAGGGTA TGGCGGAAGAGATAGCGGATGGGAAAGTTTACCAGGATGAAAATGAGATG GAGAGAGAAGTTCTGGAAGAGGCGGAAAAGAAAGAAATTTAAGACGAACA AAAGGAAGAACGGCAGGAAAATGACATGGCTCAAAACCACCTTCAAGGTG ACAAGCAAGACACTATCTGTTGACGATTGATCATTGACTGATTCGAGTTT ATTTGATAATTGATTTTAGGTTATTTCAACAGTAAATATATAACTAAGTA GTATTGCATATATTTTTAAGGTTACATTGTTAAGTTATCTTTTCGTAAGT TTAATTCTTGGATTTTTTACACTCACTATGTCTAACTGAAATTGTACTAC TTTCGTCTCAATTTACACCTCGTCAAATATTTTGGTTTACTTTTCACTTC AATCGGAGTCAGTACTTTGTTTACTCACTCCTTTTTCATTTGGATTAGAA TTACCAAATATTTAAACATTTGTAAAATAAAGATACTGTATAACATATGA TTATATAATAATAGCATGGCTAAGAATTGGTTTTATTAGAAAGAAACAAA TTTTGCTACGATTCTGTACTTAAAGGGCTCGCCACCTACTTGCCTACTTA ATTGTAAGTTCAAATAAAAGTGGTATTTACATTTCAGAGGGCGTGCCAAA AAATAATGATCGGTGCAAATTCAAAATGAAGTGAACTGTGCCTAACCTTC GAGCATCTTCCTATTTATTTTACTTGAGAAGCATCTTGGGGGAGGGGGGG GCTTAAAATCTAAAGATTGAAAAGTATTATGACCTTGAAATTTCTACCAG TGGTAGGTATGGATGATTGGAGATAATTAGCGTTTGGCCACCTGCCTGAT TAGTACTTCACAGATCAGAATATAAATTTGGCTAAAATCACATATTCGCC GATTGACTCGTTCGATTTGATTAAAATTTGCTGCTGAAAGCTGGTTTGTC AAATAATGCAATCCCTGGATAAAGTAACCAACCCAGTCCTATTGTCGGCA TTTTCAAAAAATAGCGATGTCATCAGGTAGCGATGAAGGTATCAATAATG CCAAAAATGTAACCAAGGATGCCAATTCATATATAGAATTTCAAGTCAAT TGGGGAATATTTTCAAAGTTCTCAAATT

Coding sequence (CDS) from alignment at sc0000007:650377..653654-

>TCONS_00001167 ID=TCONS_00001167|Name=TCONS_00001167|organism=Clytia hemisphaerica|type=CDS|length=5697bp|location=Sequence derived from alignment at sc0000007:650377..653654- (Clytia hemisphaerica)
GTCCGACGGTTCATGCTGAGAATGTGCATTAAGCCAGTAATGGAGATTCT
GCTGGTTGGAGTGGCAGGGGCTTTCACACTTCTGAATTACCAGATTGCGT
GGGCCATGTTAGCCTTGCTGGTCATTTCTCCGTTGATGCGGAAGTTAGGT
TATTATTACGAACGCCATCATGTGGGTTACGAGAAGAGAGAAAAATGCCG
TTTCTTTTATTTCTACACAAAGGGACAGATCAGTAAAGAGAGAGTGGAAG
CTATGTCGGATGCAGCGATCGCAATTATAGCCTGTGTTTTGATTTTGGAC
ATCACAGTGGAAGACTTCCCTACAAAACATGCTGTCCATGAAGAAGGTCT
GATCAATGTTTTAAGAGAAATGAAATTCGATTTTGGAGCATTCTTCGGAG
CATACTGTGGTGTTTCCATTTTGTGGTACATCAACCACACTGTGCTCAAC
CTTTTCCACACTATCGACATTGGTACCTTGTATCTTCAAAAGATCTTCCT
AGCTTTCCTTTGTTTTCTTCCCATTGTCAATAACATGATGGTAAGATACG
GTTTCGGACAGGAAGGTACGCAAGCGGACCGTCGATTGGCTATTCAATGG
TCTGGTGGAATATCTTTTGCAGCAGGTATCACTCAAACCATGATGGTCGT
TTGGGGATATTTCCGTAAAGAGAAGCTCCTTCACCGTTGGGCCACGTGCA
