Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001167-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001167-protein
Unique NameTCONS_00001167-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length632

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001167-protein ID=TCONS_00001167-protein|Name=TCONS_00001167-protein|organism=Clytia hemisphaerica|type=polypeptide|length=632bp
MMGVEGVTNESFHHQGEDHQHQHGTSKHADLKHLQEHYDEITDTKLPENL
HRGDITTVNRFLGYHDAMMATCGTFLVLPLRNINNMVKASDYDELKKNHK
LPHDPIVVDDLAGYLDAMKTEFIMFFLGFLIICTIWETNIIRTNVIKRYD
DFMVIXGFLIICTIWETNIIRTNVIKRYDDFMVMLGLFQMAAIVVLPFSI
ALNGAYPREDVTVLLTITILIIINIFELIMILYGFYCPRLLNMAMKDWSN
KEVRRFMLRMCIKPVMEILLVGVAGAFTLLNYQIAWAMLALLVISPLMRK
LGYYYERHHVGYEKREKCRFFYFYTKGQISKERVEAMSDAAIAIIACVLI
LDITVEDFPTKHAVHEEGLINVLREMKFDFGAFFGAYCGVSILWYINHTV
LNLFHTIDIGTLYLQKIFLAFLCFLPIVNNMMVRYGFGQEGTQADRRLAI
QWSGGISFAAGITQTMMVVWGYFRKEKLLHRWATCNKSEMNRKQLLYVRS
KICAVPIWALLCIFSSLAPGSTSVYLLLACAVGNLLTMLILKFMFMNHIN
EPGISIFDHSNHGSILSNGSGCEMRKQMKQEIADGFYDSRDHSAGECDLR
KGMAEEIADGKVYQDENEMEREVLEEAEKKEI
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000634XLOC_000634Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001167TCONS_00001167Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR010617TMEM175
Vocabulary: Molecular Function
TermDefinition
GO:0005267potassium channel activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005267 potassium channel activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 610..630
IPR010617Endosomal/lysomomal potassium channel TMEM175PFAMPF06736DUF1211coord: 333..426
e-value: 7.8E-13
score: 48.6

Blast
BLAST of TCONS_00001167-protein vs. Swiss-Prot (Human)
Match: TM175 (Endosomal/lysomomal potassium channel TMEM175 OS=Homo sapiens GN=TMEM175 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 2.767e-23
Identity = 87/341 (25.51%), Postives = 154/341 (45.16%), Query Frame = 0
Query:  158 FLIICTIWETNIIRTNVIKRYDDFMVMLGLFQMAAIVVLPFSIALNGAYPREDVTVLLTITILIIINIFELIMILYGFYCPRLLNMAMKDWSNKEVRRFMLRMCIKPVMEILLVG-----VAGAFTLLNYQIAWAMLALLVISPLMRKLGYYYERHHVGYEKRE--KCRFFYFYTKGQISKERVEAMSDAAIAIIACVLILDITVEDFPTKHAVHEE---GLINVLREMKFDFGAFFGAYCGVSILWYINHTVLNLFHTIDIGTLYLQKIFLAFLCFLPIVNNMMVRYGFGQEGTQADRRLAIQWSGGISFAAGITQTMMVVWGYFRKEKLLHRWATCNKS 488
            FLI+   W  +     V+ + DD + +L L  M  I  LP++ +L   +P   + + L    +I I + + +++ Y F+ P LL+  ++  +++ + R       + V+ I+L G      A  F+L    +++ ++  +++ P + K+  +     +G+ +        F F     +SKERVEA SD   AI+A +LILDI  ++ P    V E     L+  L      F A+FG++  V +LW+ +H++             L  + LAF+  LP+       +   Q   + +R   ++ S  I F A I Q  M  W       LLH+  T   S
Sbjct:   85 FLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYR-------RHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFA-RQPRDELER---VRVSCTIIFLASIFQLAM--W----TTALLHQAETLQPS 408          
The following BLAST results are available for this feature:
BLAST of TCONS_00001167-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TM1752.767e-2325.51Endosomal/lysomomal potassium channel TMEM175 OS=H... [more]
back to top