ACAAAAGTGAAATGAATCGCAAGCAACTTTTGTATGTCCGAAGCAAAATT
TGCGCTGTTCCCATTTGGGCGCTTCTTTGTATTTTCTCATCCTTGGCACC
AGGGTCGACGTCAGTCTATCTGCTCCTGGCGTGTGCCGTGGGTAACCTTC
TTACCATGTTGATCCTGAAGTTCATGTTTATGAACCACATCAATGAGCCA
GGTATCTCCATCTTCGATCATTCCAATCACGGATCCATACTTTCCAACGG
TAGTGGTTGCGAAATGCGTAAACAGATGAAGCAAGAGATCGCTGATGGTT
TCTACGATTCAAGAGACCATTCTGCGGGCGAATGTGACCTTCGAAAGGGT
ATGGCGGAAGAGATAGCGGATGGGAAAGTTTACCAGGATGAAAATGAGAT
GGAGAGAGAAGTTCTGGAAGAGGCGGAAAAGAAAGAAATTTAAATGGGCG
TTGAGGGCGTCACAAACGAATCGTTCCACCATCAGGGTGAGGACCATCAA
CATCAACACGGAACATCTAAACACGCTGACCTCAAACACCTTCAAGAACA
TTACGATGAAATCACAGATACAAAACTCCCTGAAAATCTACACCGTGGTG
ACATCACAACTGTCAACCGTTTCCTTGGTTACCATGATGCCATGATGGCT
ACCTGCGGTACCTTTCTCGTCTTACCATTACGTAATATCAACAACATGGT
CAAAGCAAGTGATTATGACGAGTTAAAAAAGAATCACAAACTGCCCCATG
ACCCTATCGTTGTTGATGATTTAGCTGGTTATCTGGACGCAATGAAAACC
GAATTCATTATGTTCTTCCTTGGTTTTCTTATTATATGCACGATTTGGGA
GACCAACATCATTCGAACAAACGTCATCAAAAGATACGATGATTTCATGG
TGATANTTGGTTTTCTCATTATTTGCACGATTTGGGAGACCAACATCATT
CGAACAAACGTCATCAAAAGATACGATGATTTTATGGTCATGCTTGGACT
CTTCCAGATGGCAGCCATTGTGGTTCTCCCATTCTCCATCGCTTTGAATG
GTGCATACCCAAGAGAGGATGTGACTGTGCTCCTCACCATAACCATTTTG
ATCATTATCAACATTTTCGAACTGATCATGATTTTGTACGGATTCTACTG
TCCAAGGTTGCTCAATATGGCTATGAAAGACTGGAGCAATAAGGAGATGG
TCCGACGGTTCATGCTGAGAATGTGCATTAAGCCAGTAATGGAGATTCTG
CTGGTTGGAGTGGCAGGGGCTTTCACACTTCTGAATTACCAGATTGCGTG
GGCCATGTTAGCCTTGCTGGTCATTTCTCCGTTGATGCGGAAGTTAGGTT
ATTATTACGAACGCCATCATGTGGGTTACGAGAAGAGAGAAAAATGCCGT
TTCTTTTATTTCTACACAAAGGGACAGATCAGTAAAGAGAGAGTGGAAGC
TATGTCGGATGCAGCGATCGCAATTATAGCCTGTGTTTTGATTTTGGACA
TCACAGTGGAAGACTTCCCTACAAAACATGCTGTCCATGAAGAAGGTCTG
ATCAATGTTTTAAGAGAAATGAAATTCGATTTTGGAGCATTCTTCGGAGC
ATACTGTGGTGTTTCCATTTTGTGGTACATCAACCACACTGTGCTCAACC
TTTTCCACACTATCGACATTGGTACCTTGTATCTTCAAAAGATCTTCCTA
GCTTTCCTTTGTTTTCTTCCCATTGTCAATAACATGATGGTAAGATACGG
TTTCGGACAGGAAGGTACGCAAGCGGACCGTCGATTGGCTATTCAATGGT
CTGGTGGAATATCTTTTGCAGCAGGTATCACTCAAACCATGATGGTCGTT
TGGGGATATTTCCGTAAAGAGAAGCTCCTTCACCGTTGGGCCACGTGCAA
CAAAAGTGAAATGAATCGCAAGCAACTTTTGTATGTCCGAAGCAAAATTT
GCGCTGTTCCCATTTGGGCGCTTCTTTGTATTTTCTCATCCTTGGCACCA
GGGTCGACGTCAGTCTATCTGCTCCTGGCGTGTGCCGTGGGTAACCTTCT
TACCATGTTGATCCTGAAGTTCATGTTTATGAACCACATCAATGAGCCAG
GTATCTCCATCTTCGATCATTCCAATCACGGATCCATACTTTCCAACGGT
AGTGGTTGCGAAATGCGTAAACAGATGAAGCAAGAGATCGCTGATGGTTT
CTACGATTCAAGAGACCATTCTGCGGGCGAATGTGACCTTCGAAAGGGTA
TGGCGGAAGAGATAGCGGATGGGAAAGTTTACCAGGATGAAAATGAGATG
GAGAGAGAAGTTCTGGAAGAGGCGGAAAAGAAAGAAATTTAAATGGGCGT
TGAGGGCGTCACAAACGAATCGTTCCACCATCAGGGTGAGGACCATCAAC
ATCAACACGGAACATCTAAACACGCTGACCTCAAACACCTTCAAGAACAT
TACGATGAAATCACAGATACAAAACTCCCTGAAAATCTACACCGTGGTGA
CATCACAACTGTCAACCGTTTCCTTGGTTACCATGATGCCATGATGGCTA
CCTGCGGTACCTTTCTCGTCTTACCATTACGTAATATCAACAACATGGTC
AAAGCAAGTGATTATGACGAGTTAAAAAAGAATCACAAACTGCCCCATGA
CCCTATCGTTGTTGATGATTTAGCTGGTTATCTGGACGCAATGAAAACCG
AATTCATTATGTTCTTCCTTGGTTTTCTTATTATATGCACGATTTGGGAG
ACCAACATCATTCGAACAAACGTCATCAAAAGATACGATGATTTCATGGT
GATANTTGGTTTTCTCATTATTTGCACGATTTGGGAGACCAACATCATTC
GAACAAACGTCATCAAAAGATACGATGATTTTATGGTCATGCTTGGACTC
TTCCAGATGGCAGCCATTGTGGTTCTCCCATTCTCCATCGCTTTGAATGG
TGCATACCCAAGAGAGGATGTGACTGTGCTCCTCACCATAACCATTTTGA
TCATTATCAACATTTTCGAACTGATCATGATTTTGTACGGATTCTACTGT
CCAAGGTTGCTCAATATGGCTATGAAAGACTGGAGCAATAAGGAGATGGT
CCGACGGTTCATGCTGAGAATGTGCATTAAGCCAGTAATGGAGATTCTGC
TGGTTGGAGTGGCAGGGGCTTTCACACTTCTGAATTACCAGATTGCGTGG
GCCATGTTAGCCTTGCTGGTCATTTCTCCGTTGATGCGGAAGTTAGGTTA
TTATTACGAACGCCATCATGTGGGTTACGAGAAGAGAGAAAAATGCCGTT
TCTTTTATTTCTACACAAAGGGACAGATCAGTAAAGAGAGAGTGGAAGCT
ATGTCGGATGCAGCGATCGCAATTATAGCCTGTGTTTTGATTTTGGACAT
CACAGTGGAAGACTTCCCTACAAAACATGCTGTCCATGAAGAAGGTCTGA
TCAATGTTTTAAGAGAAATGAAATTCGATTTTGGAGCATTCTTCGGAGCA
TACTGTGGTGTTTCCATTTTGTGGTACATCAACCACACTGTGCTCAACCT
TTTCCACACTATCGACATTGGTACCTTGTATCTTCAAAAGATCTTCCTAG
CTTTCCTTTGTTTTCTTCCCATTGTCAATAACATGATGGTAAGATACGGT
TTCGGACAGGAAGGTACGCAAGCGGACCGTCGATTGGCTATTCAATGGTC
TGGTGGAATATCTTTTGCAGCAGGTATCACTCAAACCATGATGGTCGTTT
GGGGATATTTCCGTAAAGAGAAGCTCCTTCACCGTTGGGCCACGTGCAAC
AAAAGTGAAATGAATCGCAAGCAACTTTTGTATGTCCGAAGCAAAATTTG
CGCTGTTCCCATTTGGGCGCTTCTTTGTATTTTCTCATCCTTGGCACCAG
GGTCGACGTCAGTCTATCTGCTCCTGGCGTGTGCCGTGGGTAACCTTCTT
ACCATGTTGATCCTGAAGTTCATGTTTATGAACCACATCAATGAGCCAGG
TATCTCCATCTTCGATCATTCCAATCACGGATCCATACTTTCCAACGGTA
GTGGTTGCGAAATGCGTAAACAGATGAAGCAAGAGATCGCTGATGGTTTC
TACGATTCAAGAGACCATTCTGCGGGCGAATGTGACCTTCGAAAGGGTAT
GGCGGAAGAGATAGCGGATGGGAAAGTTTACCAGGATGAAAATGAGATGG
AGAGAGAAGTTCTGGAAGAGGCGGAAAAGAAAGAAATTTAAATGGGCGTT
GAGGGCGTCACAAACGAATCGTTCCACCATCAGGGTGAGGACCATCAACA
TCAACACGGAACATCTAAACACGCTGACCTCAAACACCTTCAAGAACATT
ACGATGAAATCACAGATACAAAACTCCCTGAAAATCTACACCGTGGTGAC
ATCACAACTGTCAACCGTTTCCTTGGTTACCATGATGCCATGATGGCTAC
CTGCGGTACCTTTCTCGTCTTACCATTACGTAATATCAACAACATGGTCA
AAGCAAGTGATTATGACGAGTTAAAAAAGAATCACAAACTGCCCCATGAC
CCTATCGTTGTTGATGATTTAGCTGGTTATCTGGACGCAATGAAAACCGA
ATTCATTATGTTCTTCCTTGGTTTTCTTATTATATGCACGATTTGGGAGA
CCAACATCATTCGAACAAACGTCATCAAAAGATACGATGATTTCATGGTG
ATANTTGGTTTTCTCATTATTTGCACGATTTGGGAGACCAACATCATTCG
AACAAACGTCATCAAAAGATACGATGATTTTATGGTCATGCTTGGACTCT
TCCAGATGGCAGCCATTGTGGTTCTCCCATTCTCCATCGCTTTGAATGGT
GCATACCCAAGAGAGGATGTGACTGTGCTCCTCACCATAACCATTTTGAT
CATTATCAACATTTTCGAACTGATCATGATTTTGTACGGATTCTACTGTC
CAAGGTTGCTCAATATGGCTATGAAAGACTGGAGCAATAAGGAGATG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000634XLOC_000634Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001167-proteinTCONS_00001167-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001167-exon-sc0000007-1575043694:653561..653654TCONS_00001167-exon-sc0000007-1575043694:653561..653654Clytia hemisphaericaexon
TCONS_00001167-exon-sc0000007-1575043694:652664..653416TCONS_00001167-exon-sc0000007-1575043694:652664..653416Clytia hemisphaericaexon
TCONS_00001167-exon-sc0000007-1575043694:650377..652555TCONS_00001167-exon-sc0000007-1575043694:650377..652555Clytia hemisphaericaexon
TCONS_00001167-exon-sc0000007-1510915933:653561..653654TCONS_00001167-exon-sc0000007-1510915933:653561..653654Clytia hemisphaericaexon
TCONS_00001167-exon-sc0000007-1510915933:652664..653416TCONS_00001167-exon-sc0000007-1510915933:652664..653416Clytia hemisphaericaexon
TCONS_00001167-exon-sc0000007-1510915933:650377..652555TCONS_00001167-exon-sc0000007-1510915933:650377..652555Clytia hemisphaericaexon
TCONS_00001167-exon-sc0000007-1491911889:653561..653654TCONS_00001167-exon-sc0000007-1491911889:653561..653654Clytia hemisphaericaexon
TCONS_00001167-exon-sc0000007-1491911889:652664..653416TCONS_00001167-exon-sc0000007-1491911889:652664..653416Clytia hemisphaericaexon
TCONS_00001167-exon-sc0000007-1491911889:650377..652555TCONS_00001167-exon-sc0000007-1491911889:650377..652555Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:650377..653654 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.0413879 0.0304575 0.0139509 0.115484 0 0.249069 0.131172 0.418781 0.255278 0.369829 1.643 15.8375 13.0334 2.04449 4.09949 0.98343 1.55134 20.0603 8.63113 6.30099 9.71092 1.38686 2.41014 2.41651 2.16887 4.29668 6.59447 0.150564 0.211085
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR010617TMEM175
Vocabulary: Molecular Function
TermDefinition
GO:0005267potassium channel activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005267 potassium channel activity
Blast
BLAST of TCONS_00001167 vs. Swiss-Prot (Human)
Match: TM175 (Endosomal/lysomomal potassium channel TMEM175 OS=Homo sapiens GN=TMEM175 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.890e-16
Identity = 87/341 (25.51%), Postives = 154/341 (45.16%), Query Frame = 2
Query:  563 FLIICTIWETNIIRTNVIKRYDDFMVMLGLFQMAAIVVLPFSIALNGAYPREDVXXXXXXXXXXXXXXXXXXXXXYGFYCPRLLNMAMKDWSNKEVRRFMLRMCIKPVMEILLVG-----VAGAFTLLNYQIAWAMLALLVISPLMRKLGYYYERHHVGYEKRE--KCRFFYFYTKGQISKERVEAMSDXXXXXXXCVLILDITVEDFPTKHAVHEE---GLINVLREMKFDFGAFFGAYCGVSILWYINHTVLNLFHTIDIGTLYLQKIFLAFLCFLPIVNNMMVRYGFGQEGTQADRRLAIQWSGGISFAAGITQTMMVVWGYFRKEKLLHRWATCNKS 1555
            FLI+   W  +     V+ + DD + +L L  M  I  LP++ +L   +P   + + L    +I I + + +++ Y F+ P LL+  ++  +++ + R       + V+ I+L G      A  F+L    +++ ++  +++ P + K+  +     +G+ +        F F     +SKERVEA SD   AI+A +LILDI  ++ P    V E     L+  L      F A+FG++  V +LW+ +H++             L  + LAF+  LP+       +   Q   + +R   ++ S  I F A I Q  M  W       LLH+  T   S
Sbjct:   85 FLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYR-------RHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFA-RQPRDELER---VRVSCTIIFLASIFQLAM--W----TTALLHQAETLQPS 408          
The following BLAST results are available for this feature:
BLAST of TCONS_00001167 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TM1751.890e-1625.51Endosomal/lysomomal potassium channel TMEM175 OS=H... [more]
back to top